BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4644

Length=1630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57272.1|  elongation factor 1-alpha                              519   0.0     Ipomoea nil [qian niu]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                518   0.0     
gb|KHG26926.1|  Elongation factor 1-alpha                               519   0.0     Gossypium arboreum [tree cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      519   0.0     Gossypium hirsutum [American cotton]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          518   0.0     Nicotiana tomentosiformis
gb|ABA12221.1|  translation elongation factor 1A-5                      519   0.0     Gossypium hirsutum [American cotton]
gb|KHG23927.1|  Elongation factor 1-alpha                               519   0.0     Gossypium arboreum [tree cotton]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               520   0.0     Vitis vinifera
dbj|BAA34348.1|  elongation factor-1 alpha                              519   0.0     Nicotiana paniculata
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          521   0.0     
gb|ABV26710.1|  elongation factor 1 alpha                               513   0.0     Gerbera hybrid cultivar
gb|ABA12219.1|  translation elongation factor 1A-3                      519   0.0     Gossypium hirsutum [American cotton]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    519   0.0     
gb|ABA12223.1|  translation elongation factor 1A-7                      519   0.0     Gossypium hirsutum [American cotton]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          518   0.0     Eucalyptus grandis [rose gum]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          521   0.0     
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    519   0.0     Theobroma cacao [chocolate]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          519   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG01531.1|  Elongation factor 1-alpha                               519   0.0     Gossypium arboreum [tree cotton]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               518   0.0     Tarenaya hassleriana [spider flower]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          519   0.0     Nelumbo nucifera [Indian lotus]
dbj|BAC23049.1|  Elongation factor 1-alpha                              517   0.0     Solanum tuberosum [potatoes]
dbj|BAA23658.1|  EF-1 alpha                                             514   0.0     Oryza sativa [red rice]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             515   0.0     Citrus clementina [clementine]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    517   0.0     
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          518   0.0     Solanum tuberosum [potatoes]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    511   0.0     Nicotiana tabacum [American tobacco]
gb|ABB86283.1|  elongation factor-1 alpha-like                          517   0.0     Solanum tuberosum [potatoes]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             515   0.0     Citrus clementina [clementine]
gb|AHE76183.1|  elongation factor 1-alpha                               511   0.0     Chrysanthemum indicum
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         518   0.0     Medicago truncatula
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             516   0.0     Solanum tuberosum [potatoes]
gb|AEN79476.1|  elongation factor 1-alpha                               509   0.0     Ziziphus jujuba [Chinese jujube]
dbj|BAM13874.1|  elongation factor 1 alpha                              518   0.0     Symplocarpus renifolius
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          519   0.0     Cicer arietinum [garbanzo]
gb|AGC94754.1|  elongation factor 1 alpha                               514   0.0     Euphorbia lathyris
dbj|BAL14665.1|  elongation factor 1-alpha                              507   0.0     Chrysanthemum seticuspe f. boreale
ref|XP_011655322.1|  PREDICTED: elongation factor 1-alpha-like          511   0.0     Cucumis sativus [cucumbers]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  517   0.0     Solanum tuberosum [potatoes]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    511   0.0     Daucus carota [carrots]
gb|AHZ58493.1|  translation elongation factor alpha                     506   0.0     Syntrichia caninervis
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    493   0.0     Pisum sativum [garden pea]
ref|NP_001104939.1|  elongation factor alpha6                           491   0.0     Zea mays [maize]
ref|NP_001104938.1|  elongation factor 1 alpha                          478   0.0     
gb|AAR82894.1|  elongation factor 1-alpha                               511   0.0     Cichorium intybus [radicchio]
gb|KJB76560.1|  hypothetical protein B456_012G094600                    412   0.0     Gossypium raimondii
gb|AFB18314.1|  translation elongation factor-1 alpha                   476   0.0     Citrus maxima [buntan]
ref|XP_005650451.1|  translation elongation factor                      469   0.0     Coccomyxa subellipsoidea C-169
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       464   0.0     Boodlea coacta
gb|ABQ81935.1|  elongation factor 1-alpha                               437   0.0     Acetabularia acetabulum
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    515   0.0     
gb|ACT36602.1|  elongation factor 1 alpha                               422   0.0     Quercus macrocarpa [burr oak]
gb|ACL97366.1|  elongation factor-1 alpha                               418   0.0     Parvocaulis pusillus
sp|P14963.1|EF1A_EUGGR  RecName: Full=Elongation factor 1-alpha; ...    430   0.0     Euglena gracilis
gb|AAD03711.1|  elongation translation factor 1 alpha                   435   0.0     Cyanophora paradoxa
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    447   0.0     Medicago truncatula
ref|XP_001563777.1|  elongation factor 1-alpha                          430   0.0     Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010697699.1|  elongation factor 1-alpha                          429   0.0     Leishmania panamensis
ref|XP_001464664.1|  elongation factor 1-alpha                          431   0.0     Leishmania infantum JPCM5
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             419   0.0     Poecilia formosa
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Xiphophorus maculatus
ref|XP_003873865.1|  elongation factor 1-alpha                          429   0.0     Leishmania mexicana MHOM/GT/2001/U1103
gb|ESL10875.1|  elongation factor 1-alpha (EF-1-alpha)                  428   0.0     Trypanosoma rangeli SC58
gb|AAX40412.1|  elongation factor 1-alpha                               428   0.0     Trypanosoma rangeli
gb|AHI45318.1|  elongation factor 1 alpha                               429   0.0     Leishmania mexicana mexicana
ref|XP_007252284.1|  PREDICTED: elongation factor 1-alpha 1             422   0.0     
ref|XP_001682258.1|  elongation factor 1-alpha                          429   0.0     Leishmania major strain Friedlin
ref|NP_956303.1|  eukaryotic translation elongation factor 1 alph...    421   0.0     Danio rerio [leopard danio]
ref|XP_003392396.1|  elongation factor 1-alpha                          430   0.0     Leishmania infantum JPCM5
gb|KHN88882.1|  Elongation factor 1-alpha                               416   0.0     Toxocara canis
emb|CCC51155.1|  putative elongation factor 1-alpha                     424   0.0     Trypanosoma vivax Y486
gb|ESL06743.1|  elongation factor 1-alpha                               427   0.0     Trypanosoma rangeli SC58
gb|ESL05580.1|  elongation factor 1-alpha (EF-1-alpha)                  426   0.0     Trypanosoma rangeli SC58
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             419   0.0     Poecilia reticulata
ref|XP_008606624.1|  elongation factor 1-alpha 1                        419   0.0     Saprolegnia diclina VS20
ref|XP_822465.1|  elongation factor 1-alpha                             423   0.0     Trypanosoma brucei brucei TREU927
ref|NP_001167438.1|  Elongation factor 1-alpha 1                        421   0.0     Salmo salar
emb|CCC51157.1|  putative EF-1-alpha                                    423   0.0     Trypanosoma vivax Y486
ref|XP_003963863.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    421   0.0     
ref|XP_005470211.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Oreochromis niloticus
emb|CDI83049.1|  elongation factor 1-alpha, putative                    425   0.0     Eimeria acervulina
ref|XP_008277210.1|  PREDICTED: elongation factor 1-alpha 1             419   0.0     Stegastes partitus
ref|XP_005811264.1|  PREDICTED: elongation factor 1-alpha 1-like ...    419   0.0     Xiphophorus maculatus
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       414   0.0     Ascaris suum
ref|XP_001682260.1|  elongation factor 1-alpha                          426   0.0     Leishmania major strain Friedlin
ref|XP_004077036.1|  PREDICTED: elongation factor 1-alpha 1             419   0.0     Oryzias latipes [Japanese rice fish]
gb|EMF17352.1|  translation elongation factor 1-alpha                   419   0.0     Sphaerulina musiva SO2202
ref|XP_008319518.1|  PREDICTED: elongation factor 1-alpha, somati...    420   0.0     Cynoglossus semilaevis [half-smooth tongue sole]
gb|EKG06689.1|  elongation factor 1-alpha (ef-1-alpha), putative        425   0.0     Trypanosoma cruzi
gb|AIM46986.1|  translation elongation factor 1-alpha                   417   0.0     Colpodella edax
emb|CDJ59653.1|  elongation factor 1-alpha, putative                    422   0.0     Eimeria maxima
ref|XP_008609205.1|  elongation factor 1-alpha 1                        419   0.0     Saprolegnia diclina VS20
ref|XP_008427063.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Poecilia reticulata
gb|ESL09377.1|  elongation factor 1-alpha                               426   0.0     Trypanosoma rangeli SC58
gb|AAU47272.1|  elongation factor alpha G5                              424   0.0     Trypanosoma cruzi
ref|XP_008300933.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Stegastes partitus
gb|ESS66681.1|  elongation factor 1-alpha (ef-1-alpha)                  424   0.0     Trypanosoma cruzi Dm28c
ref|XP_005733783.1|  PREDICTED: elongation factor 1-alpha 1-like ...    419   0.0     Pundamilia nyererei
ref|XP_001896880.1|  elongation factor 1-alpha (EF-1-alpha)             416   0.0     Brugia malayi [agent of lymphatic filariasis]
ref|XP_006638682.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     
gb|AES62596.2|  elongation factor 1-alpha                               431   0.0     Medicago truncatula
ref|XP_004553494.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Maylandia zebra
ref|XP_007551163.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Poecilia formosa
ref|XP_003144331.1|  eukaryotic translation elongation factor 1A        415   0.0     Loa loa
ref|NP_001017795.1|  eukaryotic translation elongation factor 1 a...    420   0.0     Danio rerio [leopard danio]
ref|XP_010779184.1|  PREDICTED: elongation factor 1-alpha               416   0.0     Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 418   0.0     Arthrobotrys oligospora ATCC 24927
emb|CDP93912.1|  Protein Bm5195, isoform g                              416   0.0     Brugia malayi [agent of lymphatic filariasis]
ref|XP_003592345.1|  Elongation factor 1-alpha                          430   0.0     
ref|XP_005746073.1|  PREDICTED: elongation factor 1-alpha 1-like        419   0.0     Pundamilia nyererei
ref|XP_011213301.1|  PREDICTED: elongation factor 1-alpha 1             420   0.0     Bactrocera dorsalis [papaya fruit fly]
gb|EKF38338.1|  elongation factor 1-alpha (ef-1-alpha), putative        424   0.0     Trypanosoma cruzi marinkellei
ref|XP_003438367.1|  PREDICTED: elongation factor 1-alpha 1-like ...    418   0.0     
gb|KJH42648.1|  translation elongation factor EF-1, subunit alpha       419   0.0     Dictyocaulus viviparus
gb|KEH43749.1|  elongation factor 1-alpha                               429   0.0     Medicago truncatula
gb|AFC75715.1|  translation elongation factor 1 alpha                   424   0.0     Trypanosoma cruzi
emb|CAG00281.1|  unnamed protein product                                417   0.0     Tetraodon nigroviridis
gb|AAI54753.1|  Zgc:110335                                              418   0.0     Danio rerio [leopard danio]
gb|ACI02318.1|  elongation factor alpha G5                              424   0.0     Trypanosoma cruzi
ref|XP_819439.1|  elongation factor 1-alpha (EF-1-alpha)                424   0.0     Trypanosoma cruzi strain CL Brener
emb|CCC93415.1|  unnamed protein product                                421   0.0     Trypanosoma congolense IL3000
ref|XP_003879714.1|  elongation factor 1-alpha, related                 417   0.0     Neospora caninum Liverpool
gb|AFC75714.1|  translation elongation factor 1 alpha                   424   0.0     Trypanosoma cruzi
ref|XP_009313968.1|  elongation factor 1-alpha                          418   0.0     Trypanosoma grayi
ref|XP_804709.1|  elongation factor 1-alpha (EF-1-alpha)                424   0.0     Trypanosoma cruzi strain CL Brener
ref|NP_001032962.1|  elongation factor 1 alpha                          418   0.0     Takifugu rubripes [tiger puffer]
gb|AAI05316.1|  EEF1A1 protein                                          416   0.0     Bos taurus [bovine]
gb|AAX40413.1|  elongation factor 1-alpha                               423   0.0     Trypanosoma rangeli
gb|ACO50117.1|  elongation factor 1 alpha                               419   0.0     Seculamonas ecuadoriensis
ref|XP_006799668.1|  PREDICTED: elongation factor 1-alpha 1-like        417   0.0     Neolamprologus brichardi [lyretail cichlid]
ref|XP_010744212.1|  PREDICTED: elongation factor 1-alpha 1-like        420   0.0     Larimichthys crocea [croceine croaker]
ref|XP_004520688.1|  PREDICTED: elongation factor 1-alpha 1-like        416   0.0     Ceratitis capitata [medfly]
ref|XP_005181516.1|  PREDICTED: elongation factor 1-alpha 1             421   0.0     Musca domestica
ref|NP_571338.1|  elongation factor 1-alpha                             419   0.0     Danio rerio [leopard danio]
emb|CDS13811.1|  Putative Elongation factor 1-alpha (Fragment)          415   0.0     Lichtheimia ramosa
ref|XP_806829.1|  elongation factor 1-alpha (EF-1-alpha)                422   0.0     Trypanosoma cruzi strain CL Brener
emb|CAA34756.1|  unnamed protein product                                415   0.0     Homo sapiens [man]
tpg|DAA05867.1|  TPA: eukaryotic translation elongation factor 1A       418   0.0     Xiphinema index
ref|XP_011194365.1|  PREDICTED: elongation factor 1-alpha 1             417   0.0     Zeugodacus cucurbitae [melon fruit fly]
emb|CDH48285.1|  elongation factor 1-alpha                              415   0.0     Lichtheimia corymbifera JMRC:FSU:9682
gb|AAY85516.1|  eukaryotic translation elongation factor 1 alpha 1      416   0.0     Danio rerio [leopard danio]
emb|CDH55674.1|  elongation factor 1-alpha                              414   0.0     Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005802895.1|  PREDICTED: elongation factor 1-alpha-like          414   0.0     Xiphophorus maculatus
gb|AEZ67032.1|  eukaryotic translation elongation factor a alpha        417   0.0     Strongyloides papillosus
ref|XP_002091158.1|  GE12389                                            417   0.0     Drosophila yakuba
ref|XP_008421113.1|  PREDICTED: elongation factor 1-alpha               414   0.0     Poecilia reticulata
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  407   0.0     
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     407   0.0     Torrubiella hemipterigena
ref|XP_966355.1|  PREDICTED: elongation factor 1-alpha                  412   0.0     Tribolium castaneum [rust-red flour beetle]
gb|AAC01751.1|  elongation factor 1-alpha                               419   0.0     Trypanosoma cruzi
gb|EWC48307.1|  elongation factor 1-alpha                               418   0.0     Drechslerella stenobrocha 248
ref|XP_002369268.1|  elongation factor 1-alpha, putative                415   0.0     Toxoplasma gondii ME49
ref|XP_002604724.1|  hypothetical protein BRAFLDRAFT_58879              417   0.0     Branchiostoma floridae
dbj|BAN33726.1|  elongation factor 1alpha                               426   0.0     Eukaryota sp. PCbi66
gb|AAO49408.1|AF485331_1  elongation factor 1-alpha                     419   0.0     Cyprinus carpio [carp]
ref|XP_002059330.1|  GJ17887                                            418   0.0     Drosophila virilis
ref|XP_005993968.1|  PREDICTED: elongation factor 1-alpha, oocyte...    410   0.0     Latimeria chalumnae
gb|KIW01140.1|  elongation factor 1-alpha                               416   0.0     Verruconis gallopava
ref|XP_001551786.1|  elongation factor 1-alpha                          415   0.0     Botrytis cinerea B05.10
emb|CEF65912.1|  Elongation factor 1-alpha                              417   0.0     Strongyloides ratti
gb|ESZ89813.1|  elongation factor 1-alpha                               416   0.0     Sclerotinia borealis F-4128
ref|NP_477375.1|  elongation factor 1alpha48D, isoform A                415   0.0     Drosophila melanogaster
emb|CEJ01865.1|  Putative Elongation factor 1-alpha (Fragment)          413   0.0     Rhizopus microsporus
tpg|DAA05874.1|  TPA: eukaryotic translation elongation factor 1A       417   0.0     Strongyloides stercoralis
gb|ACO50116.1|  elongation factor 1 alpha                               418   0.0     Reclinomonas americana
gb|EFX85477.1|  hypothetical protein DAPPUDRAFT_300308                  416   0.0     Daphnia pulex
emb|CDQ66697.1|  unnamed protein product                                417   0.0     Oncorhynchus mykiss
ref|XP_001986652.1|  GH21478                                            416   0.0     Drosophila grimshawi
ref|XP_011502849.1|  PREDICTED: elongation factor 1-alpha               410   0.0     Ceratosolen solmsi marchali
ref|NP_001166227.1|  elongation factor 1-alpha                          411   0.0     Nasonia vitripennis
dbj|BAO56800.1|  elongation factor 1-alpha                              419   0.0     Clarias batrachus
ref|XP_001361821.2|  GA20951                                            417   0.0     Drosophila pseudoobscura pseudoobscura
gb|AAD56406.1|AF184170_1  elongation factor 1-alpha                     416   0.0     Sparus aurata [gilthead bream]
ref|XP_008547400.1|  PREDICTED: elongation factor 1-alpha               414   0.0     Microplitis demolitor
ref|XP_001594091.1|  elongation factor 1-alpha                          416   0.0     Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001959909.1|  GF13105                                            416   0.0     Drosophila ananassae
ref|XP_007671812.1|  hypothetical protein BAUCODRAFT_28973              414   0.0     Baudoinia panamericana UAMH 10762
gb|AAV38607.1|  eukaryotic translation elongation factor 1 alpha 2      417   0.0     synthetic construct
gb|KIO31120.1|  hypothetical protein M407DRAFT_241866                   408   0.0     Tulasnella calospora MUT 4182
gb|EFX85268.1|  hypothetical protein DAPPUDRAFT_300259                  416   0.0     Daphnia pulex
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   405   0.0     Pisolithus tinctorius Marx 270
ref|XP_007921049.1|  hypothetical protein MYCFIDRAFT_209593             412   0.0     Pseudocercospora fijiensis CIRAD86
dbj|BAM29151.1|  elongation factor 1 alpha 1                            416   0.0     Daphnia magna
gb|AAT91089.1|  elongation factor 1-alpha                               420   0.0     Pimephales promelas
ref|XP_011159441.1|  PREDICTED: elongation factor 1-alpha               409   0.0     Solenopsis invicta [imported red fire ant]
ref|XP_003835133.1|  similar to translation elongation factor 1 a...    417   0.0     Leptosphaeria maculans JN3
ref|XP_010890618.1|  PREDICTED: elongation factor 1-alpha 1             416   0.0     
emb|CEG63380.1|  Putative Elongation factor 1-alpha                     411   0.0     Rhizopus microsporus
gb|EPY27955.1|  elongation factor 1-alpha                               412   0.0     Strigomonas culicis
ref|XP_002004478.1|  GI19955                                            416   0.0     Drosophila mojavensis
ref|XP_002066234.1|  GK22048                                            415   0.0     Drosophila willistoni
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    404   0.0     Anthracocystis flocculosa PF-1
ref|XP_007579636.1|  putative elongation factor 1-alpha protein         415   0.0     
gb|KFH42761.1|  Elongation factor 1-alpha-like protein                  409   0.0     Acremonium chrysogenum ATCC 11550
ref|XP_007861104.1|  translation elongation factor 1a                   408   0.0     Gloeophyllum trabeum ATCC 11539
gb|ACO50111.1|  elongation factor 1 alpha                               421   0.0     Histiona aroides
ref|XP_011340017.1|  PREDICTED: elongation factor 1-alpha               409   0.0     Ooceraea biroi
ref|XP_007829723.1|  Elongation factor 1-alpha                          417   0.0     Pestalotiopsis fici W106-1
ref|XP_011644434.1|  PREDICTED: elongation factor 1-alpha               409   0.0     Pogonomyrmex barbatus
ref|XP_011149357.1|  PREDICTED: elongation factor 1-alpha               407   0.0     Harpegnathos saltator
dbj|BAJ15871.1|  elongation factor 1 alpha                              412   0.0     Locusta migratoria
dbj|BAB64567.1|  elongation factor-1 alpha                              418   0.0     Carassius auratus
gb|AAY17225.1|  eukaryotic translation elongation factor 1A             414   0.0     Oscheius tipulae
dbj|GAM88379.1|  hypothetical protein ANO11243_064120                   415   0.0     fungal sp. No.11243
emb|CEG69500.1|  Putative Elongation factor 1-alpha                     411   0.0     Rhizopus microsporus
ref|XP_001930631.1|  elongation factor 1-alpha                          416   0.0     Pyrenophora tritici-repentis Pt-1C-BFP
gb|EUN23392.1|  hypothetical protein COCVIDRAFT_40940                   417   0.0     Bipolaris victoriae FI3
gb|AFO66284.1|  elongation factor-1a                                    416   0.0     Pyrenophora teres f. maculata
gb|EMD90278.1|  hypothetical protein COCHEDRAFT_1139445                 417   0.0     Bipolaris maydis C5
emb|CCJ09439.1|  elongation factor 1 alpha                              412   0.0     Phaedon cochleariae [mustard leaf beetle]
gb|KFH71585.1|  elongation factor 1-alpha                               411   0.0     Mortierella verticillata NRRL 6337
gb|AEE61578.1|  unknown                                                 414   0.0     Dendroctonus ponderosae
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   403   0.0     Suillus luteus UH-Slu-Lm8-n1
emb|CBY09087.1|  unnamed protein product                                412   0.0     Oikopleura dioica
dbj|BAJ15870.1|  elongation factor 1 alpha                              412   0.0     Gryllus bimaculatus
gb|AAX40342.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
gb|EIE83783.1|  elongation factor 1-alpha                               408   0.0     Rhizopus delemar RA 99-880
sp|P28295.1|EF1A_ABSGL  RecName: Full=Elongation factor 1-alpha; ...    410   0.0     Absidia glauca
ref|XP_011304459.1|  PREDICTED: elongation factor 1-alpha               409   0.0     Fopius arisanus
tpg|DAA05872.1|  TPA: eukaryotic translation elongation factor 1A       410   0.0     Pristionchus pacificus
ref|XP_011561146.1|  PREDICTED: elongation factor 1-alpha               410   0.0     Plutella xylostella [cabbage moth]
gb|ACO50114.1|  elongation factor 1 alpha                               414   0.0     Malawimonas californiana
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    405   0.0     Pyronema omphalodes CBS 100304
ref|XP_007703566.1|  hypothetical protein COCSADRAFT_29782              417   0.0     Bipolaris sorokiniana ND90Pr
emb|CCU97773.1|  unnamed protein product                                406   0.0     Malassezia sympodialis ATCC 42132
ref|XP_005980684.1|  PREDICTED: elongation factor 1-alpha 1             413   0.0     Pantholops hodgsonii [Tibetan antelope]
ref|XP_003696535.1|  PREDICTED: elongation factor 1-alpha-like          409   0.0     
emb|CBJ32893.1|  EEF1A2, eukaryotic translation elongation factor...    416   0.0     Ectocarpus siliculosus
gb|AAV84215.1|  elongation factor 1 alpha                               413   0.0     Culicoides sonorensis
gb|AAX40361.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
ref|XP_003492701.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    407   0.0     Bombus impatiens
ref|XP_006569953.1|  PREDICTED: elongation factor 1-alpha isoform X1    409   0.0     Apis mellifera [bee]
dbj|BAO53973.1|  elongation factor 1 alpha                              409   0.0     Paralichthys olivaceus [bastard halibut]
ref|XP_012055308.1|  PREDICTED: elongation factor 1-alpha               407   0.0     Atta cephalotes
sp|Q2HJN6.1|EF1A3_OSCTI  RecName: Full=Elongation factor 1-alpha ...    414   0.0     Oscheius tipulae
emb|CAA29993.1|  EF-1-alpha                                             408   0.0     Drosophila melanogaster
gb|ADK90074.1|  elongation factor 1 alpha                               413   0.0     Bodo saltans
gb|AAX40345.1|  elongation factor 1-alpha                               411   0.0     Trypanosoma cruzi
ref|XP_003705350.1|  PREDICTED: elongation factor 1-alpha               408   0.0     Megachile rotundata
ref|XP_003037261.1|  translation elongation factor 1a                   405   0.0     Schizophyllum commune H4-8
gb|AFQ55278.1|  elongation factor 1 alpha                               414   0.0     Peltigera malacea
gb|EKG17287.1|  HR1 repeat rho-binding protein                          412   0.0     Macrophomina phaseolina MS6
gb|AAX40350.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
gb|AAX40346.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
ref|XP_003401992.1|  PREDICTED: elongation factor 1-alpha 1             406   0.0     
gb|KFY60178.1|  hypothetical protein V496_05406                         412   0.0     Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|EME49524.1|  translation elongation factor 1 alpha-like protein      410   0.0     Dothistroma septosporum NZE10
ref|XP_011051761.1|  PREDICTED: elongation factor 1-alpha               405   0.0     Acromyrmex echinatior
ref|XP_009154950.1|  elongation factor 1-alpha                          413   0.0     Exophiala dermatitidis NIH/UT8656
ref|XP_308429.3|  AGAP007406-PA                                         412   0.0     Anopheles gambiae str. PEST
gb|AAX40352.1|  elongation factor 1-alpha                               412   0.0     Trypanosoma cruzi
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  407   0.0     Pisolithus microcarpus 441
gb|KFY22405.1|  hypothetical protein V493_06618                         411   0.0     Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|EYC36929.1|  hypothetical protein Y032_0843g2644                     408   0.0     Ancylostoma ceylanicum
gb|AAX40373.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
gb|AAX40370.1|  elongation factor 1-alpha                               413   0.0     Trypanosoma cruzi
gb|AIY54298.1|  elongation factor 1-alpha                               411   0.0     Colaphellus bowringi
gb|ADK46900.1|  elongation factor-1 alpha                               411   0.0     Bactrocera dorsalis [papaya fruit fly]
ref|NP_001014993.1|  elongation factor 1-alpha                          409   0.0     Apis mellifera [bee]
gb|ENN77259.1|  hypothetical protein YQE_06088                          403   0.0     Dendroctonus ponderosae
ref|XP_011493435.1|  AAEL017096-PA                                      409   0.0     Aedes aegypti
emb|CAA31957.1|  unnamed protein product                                405   0.0     Mus musculus [mouse]
ref|XP_007762783.1|  translation elongation factor 1a                   403   0.0     Coniophora puteana RWD-64-598 SS2
gb|KFY34032.1|  hypothetical protein V494_07127                         411   0.0     Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_003297885.1|  hypothetical protein PTT_08441                     411   0.0     
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  402   0.0     Paxillus rubicundulus Ve08.2h10
ref|XP_011878233.1|  PREDICTED: elongation factor 1-alpha               407   0.0     Vollenhovia emeryi
ref|XP_011689513.1|  PREDICTED: elongation factor 1-alpha               407   0.0     Wasmannia auropunctata
gb|AHC00621.1|  tranlation elongation factor                            404   0.0     Ganoderma lucidum
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    403   0.0     Schizophyllum commune
gb|EPY33437.1|  elongation factor 1-alpha                               411   0.0     Angomonas deanei
ref|NP_001107835.1|  elongation factor 1-alpha                          414   0.0     Tribolium castaneum [rust-red flour beetle]
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   404   0.0     Paxillus involutus ATCC 200175
gb|KHJ34692.1|  putative elongation factor 1-alpha                      407   0.0     Erysiphe necator
gb|AAX40383.1|  elongation factor 1-alpha                               412   0.0     Trypanosoma cruzi
gb|EPY34388.1|  elongation factor 1-alpha                               411   0.0     Angomonas deanei
gb|KII93509.1|  hypothetical protein PLICRDRAFT_35732                   406   0.0     Plicaturopsis crispa FD-325 SS-3
gb|KFY10260.1|  hypothetical protein V492_05114                         410   0.0     Pseudogymnoascus sp. VKM F-4246
emb|CDH52802.1|  elongation factor 1-alpha                              416   0.0     Lichtheimia corymbifera JMRC:FSU:9682
sp|Q00251.1|EF1A_AURPU  RecName: Full=Elongation factor 1-alpha; ...    412   0.0     
ref|XP_007359855.1|  translation elongation factor 1a                   405   0.0     
gb|KIN04427.1|  hypothetical protein OIDMADRAFT_17500                   412   0.0     
gb|KFX98133.1|  hypothetical protein V490_02451                         410   0.0     
ref|XP_010351233.1|  PREDICTED: elongation factor 1-alpha               414   0.0     
sp|P02993.2|EF1A_ARTSA  RecName: Full=Elongation factor 1-alpha; ...    409   0.0     
gb|AFQ55277.1|  elongation factor 1 alpha                               411   0.0     
ref|XP_001732312.1|  hypothetical protein MGL_0087                      402   0.0     
gb|KFX94190.1|  hypothetical protein O988_06433                         410   0.0     
dbj|BAH28836.1|  elongation factor 1-alpha                              400   0.0     
gb|KEQ62358.1|  translation elongation factor 1-alpha                   413   0.0     
ref|XP_011269702.1|  PREDICTED: elongation factor 1-alpha               407   0.0     
gb|KIJ45278.1|  hypothetical protein M422DRAFT_30129                    406   0.0     
gb|EMS24917.1|  elongation factor EF-1 alpha subunit                    410   0.0     
gb|EPT04282.1|  hypothetical protein FOMPIDRAFT_1021956                 403   0.0     
gb|AFK49795.1|  elongation factor 1-alpha                               409   0.0     
emb|CCM01949.1|  predicted protein                                      404   0.0     
gb|AFN08747.1|  elongation factor 1A                                    406   0.0     
ref|XP_007295240.1|  putative translation elongation factor 1 alpha     411   0.0     
ref|XP_002181593.1|  predicted protein                                  428   0.0     
ref|XP_008033061.1|  translation elongation factor                      404   0.0     
gb|EPY51446.1|  translation elongation factor EF-1 alpha Ef1a-c         410   0.0     
dbj|BAE91879.1|  elongation factor 1-alpha                              407   0.0     
gb|KFZ00949.1|  hypothetical protein V501_10327                         409   0.0     
ref|XP_008712228.1|  elongation factor 1-alpha                          409   0.0     
dbj|BAF91418.1|  elongation factor 1-alpha                              406   0.0     
gb|AGO46411.1|  elongation factor 1-alpha                               405   0.0     
gb|AAX40363.1|  elongation factor 1-alpha                               410   0.0     
ref|XP_002186303.1|  translation elongation factor, EF-1, alpha s...    428   0.0     
ref|NP_001037510.1|  elongation factor 1-alpha                          414   0.0     
gb|ETN62859.1|  Elongation factor 1-alpha 2                             412   0.0     
ref|XP_007692866.1|  hypothetical protein COCMIDRAFT_41086              412   0.0     
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             400   0.0     
gb|EMD41826.1|  elongation factor 1-alpha                               405   0.0     
gb|KEQ75299.1|  translation elongation factor 1-alpha                   412   0.0     
gb|AAR89978.1|  putative elongation factor 1-alpha                      408   0.0     
gb|ADO51768.1|  elongation factor 1-alpha                               398   0.0     
dbj|BAG30769.1|  elongation factor 1 alpha                              411   0.0     
ref|XP_002126815.1|  PREDICTED: elongation factor 1-alpha, somati...    414   0.0     
ref|XP_002081092.1|  GD10821                                            405   0.0     
gb|KDQ63704.1|  hypothetical protein JAAARDRAFT_29726                   402   0.0     
emb|CCA69108.1|  probable translation elongation factor eEF-1 alp...    404   0.0     
gb|ACV40372.1|  elongation factor 1 alpha                               407   0.0     
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  401   0.0     
emb|CCJ28885.1|  unnamed protein product                                408   0.0     
gb|AAX40353.1|  elongation factor 1-alpha                               410   0.0     
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   401   0.0     
ref|XP_003853076.1|  hypothetical protein MYCGRDRAFT_92705              410   0.0     
gb|AAX40378.1|  elongation factor 1-alpha                               412   0.0     
dbj|BAD35019.1|  elongation factor 1 alpha                              414   0.0     
gb|KDR17161.1|  Elongation factor 1-alpha                               408   0.0     
ref|XP_002173392.1|  translation elongation factor EF-1 alpha Ef1a-c    410   0.0     
gb|ACE82251.1|  elongation factor 1 alpha                               402   0.0     
ref|XP_007712745.1|  hypothetical protein COCCADRAFT_37179              411   0.0     
ref|XP_007852813.1|  elongation factor 1-alpha                          404   0.0     
gb|AJQ24574.1|  translation elongation factor 1-alpha                   407   0.0     
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            401   0.0     
gb|KIW15219.1|  elongation factor 1-alpha                               412   0.0     
ref|XP_007724959.1|  elongation factor 1-alpha                          410   0.0     
gb|AAX40351.1|  elongation factor 1-alpha                               408   0.0     
ref|XP_006862603.1|  PREDICTED: elongation factor 1-alpha 1-like        412   0.0     
gb|ETN61259.1|  elongation factor 1-alpha 1                             412   0.0     
gb|KDQ30740.1|  hypothetical protein PLEOSDRAFT_1070256                 404   0.0     
ref|XP_804708.1|  elongation factor 1-alpha (EF-1-alpha)                409   0.0     
ref|XP_009547250.1|  hypothetical protein HETIRDRAFT_319829             402   0.0     
gb|ABV68853.1|  elongation factor 1 alpha                               412   0.0     
gb|KDN52178.1|  translation elongation factor 1a                        407   0.0     
gb|EPR59423.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         412   0.0     
ref|XP_007729433.1|  elongation factor 1-alpha                          411   0.0     
gb|AJG43843.1|  translation elongation factor EF-1 alpha subunit        410   0.0     
dbj|BAM18878.1|  elongation factor 1 alpha                              410   0.0     
gb|AAX40369.1|  elongation factor 1-alpha                               408   0.0     
ref|XP_007298247.1|  translation elongation factor                      402   0.0     
gb|AFJ44727.1|  elongation factor 1 alpha                               412   0.0     
dbj|BAK08877.2|  elongation factor 1 alpha                              404   0.0     
ref|XP_004924657.1|  PREDICTED: elongation factor 1-alpha 2-like        410   0.0     
gb|AAX40376.1|  elongation factor 1-alpha                               410   0.0     
gb|EPX71797.1|  translation elongation factor EF-1 alpha Ef1a-c         409   0.0     
gb|KIW44491.1|  elongation factor 1-alpha                               413   0.0     
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  400   0.0     
ref|XP_001801902.1|  hypothetical protein SNOG_11663                    408   0.0     
gb|KIL89539.1|  elongation factor 1-alpha                               404   0.0     
ref|XP_007778858.1|  elongation factor 1-alpha                          412   0.0     
emb|CEL58096.1|  elongation factor EF-1 alpha subunit                   404   0.0     
ref|XP_007378612.1|  translation elongation factor 1a                   403   0.0     
ref|XP_003399689.1|  PREDICTED: elongation factor 1-alpha               407   0.0     
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   402   0.0     
gb|ACV83782.1|  elongation factor 1 alpha                               410   0.0     
ref|XP_007753188.1|  elongation factor 1-alpha                          411   0.0     
ref|XP_011558424.1|  PREDICTED: elongation factor 1-alpha 2             410   0.0     
ref|XP_002411147.1|  translation elongation factor EF-1 alpha/Tu,...    409   0.0     
ref|XP_001525782.1|  elongation factor 1-alpha                          407   0.0     
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   401   0.0     
gb|ELR03186.1|  elongation factor 1-alpha                               408   0.0     
gb|EST10147.1|  Elongation factor 1-alpha                               407   0.0     
gb|KEQ92208.1|  hypothetical protein AUEXF2481DRAFT_48016               412   0.0     
ref|XP_008722647.1|  elongation factor 1-alpha                          412   0.0     
ref|XP_002619019.1|  elongation factor 1-alpha                          405   0.0     
gb|KFB51640.1|  hypothetical protein ZHAS_00019716                      412   0.0     
ref|XP_001850845.1|  elongation factor 1-alpha 1                        410   0.0     
gb|EFZ18275.1|  hypothetical protein SINV_00446                         399   0.0     
gb|ESW96056.1|  Elongation factor 1-alpha 1                             407   0.0     
ref|XP_011493325.1|  AAEL017301-PA                                      405   0.0     
gb|AEE62879.1|  unknown                                                 398   0.0     
ref|XP_451929.1|  hypothetical protein                                  405   0.0     
ref|XP_003491912.1|  PREDICTED: elongation factor 1-alpha-like          406   0.0     
gb|KEQ81810.1|  translation elongation factor 1-alpha                   412   0.0     
gb|AAT01102.1|  rpL23-yEF1A fusion protein                              409   0.0     
emb|CAI94748.1|  elongation factor                                      401   0.0     
sp|P41745.1|EF1A_BLAAD  RecName: Full=Elongation factor 1-alpha; ...    404   0.0     
ref|XP_008021877.1|  hypothetical protein SETTUDRAFT_36769              406   0.0     
gb|KIW72886.1|  elongation factor 1-alpha                               408   0.0     
ref|XP_001600781.1|  PREDICTED: elongation factor 1-alpha               407   0.0     
gb|ADJ18332.1|  elongation factor 1 alpha                               412   0.0     
ref|XP_007745174.1|  elongation factor 1-alpha                          409   0.0     
emb|CCG84075.1|  protein of unknown function                            407   0.0     
gb|KIW35226.1|  elongation factor 1-alpha                               412   0.0     
gb|KIK06947.1|  hypothetical protein K443DRAFT_673838                   401   0.0     
sp|Q9HDF6.1|EF1A_PIRIN  RecName: Full=Elongation factor 1-alpha; ...    400   0.0     
gb|EJU01883.1|  translation elongation factor 1a                        406   0.0     
gb|KIW50260.1|  elongation factor 1-alpha                               409   0.0     
emb|CBH32887.1|  elongation factor 1 alpha                              412   0.0     
ref|XP_009541702.1|  hypothetical protein HETIRDRAFT_413587             403   0.0     
emb|CCF54838.1|  probable translation elongation factor eEF-1 alp...    401   0.0     
gb|ADJ18333.1|  elongation factor 1 alpha                               412   0.0     
gb|ACO50113.1|  elongation factor 1 alpha                               417   0.0     
emb|CDO92450.1|  unnamed protein product                                405   0.0     
gb|AJQ24577.1|  translation elongation factor 1-alpha                   407   0.0     
dbj|BAJ90196.1|  predicted protein                                      404   0.0     
gb|AAO60080.1|  translation elongation factor 1-alpha                   407   0.0     
ref|XP_003968866.1|  PREDICTED: elongation factor 1-alpha-like          408   0.0     
gb|KIV89190.1|  elongation factor 1-alpha                               409   0.0     
gb|KJA29192.1|  hypothetical protein HYPSUDRAFT_61224                   401   0.0     
gb|KIP11993.1|  hypothetical protein PHLGIDRAFT_98729                   402   0.0     
gb|AFK73419.1|  elongation factor 1-alpha                               405   0.0     
gb|AEO51761.1|  EF-1a                                                   400   0.0     
emb|CBQ70305.1|  probable translation elongation factor eEF-1 alp...    401   0.0     
ref|XP_006960354.1|  elongation factor                                  402   0.0     
gb|AJN91132.1|  elongation factor 1-alpha                               409   0.0     
ref|XP_562379.1|  AGAP003541-PA                                         409   0.0     
gb|ADO22125.1|  translation elongation factor 1 alpha                   407   0.0     
gb|ADO22126.1|  translation elongation factor 1 alpha                   407   0.0     
emb|CCU75376.1|  elongation factor 1-alpha                              409   0.0     
gb|ADO22128.1|  translation elongation factor 1 alpha                   407   0.0     
gb|KIY01522.1|  elongation factor 1-alpha                               411   0.0     
ref|XP_001873214.1|  predicted protein                                  400   0.0     
gb|KFZ14168.1|  hypothetical protein V502_06193                         405   0.0     
gb|ADB55729.1|  elongation factor 1-alpha                               391   0.0     
gb|EPB85772.1|  elongation factor 1-alpha                               407   0.0     
ref|NP_587757.1|  translation elongation factor EF-1 alpha Ef1a-a       407   0.0     
emb|CDI51837.1|  probable translation elongation factor eEF-1 alp...    400   0.0     
gb|KIM85280.1|  hypothetical protein PILCRDRAFT_96416                   402   0.0     
ref|NP_001011628.1|  elongation factor 1-alpha                          404   0.0     
dbj|BAD02195.1|  translation elongation factor 1 alpha                  410   0.0     
gb|AJQ24596.1|  translation elongation factor 1-alpha                   405   0.0     
ref|XP_003745019.1|  PREDICTED: elongation factor 1-alpha 1-like        410   0.0     
ref|NP_595255.1|  translation elongation factor EF-1 alpha Ef1a-c       407   0.0     
ref|XP_445466.1|  hypothetical protein                                  403   0.0     
dbj|BAO42620.1|  elongation factor 1-alpha                              404   0.0     
gb|EUC65346.1|  elongation factor 1-alpha                               402   0.0     
gb|AAB48400.1|  elongation factor EF-1a                                 409   0.0     
dbj|BAJ92831.1|  predicted protein                                      406   0.0     
emb|CCE43063.1|  hypothetical protein CPAR2_207060                      406   0.0     
gb|KIW88605.1|  elongation factor 1-alpha                               408   0.0     
ref|XP_004205522.1|  PREDICTED: elongation factor 1-alpha-like          404   0.0     
gb|KIM34082.1|  hypothetical protein M408DRAFT_325599                   400   0.0     
ref|XP_008182369.1|  PREDICTED: elongation factor 1-alpha               408   0.0     
ref|XP_011319909.1|  elongation factor 1-alpha                          404   0.0     
ref|XP_002554708.1|  KLTH0F11726p                                       404   0.0     
gb|ADJ18334.1|  elongation factor 1 alpha                               410   0.0     
ref|XP_001244267.1|  hypothetical protein CIMG_03708                    405   0.0     
ref|XP_001851353.1|  conserved hypothetical protein                     406   0.0     
gb|AHW80392.1|  translation elongation factor 1-alpha                   411   0.0     
ref|XP_003068552.1|  elongation factor 1-alpha                          405   0.0     
ref|XP_001625311.1|  predicted protein                                  409   0.0     
ref|XP_001828758.1|  translation elongation factor 1 alpha              399   0.0     
ref|XP_009269781.1|  Elongation factor 1-alpha                          404   0.0     
emb|CEP61575.1|  LALA0S03e05930g1_1                                     406   0.0     
ref|XP_011175393.1|  PREDICTED: elongation factor 1-alpha               402   0.0     
gb|KIM66163.1|  hypothetical protein SCLCIDRAFT_111138                  399   0.0     
ref|XP_002582784.1|  translation elongation factor EF-1, subunit ...    408   0.0     
ref|XP_001948740.2|  PREDICTED: elongation factor 1-alpha-like          408   0.0     
dbj|BAA19867.1|  unnamed protein product                                405   0.0     
ref|XP_004198699.1|  Piso0_002085                                       406   0.0     
ref|XP_007873121.1|  translation elongation factor EF-1, subunit ...    405   0.0     
ref|XP_011257367.1|  PREDICTED: elongation factor 1-alpha               402   0.0     
ref|XP_009263372.1|  EF1A                                               404   0.0     
gb|EGC40796.1|  elongation factor 1-alpha                               403   0.0     
ref|XP_004199548.1|  Piso0_002085                                       405   0.0     
ref|XP_007336965.1|  translation elongation factor                      401   0.0     
dbj|BAE66714.2|  elongation factor 1-alpha                              406   0.0     
gb|EYE99372.1|  translation elongation factor                           400   0.0     
ref|XP_002490864.1|  Translational elongation factor EF-1 alpha         409   0.0     
sp|P14864.1|EF1A2_MUCCL  RecName: Full=Elongation factor 1-alpha;...    405   0.0     
ref|XP_002547526.1|  elongation factor 1-alpha                          407   0.0     
ref|XP_008478125.1|  PREDICTED: elongation factor 1-alpha               407   0.0     
ref|XP_002417435.1|  translation elongation factor 1-alpha, putative    406   0.0     
dbj|BAA11569.1|  elongation factor 1 alpha-A                            405   0.0     
ref|XP_711899.1|  probable translation elongation factor EF-1 alpha     407   0.0     
gb|KIX06427.1|  elongation factor 1-alpha                               405   0.0     
gb|ABD62881.1|  eukaryotic elongation factor 1 alpha                    410   0.0     
dbj|BAH85871.1|  translation elongation factor 1 alpha                  405   0.0     
ref|XP_002418726.1|  ef-1-alpha, putative; elongation factor 1-al...    406   0.0     
ref|NP_001088028.1|  uncharacterized protein LOC494720                  402   0.0     
ref|XP_011386931.1|  putative translation elongation factor EF-1 ...    401   0.0     
gb|AJQ00888.1|  Tef2p                                                   404   0.0     
sp|P06805.1|EF1A1_MUCCL  RecName: Full=Elongation factor 1-alpha;...    404   0.0     
ref|XP_002380898.1|  translation elongation factor EF-1 alpha sub...    404   0.0     
gb|AAT11876.1|  translation elongation factor 1 alpha                   408   0.0     
ref|XP_011696452.1|  PREDICTED: elongation factor 1-alpha               400   0.0     
ref|XP_007803771.1|  Elongation factor 1-alpha                          405   0.0     
ref|XP_717655.1|  probable translation elongation factor EF-1 alpha     406   0.0     
sp|P40911.1|EF1A_AJECG  RecName: Full=Elongation factor 1-alpha; ...    402   0.0     
ref|XP_001536476.1|  translation elongation factor 1-alpha              403   0.0     
ref|XP_006677815.1|  translation elongation factor 1a                   406   0.0     
emb|CDK29620.1|  unnamed protein product                                402   0.0     
sp|P51554.1|EF1A_HYDVU  RecName: Full=Elongation factor 1-alpha; ...    404   0.0     
ref|XP_006729120.1|  PREDICTED: elongation factor 1-alpha 1-like        398   0.0     
dbj|GAK62791.1|  elongation factor 1-alpha                              401   0.0     
ref|XP_007390446.1|  hypothetical protein PHACADRAFT_168368             400   0.0     
gb|KGY15518.1|  elongation factor 1-alpha                               405   0.0     



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   377 bits (968),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/186 (98%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   518 bits (1335),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   374 bits (959),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/186 (96%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   373 bits (957),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/186 (96%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   373 bits (957),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   518 bits (1335),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   373 bits (957),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   372 bits (955),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   371 bits (953),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   520 bits (1339),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 252/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (946),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   370 bits (950),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   521 bits (1342),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (943),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVV+FGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVSFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+P+KPMVVETF+ YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFAAYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   513 bits (1320),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK+RY+EIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPL D
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLLD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   375 bits (964),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/186 (97%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  311   GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (946),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (946),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   368 bits (945),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQ IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   518 bits (1333),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (947),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   521 bits (1342),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   365 bits (938),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSK+DPAK AANFTSQVIIMNHPGQI NGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKEDPAKEAANFTSQVIIMNHPGQISNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (943),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRPTDKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (942),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSK+DP K AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (941),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   518 bits (1335),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (942),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETF E PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFWESPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 252/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMINEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   365 bits (938),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LK GMVVTFGP+GLTTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGILKSGMVVTFGPTGLTTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSK+DPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  371   SGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   517 bits (1331),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   367 bits (943),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   514 bits (1325),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEP RP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPNRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (948),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/186 (96%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   515 bits (1326),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   368 bits (944),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  311   GFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_007027265.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY07767.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=566

 Score =   517 bits (1331),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   366 bits (939),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVD  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDASG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   518 bits (1334),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   511 bits (1316),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD IN+ KRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   370 bits (951),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  371   SGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   517 bits (1331),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   515 bits (1326),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   366 bits (940),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  311   GFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   511 bits (1315),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK+RY+EIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   370 bits (951),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRR
Sbjct  311   GYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   518 bits (1334),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   363 bits (931),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG +KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   516 bits (1330),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   363 bits (931),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 1/187 (1%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHH-EALQEALPGDNVGFNVKNVAVKDLK  1051
             PVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHH EALQEALPGDNVGFNVKNVAVKDLK
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHHEALQEALPGDNVGFNVKNVAVKDLK  310

Query  1052  RGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDR  1231
             RG+VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDR
Sbjct  311   RGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDR  370

Query  1232  RSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV  1411
             RSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+V
Sbjct  371   RSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNV  430

Query  1412  DKKDPTG  1432
             DKKDPTG
Sbjct  431   DKKDPTG  437



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   509 bits (1311),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITI IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIGIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYL+K
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLEK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INE KRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINELKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   370 bits (949),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELE+EPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   518 bits (1333),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 252/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMI+EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMIHEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   361 bits (926),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPGM+VTFGP+GLTTEVKSVEMHHE LQEA PGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGFIKPGMIVTFGPTGLTTEVKSVEMHHETLQEAFPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   519 bits (1336),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   360 bits (923),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VVTF P+GL TEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVLKPGFVVTFAPTGLATEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKEIEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KK+P+G
Sbjct  431   KKEPSG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   514 bits (1324),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK+RY+EIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRR
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG +KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   507 bits (1306),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK+RY+ IVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEVIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   369 bits (948),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRR
Sbjct  311   GYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  371   SGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|XP_011655322.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_011655323.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   511 bits (1316),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSK+RYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD ++EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVHEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   363 bits (933),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AA+FTSQVIIM HPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRR
Sbjct  311   GYVASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDP+G
Sbjct  431   KKDPSG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   517 bits (1332),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   356 bits (913),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTFGP+GL TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMVVTFGPTGLPTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDC  SHIAVKFAE++TKIDRR
Sbjct  311   GFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCTLSHIAVKFAEILTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKE KFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VD
Sbjct  371   SGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVD  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   511 bits (1315),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   362 bits (928),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNV+VKDLKR
Sbjct  251   PVGRVETGTIKPGMVVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVSVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVR MRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRVMRQTVAVGVIKAVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   506 bits (1304),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSKARY+EI KEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERS+NLDWYKGPTLL+ALD ++EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSSNLDWYKGPTLLDALDSVSEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   344 bits (882),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGM+V F P+GLTTEVKSVEMHHE++ EA PGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGVIKPGMLVCFAPTGLTTEVKSVEMHHESMLEAHPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPA+ AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TK+DRR
Sbjct  311   GYVASDSKNDPAREAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLKNGDAGFVK++PTKPM VETF+EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEKEPKFLKNGDAGFVKLIPTKPMTVETFAEYPPLGRFAVRDMRQTVAVGVIKAVE  430

Query  1415  KKDPTG  1432
             KK+ TG
Sbjct  431   KKEATG  436



>sp|Q41011.1|EF1A_PEA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Pisum 
sativum]
 emb|CAA65391.1| elongation factor 1-alpha [Pisum sativum]
Length=447

 Score =   493 bits (1270),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTT H+IYKLGGIDKRVIERFEKEA EMNKRSFKYAW+L
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTVHVIYKLGGIDKRVIERFEKEADEMNKRSFKYAWLL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIAL KFETTKYY TV+DAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALLKFETTKYYSTVMDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK RY+EIVKEVSSYLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKE  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   354 bits (908),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNV FNVKNVAVKDLK 
Sbjct  251   PVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVRFNVKNVAVKDLKH  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GLVASNSKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|NP_001104939.1| elongation factor alpha6 [Zea mays]
 gb|AAF42980.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   491 bits (1264),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 242/253 (96%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAW L
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWAL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPG RDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGPRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSKARY+EIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KI FVPISGFEGDNMIERSTNLDWY GPTLLEA D I EPKRP+DKP+RL LQD
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYNGPTLLEAPDQITEPKRPSDKPMRLALQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGG GTVP G
Sbjct  241  VYKIGGFGTVPVG  253


 Score =   356 bits (913),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KP MVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFN+KNVAVKDLKR
Sbjct  251   PVGRVETGVIKPVMVVTFGPTGLTTEVKSVEMHHEAIQEALPGDNVGFNLKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSKDDLAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKEL +EPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELGEEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>ref|NP_001104938.1| elongation factor 1 alpha [Zea mays]
 gb|AAF42978.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   478 bits (1230),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/253 (92%), Positives = 237/253 (94%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MG EK HI+IVVIG VDSGKSTTTGHLIYKLGG DKRVIERFEKEA EMNKRSFKYAWVL
Sbjct  1    MGNEKSHINIVVIGPVDSGKSTTTGHLIYKLGGFDKRVIERFEKEAPEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERG TIDIALWKFETTKYYCTVIDA GHR FIKNMIT TSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGFTIDIALWKFETTKYYCTVIDARGHRHFIKNMITRTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I E KRP+ KPLRL LQD
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDKITEAKRPSHKPLRLALQD  240

Query  844  VYKIGGIGTVPCG  882
            VY+IGGIGTVP G
Sbjct  241  VYQIGGIGTVPVG  253


 Score =   355 bits (911),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVE GV+KPGMVVTFGP+GLTTEVKSVEM HEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVEAGVIKPGMVVTFGPTGLTTEVKSVEMQHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNS+DDPAK A +FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  311   GFVASNSRDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEKEPKFLK GDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKELEKEPKFLKYGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKDPTG  1432
             KKDPTG
Sbjct  431   KKDPTG  436



>gb|AAR82894.1| elongation factor 1-alpha [Cichorium intybus]
Length=448

 Score =   511 bits (1316),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/251 (97%), Positives = 250/251 (99%), Gaps = 0/251 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSK+RY+EIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVP  876
            VYKIGGIGTVP
Sbjct  241  VYKIGGIGTVP  251


 Score =   304 bits (779),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 163/188 (87%), Gaps = 5/188 (3%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSG--LTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDL  1048
             PV RVETGV+KPGM     PS   +  E KSVEMHHE   + LPGDNVGFNVK  +V DL
Sbjct  251   PVRRVETGVIKPGMS---SPSVHLVDHESKSVEMHHERCLKPLPGDNVGFNVKERSVMDL  307

Query  1049  KRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKID  1228
             KRG VASNS+D PAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  L+TKID
Sbjct  308   KRGXVASNSRDXPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQXLLTKID  367

Query  1229  RRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKS  1408
             RRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV K+
Sbjct  368   RRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVTKN  427

Query  1409  VDKKDPTG  1432
             VDKKDPTG
Sbjct  428   VDKKDPTG  435



>gb|KJB76560.1| hypothetical protein B456_012G094600 [Gossypium raimondii]
Length=425

 Score =   412 bits (1060),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 202/216 (94%), Gaps = 10/216 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMN RSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNNRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDITLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMICCCN          KARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCN----------KARYDEIVKEVSSYLKK  170

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTL  771
            VGYNPEKIPFVPISGFE DNMIERSTNLDWYKGPTL
Sbjct  171  VGYNPEKIPFVPISGFECDNMIERSTNLDWYKGPTL  206


 Score =   392 bits (1006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 201/211 (95%), Gaps = 1/211 (0%)
 Frame = +2

Query  803   RGP-LTSPSVSHSKMCTKLVVLELSPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE  979
             +GP LTS SV H +MCT+L VLELSPVGRVETG+LKPGMV TFGPSGLT EVKSVEMHHE
Sbjct  202   KGPTLTSHSVFHFRMCTRLEVLELSPVGRVETGILKPGMVATFGPSGLTIEVKSVEMHHE  261

Query  980   ALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGY  1159
             +L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AANFTSQVIIMNHP QIGNGY
Sbjct  262   SLTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPAQIGNGY  321

Query  1160  APVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSE  1339
             APVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGFVKM+PTKPMVVETF+E
Sbjct  322   APVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFAE  381

Query  1340  YPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  1432
             YPPLGRFAVRDMRQTVAVGVI+SV+KKDP+G
Sbjct  382   YPPLGRFAVRDMRQTVAVGVIESVEKKDPSG  412



>gb|AFB18314.1| translation elongation factor-1 alpha, partial [Citrus maxima]
Length=394

 Score =   476 bits (1224),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 229/237 (97%), Positives = 234/237 (99%), Gaps = 1/237 (0%)
 Frame = +1

Query  175  SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIAL  354
            SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMN+RSFKYAWVLDKLKAERERGITIDIAL
Sbjct  1    SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNERSFKYAWVLDKLKAERERGITIDIAL  60

Query  355  WKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHA  534
            WKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHA
Sbjct  61   WKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHA  120

Query  535  LLAFTLGVKQMICCCNK-IDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIPFVPISGF  711
            LLAFTLGVKQMICCCNK +DATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+PFVPISGF
Sbjct  121  LLAFTLGVKQMICCCNKQMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGF  180

Query  712  EGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGGIGTVPCG  882
            EGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  181  EGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVG  237


 Score =   315 bits (808),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  235   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  294

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VASNSKDDPA+  ANF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRR
Sbjct  295   GFVASNSKDDPAREVANFPSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRR  354

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLG  1354
             SGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLG
Sbjct  355   SGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLG  394



>ref|XP_005650451.1| translation elongation factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25907.1| translation elongation factor [Coccomyxa subellipsoidea C-169]
Length=446

 Score =   469 bits (1206),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/253 (89%), Positives = 237/253 (94%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H++IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIE+FEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKLHLNIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIEKFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTP  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLA+TLGVKQMI   NK+DAT PKY + RYDEIVKEV +Y+KK
Sbjct  121  GGFEAGISKDGQTREHALLAYTLGVKQMIVALNKMDATEPKYDQKRYDEIVKEVGNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP K+ FVPISGF+GDNMIERSTNL WYKG TLLEALD I+ PKRP+DKPLRLPLQD
Sbjct  181  VGYNPAKVNFVPISGFQGDNMIERSTNLGWYKGLTLLEALDAIDPPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   322 bits (825),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVV F PSGLTTEVKSVEMHHE+L EA PGDNVGFNVKNV+VK+LKR
Sbjct  251   PVGRVETGIIKPGMVVVFAPSGLTTEVKSVEMHHESLPEAAPGDNVGFNVKNVSVKELKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPAK A NFT+QVIIMNHPGQIGNGYAPVLDCHT+HIA KF E+ TKIDRR
Sbjct  311   GFVASDSKNDPAKEATNFTAQVIIMNHPGQIGNGYAPVLDCHTAHIACKFQEITTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELE  PKFLKNGDA +V M+PTKPM VE F+ YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  371   SGKELEAAPKFLKNGDAAYVIMVPTKPMCVEPFTMYPPLGRFAVRDMRQTVAVGVIKAVE  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDASG  436



>dbj|BAK23239.1| eukaryotic translation elongation factor 1 alpha [Boodlea coacta]
Length=446

 Score =   464 bits (1195),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/253 (85%), Positives = 237/253 (94%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M KEK+H+++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIE+FEKEA+EMNKRSFKYAWVL
Sbjct  1    MAKEKLHLNLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIEKFEKEASEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY+CTVIDAPGHRDFIKNMITGT+QADCAVL+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFETPKYFCTVIDAPGHRDFIKNMITGTTQADCAVLMIDSTP  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISK+GQTREHALLAFTLGVKQMICC NK+DAT P YS+ RY+EI KEV +Y+KK
Sbjct  121  GGFEAGISKEGQTREHALLAFTLGVKQMICCTNKMDATEPPYSEKRYEEIQKEVKNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY P+ +PF+PISGF GDNMIERSTN++WYKGPTLLEALD +  PKRP+DKPLRLPLQD
Sbjct  181  VGYKPDAVPFIPISGFNGDNMIERSTNMNWYKGPTLLEALDAVEPPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   309 bits (792),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  L+TEVKSVEMHHEAL EALPGDNVGFNVKNV+VK+LKR
Sbjct  251   PVGRVETGVIKPGMVVTFAPVALSTEVKSVEMHHEALPEALPGDNVGFNVKNVSVKELKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPA G A F +QVIIMNHPGQI NGY PVLDCHTSHIAVKF E+  K+DRR
Sbjct  311   GFVASDSKNDPAMGCAQFKAQVIIMNHPGQISNGYTPVLDCHTSHIAVKFREIQQKVDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+KNGDA FV M PTKPM VE F+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  371   SGKVTEEGPKFIKNGDAAFVMMEPTKPMCVEPFTEYPPLGRFAVRDMRQTVAVGVIKEVE  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDGSG  436



>gb|ABQ81935.1| elongation factor 1-alpha [Acetabularia acetabulum]
Length=430

 Score =   437 bits (1123),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = +1

Query  175  SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIAL  354
            SGKSTTTGHLIYKLGGIDKRVIE+FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIAL
Sbjct  1    SGKSTTTGHLIYKLGGIDKRVIEKFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIAL  60

Query  355  WKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHA  534
            WKFET KY+CTVIDAPGHRDFIKNMITGTSQADCAVL+IDST GGFE+G SKDGQTREH 
Sbjct  61   WKFETPKYHCTVIDAPGHRDFIKNMITGTSQADCAVLMIDSTPGGFESGTSKDGQTREHG  120

Query  535  LLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFE  714
            LLAFTLGVKQMI  CNK+DAT P YS ARY+EI  EVS YLKKVGYNPEKI FVPISGF+
Sbjct  121  LLAFTLGVKQMIVGCNKMDATEPPYSDARYNEIKTEVSKYLKKVGYNPEKINFVPISGFQ  180

Query  715  GDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGGIGTVPCG  882
            GDNM+E+S+N++WYKGPTLLEALDM+  PKRP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  181  GDNMLEKSSNMNWYKGPTLLEALDMVEPPKRPSDKPLRLPLQDVYKIGGIGTVPVG  236


 Score =   320 bits (820),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK++KR
Sbjct  234   PVGRVETGVIKPGMIVTFAPTGLTTEVKSVEMHHEALPEAVPGDNVGFNVKNVSVKEIKR  293

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK DPAKG  NFT+QVIIMNHPGQIGNGY PVLDCHT+HIAVKF ++  K+DRR
Sbjct  294   GYVASDSKSDPAKGCDNFTAQVIIMNHPGQIGNGYQPVLDCHTAHIAVKFKDIQKKVDRR  353

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E+ PKF+KNGDA FV M P+KPMVVE+F+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  354   SGKVVEESPKFIKNGDAAFVIMEPSKPMVVESFTEYPPLGRFAVRDMRQTVAVGVIKKVE  413

Query  1415  KKDPT  1429
             KKDP+
Sbjct  414   KKDPS  418



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   515 bits (1326),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSKARYDEIVKEVSSYLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   237 bits (604),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR
Sbjct  251   PVGRVETGMLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKI  1225
             G+VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKI
Sbjct  311   GFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKI  367



>gb|ACT36602.1| elongation factor 1 alpha [Quercus macrocarpa]
Length=366

 Score =   422 bits (1085),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/208 (96%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = +1

Query  259  AAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITG  438
            AAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITG
Sbjct  1    AAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITG  60

Query  439  TSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKA  618
            TSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKA
Sbjct  61   TSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKA  120

Query  619  RYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINE  798
            RYDEIVKE SSYLKKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INE
Sbjct  121  RYDEIVKEDSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINE  180

Query  799  PKRPTDKPLRLPLQDVYKIGGIGTVPCG  882
            PKRP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  181  PKRPSDKPLRLPLQDVYKIGGIGTVPVG  208


 Score =   320 bits (821),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/161 (95%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTFGP+GL TEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKR
Sbjct  206   PVGRVETGIIKPGMVVTFGPTGLATEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKR  265

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRR
Sbjct  266   GYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRR  325

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGR  1357
             SGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGR
Sbjct  326   SGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGR  366



>gb|ACL97366.1| elongation factor-1 alpha, partial [Parvocaulis pusilla]
Length=422

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = +1

Query  199  HLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY  378
            HLIYKLGGIDKRVIE+FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET KY
Sbjct  1    HLIYKLGGIDKRVIEKFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETPKY  60

Query  379  YCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGV  558
            +CTVIDAPGHRDFIKNMITGTSQADCAVL+IDST GGFEAGISK+GQTREH LLAFTLGV
Sbjct  61   HCTVIDAPGHRDFIKNMITGTSQADCAVLMIDSTPGGFEAGISKEGQTREHGLLAFTLGV  120

Query  559  KQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERS  738
            KQMI   NK+DAT P YS+ARY+EI  EVS YLKKVGYNP+KI FVPISGF+GDNM+E+S
Sbjct  121  KQMIVGTNKMDATEPPYSEARYNEIKTEVSKYLKKVGYNPDKINFVPISGFQGDNMLEKS  180

Query  739  TNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGGIGTVPCG  882
            TN+ WYKGPTLLEALD+I  PKRP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  181  TNMSWYKGPTLLEALDLIEPPKRPSDKPLRLPLQDVYKIGGIGTVPVG  228


 Score =   320 bits (820),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+GLTTEVKSVEMHHEA+ EA+PGDNVGFNVKNV+VK++KR
Sbjct  226   PVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEAMPEAVPGDNVGFNVKNVSVKEIKR  285

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYV S+SK+DPAKG  NF +QVIIMNHPGQIGNGYAPVLDCHT+HIAVKF E+  K+DRR
Sbjct  286   GYVCSDSKNDPAKGCENFMAQVIIMNHPGQIGNGYAPVLDCHTAHIAVKFKEIQQKVDRR  345

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E+ PKF+KNGDA FV M PTKPMVVE F+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  346   SGKVVEEAPKFIKNGDAAFVVMEPTKPMVVEAFTEYPPLGRFAVRDMRQTVAVGVIKKVE  405

Query  1415  KKDP  1426
             KKDP
Sbjct  406   KKDP  409



>sp|P14963.1|EF1A_EUGGR RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Euglena 
gracilis]
 emb|CAA34769.1| unnamed protein product [Euglena gracilis]
Length=445

 Score =   430 bits (1106),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 224/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHIS+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA+EM K SFKYAWVL
Sbjct  1    MGKEKVHISLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEASEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERER ITIDIALWKFET K   T+IDAPGHRDFIKNMITGTSQAD AVL+IDSTT
Sbjct  61   DKLKAERERCITIDIALWKFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLA+TLGVKQMI   NK D  T KYS+ARY+EI KEVS YLKK
Sbjct  121  GGFEAGISKDGQTREHALLAYTLGVKQMIVATNKFDDKTVKYSQARYEEIKKEVSGYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PF+PISG+ GDNMIE S N+ WYKG TL+ ALD +  PKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKVPFIPISGWNGDNMIEASENMGWYKGLTLIGALDNLEPPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VVTF P+ LTTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVLKPGDVVTFAPNNLTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASN+K+DPAK AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFA + TKIDRR
Sbjct  311   GYVASNAKNDPAKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFATIQTKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELE EPKF+K+GDA  V M P KPM VE+F++YPPLG  +  DMRQTVAVGVIKSV+
Sbjct  371   SGKELEAEPKFIKSGDAAIVLMKPQKPMCVESFTDYPPLG-VSCGDMRQTVAVGVIKSVN  429

Query  1415  KKDPTG  1432
             KK+ TG
Sbjct  430   KKENTG  435



>gb|AAD03711.1| elongation translation factor 1 alpha [Cyanophora paradoxa]
Length=451

 Score =   435 bits (1118),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+K HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKQKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEIGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL+I + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVIPAAT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQMI   NK+D  +  Y + R++EI KEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQMIVAVNKMDEKSVNYGQPRFEEIKKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            +GYNP+KIPFVPISGF GDNM+E S+NL WYKGPTL+EALD + EPKRP++KPLRLPLQD
Sbjct  181  IGYNPDKIPFVPISGFNGDNMLEPSSNLGWYKGPTLVEALDQVEEPKRPSEKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGM V F PS +TTEVKSVEMHHE++ EALPGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVIKPGMTVVFAPSAVTTEVKSVEMHHESMPEALPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+ K+DPAK + +F +QVII+NHPGQIG GY+PV+DCHT+HIA KF+EL+TKIDRR
Sbjct  311   GYVASDVKNDPAKESESFVAQVIILNHPGQIGAGYSPVVDCHTAHIACKFSELITKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELE  PKF+K+GDA   +++P KPM VE F+ YPPLGRFAVRDMRQTVAVGVIK V 
Sbjct  371   SGKELEASPKFVKSGDACMARLIPNKPMCVEAFTNYPPLGRFAVRDMRQTVAVGVIKEVV  430

Query  1415  KKDPT  1429
             KK+P+
Sbjct  431   KKEPS  435



>gb|KEH43146.1| elongation factor Tu (EF-Tu) GTP-binding family protein [Medicago 
truncatula]
Length=442

 Score =   447 bits (1151),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 231/253 (91%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M K+KVHI++VVIGHVDSGKSTT GHLIYKLGGI+K VIER EKEA E+NK SFKYAWVL
Sbjct  1    MVKDKVHINVVVIGHVDSGKSTTAGHLIYKLGGIEKDVIERLEKEATEINKPSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+L KFETTKYYCT+IDAPGHRDFIKNMITGTSQADCAVL+IDSTT
Sbjct  61   DKLKAERERGITIDISLSKFETTKYYCTLIDAPGHRDFIKNMITGTSQADCAVLVIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAG S++GQT EHALLAF LGV+QMICCCNK+DATTPKYSK RY+EIVKE S +L  
Sbjct  121  GSFEAGYSQEGQTSEHALLAFVLGVRQMICCCNKMDATTPKYSKDRYEEIVKEFSPFLID  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN ++IPFVPISGFEGDN+IERSTNLDWYKGPTLLEALD I EPKR  DKPLRLPLQD
Sbjct  181  VGYNLDEIPFVPISGFEGDNIIERSTNLDWYKGPTLLEALDQIKEPKRLLDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   285 bits (729),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVE+GVLKPGM VTF P+GL T V S+EMHHE L EALPGD VGFNV++ +VKDL+R
Sbjct  251   PVGRVESGVLKPGMAVTFAPTGLKTLVNSMEMHHEKLNEALPGDIVGFNVQHGSVKDLRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK DPA  AA FTS+VII N  G+I NGY P+LDCHTSH+ VKFA+L+TK DR 
Sbjct  311   GYVASDSKHDPATEAAKFTSRVIITNQTGRIQNGYTPILDCHTSHVPVKFAKLVTKFDRF  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SG E+EKEPKFLKNGDAG VKM+PTK MVVE FS YPPLGRFAVRDMRQTVAVGVI  V 
Sbjct  371   SGLEIEKEPKFLKNGDAGVVKMIPTKSMVVEDFSTYPPLGRFAVRDMRQTVAVGVIMVVK  430

Query  1415  KKDP  1426
             KKDP
Sbjct  431   KKDP  434



>ref|XP_001563777.1| elongation factor 1-alpha [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM37822.1| elongation factor 1-alpha [Leishmania braziliensis MHOM/BR/75/M2904]
Length=449

 Score =   430 bits (1106),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 228/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEMGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T +YS+ARY+EI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVQYSQARYEEISKEVGTYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMI++S ++ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIDKSESMAWYKGPTLLDALDMLEAPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA+PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAVPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FA++ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFADIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++YPPLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYPPLGRFAVRDMRQTVAVGIIKAVS  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>ref|XP_010697699.1| elongation factor 1-alpha [Leishmania panamensis]
 gb|AIN97046.1| elongation factor 1-alpha [Leishmania panamensis]
Length=449

 Score =   429 bits (1103),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 228/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEMGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T +YS++RY+EI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVQYSQSRYEEISKEVGAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMI++S ++ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIDKSESMAWYKGPTLLDALDMLEAPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA+PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAVPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FA++ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFADIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++YPPLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYPPLGRFAVRDMRQTVAVGIIKAVS  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>ref|XP_001464664.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 ref|XP_003392395.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 ref|XP_003392397.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 ref|XP_003392399.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 ref|XP_003392400.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 ref|XP_003859873.1| elongation factor 1-alpha [Leishmania donovani]
 gb|AAL08019.1|AF416379_1 elongation factor 1-alpha [Leishmania donovani]
 emb|CAM59692.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ08554.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ08556.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ08558.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ08559.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ33166.1| elongation factor 1-alpha [Leishmania donovani]
Length=449

 Score =   431 bits (1107),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y+++RYDEI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRYDEISKEVGAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMIERS N+ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKEGSG  436



>ref|XP_007567352.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia formosa]
 ref|XP_007567353.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia formosa]
 ref|XP_007567354.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia formosa]
 ref|XP_007567355.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia formosa]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   307 bits (786),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK PT
Sbjct  443   KKAPT  447



>ref|XP_005805806.1| PREDICTED: elongation factor 1-alpha 1-like [Xiphophorus maculatus]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMAWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   307 bits (786),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK PT
Sbjct  443   KKAPT  447



>ref|XP_003873865.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
 ref|XP_003873866.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
 ref|XP_003873867.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ25359.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ25360.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ25361.1| elongation factor 1-alpha [Leishmania mexicana MHOM/GT/2001/U1103]
Length=449

 Score =   429 bits (1104),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 228/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y+++RYDEI KEVS+YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVMYAQSRYDEISKEVSAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMI++S N+ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIDKSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKESSG  436



>gb|ESL10875.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma rangeli SC58]
Length=482

 Score =   428 bits (1101),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  121  RMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            RMGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWV
Sbjct  33   RMGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWV  92

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S 
Sbjct  93   LDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASA  152

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
             G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS++RY+EI+KEVS+YLK
Sbjct  153  QGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQSRYEEIMKEVSAYLK  212

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  840
            KVGYN EK+ FVPISG++GDNMIE+S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQ
Sbjct  213  KVGYNVEKVRFVPISGWQGDNMIEKSDNMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQ  272

Query  841  DVYKIGGIGTVPCG  882
            DVYKIGGIGTVP G
Sbjct  273  DVYKIGGIGTVPVG  286


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  284   PVGRVETGVMKPGDVVTFSPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  343

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  344   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  403

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  404   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  463

Query  1415  KKD  1423
             KK+
Sbjct  464   KKE  466



>gb|AAX40412.1| elongation factor 1-alpha [Trypanosoma rangeli]
 gb|AAX40414.1| elongation factor 1-alpha [Trypanosoma rangeli]
Length=449

 Score =   428 bits (1101),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/253 (80%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS+ARY+EIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQARYEEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDNMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFSPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>gb|AHI45318.1| elongation factor 1 alpha, partial [Leishmania mexicana mexicana]
Length=449

 Score =   429 bits (1102),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK D  T  Y+++RYDEI KEVS+YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKTDDKTVMYAQSRYDEISKEVSAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMI++S N+ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIDKSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKESSG  436



>ref|XP_007252284.1| PREDICTED: elongation factor 1-alpha 1 [Astyanax mexicanus]
Length=462

 Score =   422 bits (1084),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNPE + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPETVAFVPISGWNGDNMLEASPNMTWFKGWKITRKEGNVSGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAAVFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKNLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPTG  1432
             KK P+G
Sbjct  443   KKAPSG  448



>ref|XP_001682258.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 ref|XP_001682259.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 ref|XP_001682261.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 ref|XP_001682262.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 ref|XP_001682263.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 ref|XP_001682264.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03416.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03417.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03419.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03420.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03421.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CAJ03422.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 emb|CDJ41663.1| elongation factor 1-alpha, putative [Eimeria tenella]
Length=449

 Score =   429 bits (1103),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y+++RYDEI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRYDEISKEVGAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMIE+S N+ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKEGSG  436



>ref|NP_956303.1| eukaryotic translation elongation factor 1 alpha 1-like [Danio 
rerio]
 gb|AAH60907.1| Zgc:73138 [Danio rerio]
Length=462

 Score =   421 bits (1082),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRKEGNAAGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V+M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVEMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKTAT  447



>ref|XP_003392396.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
 emb|CBZ08555.1| elongation factor 1-alpha [Leishmania infantum JPCM5]
Length=503

 Score =   430 bits (1106),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y+++RYDEI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRYDEISKEVGAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMIERS N+ WYKGPTLL+ALDM+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKEGSG  436



>gb|KHN88882.1| Elongation factor 1-alpha [Toxocara canis]
Length=464

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+ R++E+  EVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSETRFNEVTTEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E STN+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPKTVAFVPISGFNGDNMLEPSTNMPWFKGWNVERKEGTATGKTLLEALDSIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   308 bits (789),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKN++VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPQNVTTEVKSVEMHHEALAEALPGDNVGFNVKNISVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK A +FT+QVIIMNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVASDSKNDPAKEAKSFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKFLK+GDAG V+++PTKPM VETF+EY PLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKVEDNPKFLKSGDAGIVELIPTKPMCVETFTEYAPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPTG  1432
             K + TG
Sbjct  443   KTETTG  448



>emb|CCC51155.1| putative elongation factor 1-alpha [Trypanosoma vivax Y486]
Length=455

 Score =   424 bits (1089),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y + RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S  + WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  N+K+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHTSHIA KFAE+ +KIDRR
Sbjct  311   GNVCGNTKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKAIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDGSG  436



>gb|ESL06743.1| elongation factor 1-alpha [Trypanosoma rangeli SC58]
Length=530

 Score =   427 bits (1097),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  121  RMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            RMGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWV
Sbjct  81   RMGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWV  140

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S 
Sbjct  141  LDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASA  200

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
             G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS++RY+EI+KEVS+YLK
Sbjct  201  QGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQSRYEEIMKEVSAYLK  260

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  840
            KVGYN EK+ FVPISG++GDNMIE+S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQ
Sbjct  261  KVGYNVEKVRFVPISGWQGDNMIEKSDNMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQ  320

Query  841  DVYKIGGIGTVPCG  882
            DVYKIGGIGTVP G
Sbjct  321  DVYKIGGIGTVPVG  334


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  332   PVGRVETGVMKPGDVVTFSPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  391

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  392   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  451

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  452   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  511

Query  1415  KKD  1423
             KK+
Sbjct  512   KKE  514



>gb|ESL05580.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma rangeli SC58]
Length=449

 Score =   426 bits (1096),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS++RY+EI+KEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQSRYEEIMKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDNMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFSPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>ref|XP_008404506.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia reticulata]
 ref|XP_008404509.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia reticulata]
 ref|XP_008404514.1| PREDICTED: elongation factor 1-alpha 1 [Poecilia reticulata]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   304 bits (779),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKAAT  447



>ref|XP_008606624.1| elongation factor 1-alpha 1 [Saprolegnia diclina VS20]
 gb|EQC40150.1| elongation factor 1-alpha 1 [Saprolegnia diclina VS20]
Length=442

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M KEK+HIS+VVIGHVD+GKSTTTGHLIYK GGIDKR IE+FEKEA E+ K SFKYAWVL
Sbjct  1    MPKEKIHISLVVIGHVDAGKSTTTGHLIYKCGGIDKRTIEKFEKEALELGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            D LKAERERGITIDIALWKFE+ KY+ TVIDAPGHRDFIKNMITGTSQADCA+L++ S  
Sbjct  61   DNLKAERERGITIDIALWKFESPKYFFTVIDAPGHRDFIKNMITGTSQADCAILVVASGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGV+QMI   NK+D ++  Y +ARY+EI +EVS+YLKK
Sbjct  121  GEFEAGISKEGQTREHALLAFTLGVRQMIVAINKMDDSSVMYGQARYEEIKEEVSNYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY P K+PFVPISG+EGDNMIE+S N+ WYKGP LLEALD +N PKRPTDK LRLPLQD
Sbjct  181  VGYKPAKVPFVPISGWEGDNMIEKSGNMPWYKGPCLLEALDNLNPPKRPTDKALRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV FGP GL TEVKSVEMHHE+L EA+PGDNVGFNVKNV+VK+L+R
Sbjct  251   PVGRVETGVLKPGMVVQFGPVGLQTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKELRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAKG  NFT+QVI++NHPGQIGNGY+PVLDCHT+H+A KF E+  K+DRR
Sbjct  311   GYVASDSKNDPAKGTENFTAQVIVLNHPGQIGNGYSPVLDCHTAHVACKFKEITQKMDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PKF+K+GDA  V + PTKPM VE+F EYPPLGRFAVRDMRQTVAVGVI SV 
Sbjct  371   SGKVLEENPKFVKSGDACMVILEPTKPMTVESFQEYPPLGRFAVRDMRQTVAVGVIHSVI  430

Query  1415  KKDPTG  1432
             KK+  G
Sbjct  431   KKEAAG  436



>ref|XP_822465.1| elongation factor 1-alpha [Trypanosoma brucei brucei TREU927]
 ref|XP_822466.1| elongation factor 1-alpha [Trypanosoma brucei brucei TREU927]
 ref|XP_011777435.1| elongation factor 1-alpha, putative [Trypanosoma brucei gambiense 
DAL972]
 sp|P86934.1|EF1A1_TRYB2 RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1 
[Trypanosoma brucei brucei TREU927]
 sp|P86939.1|EF1A2_TRYB2 RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2 
[Trypanosoma brucei brucei TREU927]
 gb|EAN77637.1| elongation factor 1-alpha [Trypanosoma brucei brucei TREU927]
 gb|EAN77638.1| elongation factor 1-alpha [Trypanosoma brucei brucei TREU927]
 emb|CBH15169.1| elongation factor 1-alpha, putative [Trypanosoma brucei gambiense 
DAL972]
Length=449

 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAA++ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y + RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S  + WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSEKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  N+K+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHTSHIA KFAE+ +KIDRR
Sbjct  311   GNVCGNTKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKAPKSIKSGDAAIVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDGSG  436



>ref|NP_001167438.1| Elongation factor 1-alpha 1 [Salmo salar]
 gb|ACN11490.1| Elongation factor 1-alpha 1 [Salmo salar]
Length=462

 Score =   421 bits (1081),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET++YY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSRYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVSVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGNASGTTLLEALDAIQPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (774),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVIKPGMVVTFAPVNVTTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMVPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKAVE  442

Query  1415  KKDPT  1429
             KK P+
Sbjct  443   KKAPS  447



>emb|CCC51157.1| putative EF-1-alpha [Trypanosoma vivax Y486]
Length=449

 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y + RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S  + WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  N+K+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHTSHIA KFAE+ +KIDRR
Sbjct  311   GNVCGNTKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKAIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDGSG  436



>ref|XP_003963863.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha 1-like 
[Takifugu rubripes]
Length=462

 Score =   421 bits (1082),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYDEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKISRKEGNASGXTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMVPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>ref|XP_005470211.1| PREDICTED: elongation factor 1-alpha 1-like [Oreochromis niloticus]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK PT
Sbjct  443   KKAPT  447



>emb|CDI83049.1| elongation factor 1-alpha, putative [Eimeria acervulina]
Length=450

 Score =   425 bits (1092),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/254 (79%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVL
Sbjct  1    MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALW+FET  ++ TVIDAPGHRDFIKNMITGTSQAD A+L++ +  
Sbjct  61   DKLKAERERGITIDIALWQFETPTFHYTVIDAPGHRDFIKNMITGTSQADVALLVVPADQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTP-KYSKARYDEIVKEVSSYLK  660
            GGFE   SK+GQTREHALLAFTLGVKQMI   NK+DATTP KYS++R++EI  EVS YLK
Sbjct  121  GGFEGAFSKEGQTREHALLAFTLGVKQMIVGINKMDATTPEKYSESRFNEIQAEVSRYLK  180

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  840
             VGYNPEK+PFVPISGF GDNM+E+STN+ WYKG TL+EALD +  PKRP+DKPLRLPLQ
Sbjct  181  TVGYNPEKVPFVPISGFMGDNMVEKSTNMPWYKGKTLVEALDSVEPPKRPSDKPLRLPLQ  240

Query  841  DVYKIGGIGTVPCG  882
            DVYKIGGIGTVP G
Sbjct  241  DVYKIGGIGTVPVG  254


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+GL TEVKSVEMHH  L++A+PGDNVGFNVKNV+VKD+KR
Sbjct  252   PVGRVETGILKPGMVVTFAPTGLQTEVKSVEMHHTQLEQAVPGDNVGFNVKNVSVKDVKR  311

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPAKGAA+F +QVI+++HPGQI  GY PVLDCHT+HI+ KFAEL  ++DRR
Sbjct  312   GHVASDSKNDPAKGAASFQAQVIVLHHPGQINPGYTPVLDCHTAHISCKFAELEKRLDRR  371

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE  PKF+K+GDA  VKM P+KPM VE+F EYPPLGRFAVRDM+QT+AVGVIK+V+
Sbjct  372   SGKALEDNPKFIKSGDAAIVKMEPSKPMCVESFIEYPPLGRFAVRDMKQTIAVGVIKAVE  431

Query  1415  KKDPTG  1432
             KK+  G
Sbjct  432   KKEAGG  437



>ref|XP_008277210.1| PREDICTED: elongation factor 1-alpha 1 [Stegastes partitus]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK PT
Sbjct  443   KKAPT  447



>ref|XP_005811264.1| PREDICTED: elongation factor 1-alpha 1-like isoform X1 [Xiphophorus 
maculatus]
 ref|XP_005811265.1| PREDICTED: elongation factor 1-alpha 1-like isoform X2 [Xiphophorus 
maculatus]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (775),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>tpg|DAA05869.1| TPA_inf: eukaryotic translation elongation factor 1A [Ascaris 
suum]
Length=464

 Score =   414 bits (1063),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+ R++E+  EVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSETRFNEVTTEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPKAVAFVPISGFNGDNMLEPSPNMPWFKGWNVERKEGTASGKTLLEALDSIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   308 bits (789),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKN++VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPQNVTTEVKSVEMHHEALAEALPGDNVGFNVKNISVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK A +FT+QVIIMNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVASDSKNDPAKEAKSFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKFLK+GDAG ++++PTKPM VETF+EY PLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKVEDNPKFLKSGDAGIIELIPTKPMCVETFTEYAPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KKDPTG  1432
             K +  G
Sbjct  443   KTEAAG  448



>ref|XP_001682260.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
 gb|AAY51370.1| elongation factor1-alpha [Leishmania major]
 emb|CAJ03418.1| elongation factor 1-alpha [Leishmania major strain Friedlin]
Length=449

 Score =   426 bits (1096),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTH  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y+++RYDEI KEV +YLK+
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRYDEISKEVGAYLKR  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ F+PISG++GDNMIE+S N+ WYKGPTLL+AL M+  P RP DKPLRLPLQD
Sbjct  181  VGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDALGMLEPPVRPVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVI++NHPGQI NGYAPVLDCHTSHIA +FAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  VKM+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK V+
Sbjct  371   SGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKEGSG  436



>ref|XP_004077036.1| PREDICTED: elongation factor 1-alpha 1 [Oryzias latipes]
 ref|XP_011482477.1| PREDICTED: elongation factor 1-alpha 1 [Oryzias latipes]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (774),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>gb|EMF17352.1| translation elongation factor 1-alpha [Sphaerulina musiva SO2202]
Length=459

 Score =   419 bits (1076),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/264 (78%), Positives = 226/264 (86%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ R++EI+KE SS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRFNEIIKETSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMI+ STN  WYK           G TLLEA+D I+EP RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDNSTNCPWYKGWEKETKTKSTGKTLLEAIDAIDEPARP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+G+TTEVKSVEMHHE LQE LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLQEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKSDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   SGKSIEDSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D +G
Sbjct  440   KSDKSG  445



>ref|XP_008319518.1| PREDICTED: elongation factor 1-alpha, somatic form [Cynoglossus 
semilaevis]
 ref|XP_008319519.1| PREDICTED: elongation factor 1-alpha, somatic form [Cynoglossus 
semilaevis]
 ref|XP_008319520.1| PREDICTED: elongation factor 1-alpha, somatic form [Cynoglossus 
semilaevis]
 ref|XP_008319521.1| PREDICTED: elongation factor 1-alpha, somatic form [Cynoglossus 
semilaevis]
Length=462

 Score =   420 bits (1080),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFA+L  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFADLKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMVPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKAVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>gb|EKG06689.1| elongation factor 1-alpha (ef-1-alpha), putative [Trypanosoma 
cruzi]
Length=489

 Score =   425 bits (1092),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/271 (75%), Positives = 232/271 (86%), Gaps = 7/271 (3%)
 Frame = +1

Query  70   VFPLPQPSSEESFY*KLRMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF  249
            VF +PQ  +         MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+F
Sbjct  30   VFSIPQGKTR-------IMGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKF  82

Query  250  EKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNM  429
            EKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNM
Sbjct  83   EKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM  142

Query  430  ITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKY  609
            ITGTSQAD AVL+I S+ G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +
Sbjct  143  ITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNF  202

Query  610  SKARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDM  789
            ++ RYDEIVKEVS+YLKKVGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM
Sbjct  203  AQERYDEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDM  262

Query  790  INEPKRPTDKPLRLPLQDVYKIGGIGTVPCG  882
            +  P RP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  263  LEPPVRPSDKPLRLPLQDVYKIGGIGTVPVG  293


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  291   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  350

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  351   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  410

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  411   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  470

Query  1415  KKD  1423
             KKD
Sbjct  471   KKD  473



>gb|AIM46986.1| translation elongation factor 1-alpha [Colpodella edax]
Length=445

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 221/253 (87%), Gaps = 2/253 (1%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI++VVIGHVD+GKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDAGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET K+YCT+IDAPGHRDFIKNMITGTSQAD A+L+I S T
Sbjct  61   DKLKAERERGITIDIALWKFETEKFYCTIIDAPGHRDFIKNMITGTSQADLAILVIASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAG +K+GQTREHALLAFTLGVKQMI   NK+D     +++ARY+EI  EV  +LK 
Sbjct  121  GEFEAGFAKEGQTREHALLAFTLGVKQMIVAVNKMDDAG--WAEARYNEIQTEVKRFLKT  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+K+PF+PISGF GDNM+ERS NL WYKGP L+EA+++   PKRP DKPLRLPLQD
Sbjct  179  VGYNPDKVPFIPISGFRGDNMLERSDNLKWYKGPILVEAINLCEPPKRPNDKPLRLPLQD  238

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  239  VYKIGGIGTVPVG  251


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+G+TTEVKSVEMHHE L EA PGDNVGFNVKNV+VK+LKR
Sbjct  249   PVGRVETGVLKPGMVVTFAPAGVTTEVKSVEMHHEQLPEANPGDNVGFNVKNVSVKELKR  308

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPA GAA+F +QVI++NHPG+I NGYAPVLDCHT+HIA KFAE+ +K+DRR
Sbjct  309   GFVASDSKNDPAMGAADFLAQVIVLNHPGEIKNGYAPVLDCHTAHIACKFAEIRSKMDRR  368

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GKELEK+PK +K+GDA  V M P+KPMVVE+F EYPPLGRFAVRDMR TVAVGVIK V+
Sbjct  369   TGKELEKDPKTIKSGDAAMVLMQPSKPMVVESFQEYPPLGRFAVRDMRSTVAVGVIKEVN  428

Query  1415  KKDPTG  1432
             KK+ T 
Sbjct  429   KKEATA  434



>emb|CDJ59653.1| elongation factor 1-alpha, putative [Eimeria maxima]
Length=450

 Score =   422 bits (1085),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 224/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVL
Sbjct  1    MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALW+FET  ++ TVIDAPGHRDFIKNMITGTSQAD A+L++ +  
Sbjct  61   DKLKAERERGITIDIALWQFETPTFHYTVIDAPGHRDFIKNMITGTSQADVALLVVPADQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTP-KYSKARYDEIVKEVSSYLK  660
            GGFE   SK+GQTREHALLAFTLGVKQMI   NK+DATTP KYS+ R++EI  EVS YLK
Sbjct  121  GGFEGAFSKEGQTREHALLAFTLGVKQMIVGINKMDATTPDKYSENRFNEIQAEVSRYLK  180

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  840
             VGYNPEK+PFVPISGF GDNM+E+S+N+ WYKG TL+EALD +  PKRP+DKPLRLPLQ
Sbjct  181  TVGYNPEKVPFVPISGFMGDNMVEKSSNMPWYKGKTLVEALDSVEPPKRPSDKPLRLPLQ  240

Query  841  DVYKIGGIGTVPCG  882
            DVYKIGGIGTVP G
Sbjct  241  DVYKIGGIGTVPVG  254


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+GL TEVKSVEMHH  L++A+PGDNVGFNVKNV+VKD+KR
Sbjct  252   PVGRVETGILKPGMVVTFAPTGLQTEVKSVEMHHTQLEQAVPGDNVGFNVKNVSVKDIKR  311

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPAKGAA+F +QVI+++HPGQI  GY PVLDCHT+HI+ KFAEL  ++DRR
Sbjct  312   GHVASDSKNDPAKGAASFQAQVIVLHHPGQINAGYTPVLDCHTAHISCKFAELEKRLDRR  371

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE  PKF+K GDA  +KM P+KPM VE+F EYPPLGRFAVRDM+QT+AVGVIK+V+
Sbjct  372   SGKSLEDNPKFIKTGDAAIIKMEPSKPMCVESFIEYPPLGRFAVRDMKQTIAVGVIKAVE  431

Query  1415  KKDPTG  1432
             KKD  G
Sbjct  432   KKDAGG  437



>ref|XP_008609205.1| elongation factor 1-alpha 1 [Saprolegnia diclina VS20]
 gb|EQC37043.1| elongation factor 1-alpha 1 [Saprolegnia diclina VS20]
Length=442

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M KEK+HIS+VVIGHVD+GKSTTTGHLIYK GGIDKR IE+FEKEA E+ K SFKYAWVL
Sbjct  1    MPKEKIHISLVVIGHVDAGKSTTTGHLIYKCGGIDKRTIEKFEKEALELGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            D LKAERERGITIDIALWKFE+ KY+ TVIDAPGHRDFIKNMITGTSQADCA+L++ S  
Sbjct  61   DNLKAERERGITIDIALWKFESPKYFFTVIDAPGHRDFIKNMITGTSQADCAILVVASGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGV+QMI   NK+D ++  Y +ARY+EI +EVS+YLKK
Sbjct  121  GEFEAGISKEGQTREHALLAFTLGVRQMIVAINKMDDSSVMYGQARYEEIKEEVSNYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY P K+PFVPISG+EGDNMIE+S N+ WYKGP LLEALD +N PKRPTDK LRLPLQD
Sbjct  181  VGYKPAKVPFVPISGWEGDNMIEKSGNMPWYKGPCLLEALDNLNPPKRPTDKALRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV FGP GL TEVKSVEMHHE+L EA+PGDNVGFNVKNV+VK+L+R
Sbjct  251   PVGRVETGVLKPGMVVQFGPVGLQTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKELRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAKG  NFT+QVI++NHPGQIGNGY+PVLDCHT+H+A KF E+  K+DRR
Sbjct  311   GYVASDSKNDPAKGTENFTAQVIVLNHPGQIGNGYSPVLDCHTAHVACKFKEITQKMDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PKF+K+GDA  V + PTKPM VE+F EYPPLGRFAVRDMRQTVAVGVI  V 
Sbjct  371   SGKVLEENPKFVKSGDACLVILEPTKPMTVESFQEYPPLGRFAVRDMRQTVAVGVIHGVV  430

Query  1415  KKDPTG  1432
             KK+  G
Sbjct  431   KKEAAG  436



>ref|XP_008427063.1| PREDICTED: elongation factor 1-alpha 1-like [Poecilia reticulata]
 ref|XP_008427065.1| PREDICTED: elongation factor 1-alpha 1-like [Poecilia reticulata]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>gb|ESL09377.1| elongation factor 1-alpha [Trypanosoma rangeli SC58]
Length=449

 Score =   426 bits (1096),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS++RY+EI+KEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQSRYEEIMKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDNMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFSPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPG +GNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGSVGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>gb|AAU47272.1| elongation factor alpha G5 [Trypanosoma cruzi]
Length=449

 Score =   424 bits (1090),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>ref|XP_008300933.1| PREDICTED: elongation factor 1-alpha 1-like [Stegastes partitus]
 ref|XP_008300934.1| PREDICTED: elongation factor 1-alpha 1-like [Stegastes partitus]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>gb|ESS66681.1| elongation factor 1-alpha (ef-1-alpha) [Trypanosoma cruzi Dm28c]
Length=716

 Score =   424 bits (1089),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>ref|XP_005733783.1| PREDICTED: elongation factor 1-alpha 1-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005733784.1| PREDICTED: elongation factor 1-alpha 1-like isoform X2 [Pundamilia 
nyererei]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>ref|XP_001896880.1| elongation factor 1-alpha (EF-1-alpha) [Brugia malayi]
Length=513

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  47   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  106

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  107  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  166

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+AR++E+  EVS+Y+KK
Sbjct  167  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPAFSEARFNEVTNEVSNYIKK  226

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E S N+ W+K            G TLLEALD +  P R
Sbjct  227  IGYNPKAVAFVPISGFNGDNMLEPSPNMPWFKGWNVERKEGNASGKTLLEALDAVIPPSR  286

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  287  PTDKPLRLPLQDVYKIGGIGTVPVG  311


 Score =   305 bits (782),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEALQEALPGDNVGFNVKNV++K+++R
Sbjct  309   PVGRVETGILKPGMVVTFAPQNITTEVKSVEMHHEALQEALPGDNVGFNVKNVSIKEIRR  368

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK    FT+QVIIMNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  369   GSVASDSKNDPAKETKQFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACKFAELKEKVDRR  428

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKFLK+GDAG + ++PTKP+ VETF+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  429   SGKKVEDNPKFLKSGDAGIIDLIPTKPLCVETFTEYPPLGRFAVRDMRQTVAVGVIKGVE  488

Query  1415  KKD  1423
             K +
Sbjct  489   KTE  491



>ref|XP_006638682.1| PREDICTED: elongation factor 1-alpha 1-like [Lepisosteus oculatus]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLESSPNMTWFKGWKITRKDGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FS+YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKAST  447



>gb|AES62596.2| elongation factor 1-alpha [Medicago truncatula]
Length=874

 Score =   431 bits (1107),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 226/253 (89%), Gaps = 4/253 (2%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M K+KV I+IVVIGHVDSGKSTTTGHLI+KLG I K VIE  EKEAA+MNKRSFKYAWVL
Sbjct  1    MAKKKVRINIVVIGHVDSGKSTTTGHLIHKLGCIHKSVIESLEKEAAKMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERG+TIDI L KFET KY CTVIDAPGHRDFIKNMITGTSQADCAVL+IDSTT
Sbjct  61   DKLKAERERGVTIDITLSKFETNKYNCTVIDAPGHRDFIKNMITGTSQADCAVLVIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAG+  +GQTREHALLAFTLGV QMICCCNK+DATTPKYS+ RY EIV++V   L K
Sbjct  121  GGFEAGM--NGQTREHALLAFTLGVNQMICCCNKMDATTPKYSRDRYVEIVRQVLPCLNK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY  + IP VPISGFEGDN+IERSTNLDWYKGPTLLEA+D INEP RP+DKPLR+PLQD
Sbjct  179  VGY--KLIPIVPISGFEGDNLIERSTNLDWYKGPTLLEAIDQINEPMRPSDKPLRIPLQD  236

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  237  VYKIGGIGTVPVG  249


 Score =   290 bits (742),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG L PGMV+TF  +GL  EVKSVEMHHEA+ EALPGD VGFNV NVA +DLK+
Sbjct  247   PVGRVETGSLNPGMVLTFAATGLQAEVKSVEMHHEAIGEALPGDIVGFNV-NVAARDLKQ  305

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNS+ DPA  AA+FTS VII NHPGQI NGY PVLDCHTSHIAVKFAEL++K+DR 
Sbjct  306   GYVASNSEGDPAVEAAHFTSLVIITNHPGQIRNGYTPVLDCHTSHIAVKFAELISKVDRC  365

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SG+E+E+EPKFL +GD G +KM+PTKPMVVE FS YPPLGRF VRD  QTVAVGVIK+V 
Sbjct  366   SGEEIEREPKFLMSGDTGIIKMIPTKPMVVEPFSLYPPLGRFVVRDWHQTVAVGVIKAVK  425

Query  1415  KKDPTG  1432
             KKDP  
Sbjct  426   KKDPAA  431



>ref|XP_004553494.1| PREDICTED: elongation factor 1-alpha 1-like [Maylandia zebra]
 ref|XP_005947284.1| PREDICTED: elongation factor 1-alpha 1-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005947285.1| PREDICTED: elongation factor 1-alpha 1-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006783619.1| PREDICTED: elongation factor 1-alpha 1-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006783620.1| PREDICTED: elongation factor 1-alpha 1-like isoform X2 [Neolamprologus 
brichardi]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>ref|XP_007551163.1| PREDICTED: elongation factor 1-alpha 1-like [Poecilia formosa]
 ref|XP_007551164.1| PREDICTED: elongation factor 1-alpha 1-like [Poecilia formosa]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALMEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>ref|XP_003144331.1| eukaryotic translation elongation factor 1A [Loa loa]
 gb|EFO19738.1| elongation factor 1-alpha [Loa loa]
Length=467

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+ R++E+  EVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTAPAFSETRFNEVTNEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E S N+ W+K            G TLLEALD +  P R
Sbjct  181  IGYNPKAVAFVPISGFNGDNMLEPSENMPWFKGWSVERKEGNASGKTLLEALDAVIPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   305 bits (782),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEALQEALPGDNVGFNVKNV++K+++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPQNITTEVKSVEMHHEALQEALPGDNVGFNVKNVSIKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK    FT+QVIIMNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVASDSKNDPAKETKQFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKFLK+GDAG V ++PTKP+ VETF+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKVEDNPKFLKSGDAGIVDLIPTKPLCVETFTEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKD  1423
             K +
Sbjct  443   KTE  445



>ref|NP_001017795.1| eukaryotic translation elongation factor 1 alpha 1 [Danio rerio]
 gb|AAH92884.1| Zgc:110335 [Danio rerio]
 gb|AAI65592.1| Zgc:110335 protein [Danio rerio]
Length=462

 Score =   420 bits (1079),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSSSGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPG+VVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AA+FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKTST  447



>ref|XP_010779184.1| PREDICTED: elongation factor 1-alpha [Notothenia coriiceps]
Length=461

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ARY+EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARYEEIAKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  +PFVPISG+ GDNM+E S  + W+K            G TLLE+LD I  P R
Sbjct  181  IGYNPLTVPFVPISGWHGDNMLEASEKMTWFKGWKVERKEGNASGVTLLESLDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   304 bits (779),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+ LTTEVKSVEMHHE+L EA+PGDNVGFN+KNV+VK+++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPAMLTTEVKSVEMHHESLTEAMPGDNVGFNIKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP KGA NF +QVII+NHPGQI  GYAPVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKGADNFNAQVIILNHPGQINAGYAPVLDCHTAHIACKFTELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKF+K+GDA  VKM+P KPMVVE FS YPPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   SGKKIEDSPKFVKSGDAAIVKMIPQKPMVVEPFSSYPPLGRFAVRDMRQTVAVGVIKAVV  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   TKDASG  448



>ref|XP_011125707.1| hypothetical protein AOL_s00169g48 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX45442.1| hypothetical protein AOL_s00169g48 [Arthrobotrys oligospora ATCC 
24927]
Length=461

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/265 (77%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET K+Y TVIDAPGHRDFIKNMITGTSQADCA+LII S T
Sbjct  61   DKLKAERERGITIDIALWKFETPKFYVTVIDAPGHRDFIKNMITGTSQADCAILIIASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D T P +S+ARY+EI KE SS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQLIIAMNKMDTTAPPWSQARYEEIKKEASSFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VG+NP+ +PFVPISGF GDNMI+ S N  WYK            G TLLEA+D I  P R
Sbjct  181  VGFNPKSVPFVPISGFNGDNMIDASENCPWYKGWDKETKAGKTTGKTLLEAIDAIEPPVR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PSDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF PS +TTEVKSVEMHHE L E  PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVIKAGMVVTFAPSNVTTEVKSVEMHHEQLVEGCPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  +SK+DP KGAA+F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  323   GNVCGDSKNDPPKGAASFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLQKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PKF+K+GDA  VKM+P+KPM VE+F+EYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   TGKATEENPKFIKSGDAAIVKMIPSKPMCVESFTEYPPLGRFAVRDMRQTVAVGVIKTVD  442

Query  1415  KKDPTG  1432
             K D  G
Sbjct  443   KDDKAG  448



>emb|CDP93912.1| Protein Bm5195, isoform g [Brugia malayi]
Length=467

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+AR++E+  EVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPAFSEARFNEVTNEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E S N+ W+K            G TLLEALD +  P R
Sbjct  181  IGYNPKAVAFVPISGFNGDNMLEPSPNMPWFKGWNVERKEGNASGKTLLEALDAVIPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   304 bits (779),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEALQEALPGDNVGFNVKNV++K+++R
Sbjct  263   PVGRVETGILKPGMVVTFAPQNITTEVKSVEMHHEALQEALPGDNVGFNVKNVSIKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK    FT+QVIIMNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVASDSKNDPAKETKQFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PKFLK+GDAG + ++PTKP+ VETF+EYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKVEDNPKFLKSGDAGIIDLIPTKPLCVETFTEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKD  1423
             K +
Sbjct  443   KTE  445



>ref|XP_003592345.1| Elongation factor 1-alpha [Medicago truncatula]
Length=996

 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 226/253 (89%), Gaps = 4/253 (2%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M K+KV I+IVVIGHVDSGKSTTTGHLI+KLG I K VIE  EKEAA+MNKRSFKYAWVL
Sbjct  1    MAKKKVRINIVVIGHVDSGKSTTTGHLIHKLGCIHKSVIESLEKEAAKMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERG+TIDI L KFET KY CTVIDAPGHRDFIKNMITGTSQADCAVL+IDSTT
Sbjct  61   DKLKAERERGVTIDITLSKFETNKYNCTVIDAPGHRDFIKNMITGTSQADCAVLVIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAG+  +GQTREHALLAFTLGV QMICCCNK+DATTPKYS+ RY EIV++V   L K
Sbjct  121  GGFEAGM--NGQTREHALLAFTLGVNQMICCCNKMDATTPKYSRDRYVEIVRQVLPCLNK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY  + IP VPISGFEGDN+IERSTNLDWYKGPTLLEA+D INEP RP+DKPLR+PLQD
Sbjct  179  VGY--KLIPIVPISGFEGDNLIERSTNLDWYKGPTLLEAIDQINEPMRPSDKPLRIPLQD  236

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  237  VYKIGGIGTVPVG  249


 Score =   290 bits (742),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG L PGMV+TF  +GL  EVKSVEMHHEA+ EALPGD VGFNV NVA +DLK+
Sbjct  247   PVGRVETGSLNPGMVLTFAATGLQAEVKSVEMHHEAIGEALPGDIVGFNV-NVAARDLKQ  305

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNS+ DPA  AA+FTS VII NHPGQI NGY PVLDCHTSHIAVKFAEL++K+DR 
Sbjct  306   GYVASNSEGDPAVEAAHFTSLVIITNHPGQIRNGYTPVLDCHTSHIAVKFAELISKVDRC  365

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SG+E+E+EPKFL +GD G +KM+PTKPMVVE FS YPPLGRF VRD  QTVAVGVIK+V 
Sbjct  366   SGEEIEREPKFLMSGDTGIIKMIPTKPMVVEPFSLYPPLGRFVVRDWHQTVAVGVIKAVK  425

Query  1415  KKDPTG  1432
             KKDP  
Sbjct  426   KKDPAA  431



>ref|XP_005746073.1| PREDICTED: elongation factor 1-alpha 1-like [Pundamilia nyererei]
 ref|XP_005919352.1| PREDICTED: elongation factor 1-alpha 1-like [Haplochromis burtoni]
Length=462

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (770),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKAAT  447



>ref|XP_011213301.1| PREDICTED: elongation factor 1-alpha 1 [Bactrocera dorsalis]
Length=463

 Score =   420 bits (1080),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/265 (77%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTNMPWFKGWKVERKEGNAEGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>gb|EKF38338.1| elongation factor 1-alpha (ef-1-alpha), putative [Trypanosoma 
cruzi marinkellei]
Length=475

 Score =   424 bits (1091),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  27   MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  86

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  87   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  146

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  147  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  206

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  207  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  266

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  267  VYKIGGIGTVPVG  279


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  277   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  336

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  337   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  396

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  397   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  456

Query  1415  KKD  1423
             KK+
Sbjct  457   KKE  459



>ref|XP_003438367.1| PREDICTED: elongation factor 1-alpha 1-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005473699.1| PREDICTED: elongation factor 1-alpha 1-like isoform X2 [Oreochromis 
niloticus]
Length=462

 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLG KQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGAKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>gb|KJH42648.1| translation elongation factor EF-1, subunit alpha [Dictyocaulus 
viviparus]
Length=464

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 227/265 (86%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+AR++EI  EVS+++KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFNEITTEVSNFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ +PFVPISGF GDNM+E S+N+ W+K            G TLLEALD +  P+R
Sbjct  181  IGYNPKSVPFVPISGFNGDNMLEPSSNMGWFKGWTIERKEGNVTGKTLLEALDSVIPPQR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTD+PLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDRPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P  +TTEVKSVEMHHE+L EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGIMKPGMVVTFAPQNITTEVKSVEMHHESLSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +F +QVIIMNHPGQIG GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVCSDSKNDPAKEARSFNAQVIIMNHPGQIGAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK++E  PKFLK+GDAG V++ PTKP+ VE+F++Y PLGRFAVRDMRQTVAVGVIKSVD
Sbjct  383   TGKKVEDNPKFLKSGDAGIVELHPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVD  442

Query  1415  KKDPT  1429
             K + T
Sbjct  443   KSEGT  447



>gb|KEH43749.1| elongation factor 1-alpha [Medicago truncatula]
Length=822

 Score =   429 bits (1104),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 226/253 (89%), Gaps = 4/253 (2%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            M K+KV I+IVVIGHVDSGKSTTTGHLI+KLG I K VIE  EKEAA+MNKRSFKYAWVL
Sbjct  1    MAKKKVRINIVVIGHVDSGKSTTTGHLIHKLGCIHKSVIESLEKEAAKMNKRSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERG+TIDI L KFET KY CTVIDAPGHRDFIKNMITGTSQADCAVL+IDSTT
Sbjct  61   DKLKAERERGVTIDITLSKFETNKYNCTVIDAPGHRDFIKNMITGTSQADCAVLVIDSTT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAG+  +GQTREHALLAFTLGV QMICCCNK+DATTPKYS+ RY EIV++V   L K
Sbjct  121  GGFEAGM--NGQTREHALLAFTLGVNQMICCCNKMDATTPKYSRDRYVEIVRQVLPCLNK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY  + IP VPISGFEGDN+IERSTNLDWYKGPTLLEA+D INEP RP+DKPLR+PLQD
Sbjct  179  VGY--KLIPIVPISGFEGDNLIERSTNLDWYKGPTLLEAIDQINEPMRPSDKPLRIPLQD  236

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  237  VYKIGGIGTVPVG  249


 Score =   290 bits (741),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG L PGMV+TF  +GL  EVKSVEMHHEA+ EALPGD VGFNV NVA +DLK+
Sbjct  247   PVGRVETGSLNPGMVLTFAATGLQAEVKSVEMHHEAIGEALPGDIVGFNV-NVAARDLKQ  305

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVASNS+ DPA  AA+FTS VII NHPGQI NGY PVLDCHTSHIAVKFAEL++K+DR 
Sbjct  306   GYVASNSEGDPAVEAAHFTSLVIITNHPGQIRNGYTPVLDCHTSHIAVKFAELISKVDRC  365

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SG+E+E+EPKFL +GD G +KM+PTKPMVVE FS YPPLGRF VRD  QTVAVGVIK+V 
Sbjct  366   SGEEIEREPKFLMSGDTGIIKMIPTKPMVVEPFSLYPPLGRFVVRDWHQTVAVGVIKAVK  425

Query  1415  KKDPTG  1432
             KKDP  
Sbjct  426   KKDPAA  431



>gb|AFC75715.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
Length=449

 Score =   424 bits (1090),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>emb|CAG00281.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=462

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/266 (76%), Positives = 226/266 (85%), Gaps = 13/266 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYDEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKISRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGG-IGTVPCG  882
            PTDKPLRLPLQDVYKIGG IGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGSIGTVPVG  266


 Score =   302 bits (774),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  264   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  323

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  324   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  383

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  384   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  443

Query  1415  KKDPT  1429
             KK  T
Sbjct  444   KKVST  448



>gb|AAI54753.1| Zgc:110335 [Danio rerio]
Length=462

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSSSGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P DKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PADKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPG+VVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AA+FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKTST  447



>gb|ACI02318.1| elongation factor alpha G5 [Trypanosoma cruzi]
Length=445

 Score =   424 bits (1091),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>ref|XP_819439.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN97588.1| elongation factor 1-alpha (EF-1-alpha), putative [Trypanosoma 
cruzi]
 gb|EKF30573.1| elongation factor 1-alpha (ef-1-alpha), putative [Trypanosoma 
cruzi marinkellei]
Length=449

 Score =   424 bits (1089),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>emb|CCC93415.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=449

 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAA++ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y + RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMI++S  + WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIDKSDKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  N+K+DP K AA+FT+QVII+NHPG IGNGYAPVLDCHTSHIA KFAE+ +KIDRR
Sbjct  311   GNVCGNTKNDPPKEAADFTAQVIILNHPGMIGNGYAPVLDCHTSHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V+
Sbjct  371   SGKELEKAPKAIKSGDAAIVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVN  430

Query  1415  KKDPTG  1432
             KK+ +G
Sbjct  431   KKEGSG  436



>ref|XP_003879714.1| elongation factor 1-alpha, related [Neospora caninum Liverpool]
 ref|XP_003881657.1| Elongation factor 1-alpha, related [Neospora caninum Liverpool]
 emb|CBZ49679.1| elongation factor 1-alpha, related [Neospora caninum Liverpool]
 emb|CBZ51624.1| Elongation factor 1-alpha, related [Neospora caninum Liverpool]
Length=448

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 223/253 (88%), Gaps = 2/253 (1%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVL
Sbjct  1    MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQAD A+L++ +  
Sbjct  61   DKLKAERERGITIDIALWQFETPKYHYTVIDAPGHRDFIKNMITGTSQADVALLVVPAEA  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFE   SK+GQTREHALLAFTLGVKQMI   NK+D+    YS+ R++EI KEV+ YLKK
Sbjct  121  GGFEGAFSKEGQTREHALLAFTLGVKQMIVGINKMDSCN--YSEDRFNEIQKEVAMYLKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PFV ISGF GDNM+E+STN+ WYKG TL+EALDM+  PKRP+DKPLRLPLQD
Sbjct  179  VGYNPEKVPFVAISGFVGDNMVEKSTNMSWYKGKTLVEALDMMEAPKRPSDKPLRLPLQD  238

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  239  VYKIGGIGTVPVG  251


 Score =   301 bits (770),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LK GMV+TF P GLTTE KSVEMHHE L++A+PGDNVGFNVKNV+VK+LKR
Sbjct  249   PVGRVETGILKAGMVLTFAPVGLTTECKSVEMHHEVLEQAVPGDNVGFNVKNVSVKELKR  308

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAKG A F +QVI++NHPG+I NGY+PV+DCHT+HIA KFAE+ TK+D+R
Sbjct  309   GYVASDSKNDPAKGCATFLAQVIVLNHPGEIKNGYSPVIDCHTAHIACKFAEIKTKMDKR  368

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PK +K+GDA  V M P+KPMVVE F++YPPLGRFAVRDM+QTVAVGVIKSV+
Sbjct  369   SGKTLEESPKCIKSGDAAMVNMEPSKPMVVEAFTDYPPLGRFAVRDMKQTVAVGVIKSVE  428

Query  1415  KKDP  1426
             KK+P
Sbjct  429   KKEP  432



>gb|AFC75714.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
 gb|AFC75716.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
 gb|AFC75717.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
 gb|AFC75718.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
 gb|AFC75719.1| translation elongation factor 1 alpha [Trypanosoma cruzi]
Length=449

 Score =   424 bits (1089),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>ref|XP_009313968.1| elongation factor 1-alpha [Trypanosoma grayi]
 gb|KEG07798.1| elongation factor 1-alpha [Trypanosoma grayi]
Length=449

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 224/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAA++ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  T  Y + RY+EIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYEEIVKEVSTYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S  + WYKGPTLLEALDM++ P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSEKMPWYKGPTLLEALDMLDAPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLTEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKAIKSGDAAIVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKDPTG  1432
             KKD +G
Sbjct  431   KKDGSG  436



>ref|XP_804709.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma cruzi strain 
CL Brener]
 ref|XP_819440.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN82858.1| elongation factor 1-alpha (EF-1-alpha), putative [Trypanosoma 
cruzi]
 gb|EAN97589.1| elongation factor 1-alpha (EF-1-alpha), putative [Trypanosoma 
cruzi]
Length=449

 Score =   424 bits (1089),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>ref|NP_001032962.1| elongation factor 1 alpha [Takifugu rubripes]
 dbj|BAE06267.1| elongation factor 1 alpha [Takifugu rubripes]
Length=461

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFNEITKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTKMSWFKGWKVERKEGNASGTTLLDALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKP MVVTF P  LTTEVKSVE HHE+L EA+PGDNVGFNVK+V+VK+++R
Sbjct  263   PVGRVETGLLKPSMVVTFAPVNLTTEVKSVETHHESLTEAVPGDNVGFNVKDVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP KGA NF +QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKGADNFNAQVIILNHPGQINAGYAPVLDCHTAHIACKFSELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE +PKF+K+GDA  VK++P KPMVVE FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKKLEDQPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KKDPTG  1432
              K+ +G
Sbjct  443   TKEVSG  448



>gb|AAI05316.1| EEF1A1 protein [Bos taurus]
Length=462

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEA+D I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEAMDCILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM VE+FS+YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>gb|AAX40413.1| elongation factor 1-alpha [Trypanosoma rangeli]
Length=449

 Score =   423 bits (1088),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 225/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+L+I S  
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILVIASAQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  YS+ARY+EIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDEKSVNYSQARYEEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG++GDNMIE+S N+  YKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFVPISGWQGDNMIEKSDNMPRYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG VVTF P+ +TTEVK +EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMKPGDVVTFSPANVTTEVKLIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAALVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>gb|ACO50117.1| elongation factor 1 alpha [Seculamonas ecuadoriensis]
Length=447

 Score =   419 bits (1078),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIY+ GGIDKR IE+FEKEA ++ K SFKYAWVL
Sbjct  1    MGKEKAHLNLVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEANDIGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY CT+IDAPGHRDFIKNMITGTSQAD A+L+I S T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYVCTIIDAPGHRDFIKNMITGTSQADAAILVIASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGIS +GQTREHALLAFTLGVKQ+    NKID  +  YS+ARYDEI  EVS+YLKK
Sbjct  121  GEFEAGISSEGQTREHALLAFTLGVKQIAVAINKIDDKSVNYSQARYDEIKAEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+ FVPISG+ GDNM+ERS N  WY GPTL+EA+D   EPKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKVNFVPISGWHGDNMLERSKNTSWYTGPTLVEAIDSFEEPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   298 bits (763),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGM V F PSGL+TEVKS+EMHH  L EA+PGDNVGFN+KN+AVKD++R
Sbjct  251   PVGRVETGIMKPGMTVLFAPSGLSTEVKSIEMHHTQLPEAVPGDNVGFNIKNIAVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+ K+DPAK AA+F +QVI++NHPGQIG GY+PVLDCHTSHIA +FAEL+ KIDRR
Sbjct  311   GYVASDIKNDPAKEAASFNAQVIVLNHPGQIGQGYSPVLDCHTSHIACRFAELVQKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E+ PK +K+G+A  VK++P KPM VET++EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   TGKVMEENPKAIKSGEAAIVKLVPMKPMCVETYAEYPPLGRFAVRDMRQTVAVGVIKSVE  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>ref|XP_006799668.1| PREDICTED: elongation factor 1-alpha 1-like [Neolamprologus brichardi]
Length=462

 Score =   417 bits (1072),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGT QADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTPQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKDGSASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +S++DP + AA FTSQVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSRNDPPQEAAGFTSQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKAAT  447



>ref|XP_010744212.1| PREDICTED: elongation factor 1-alpha 1-like [Larimichthys crocea]
Length=462

 Score =   420 bits (1079),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LK G VVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKSGTVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP + AANFT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKAVE  442

Query  1415  KKDPT  1429
             KK  T
Sbjct  443   KKVST  447



>ref|XP_004520688.1| PREDICTED: elongation factor 1-alpha 1-like [Ceratitis capitata]
Length=463

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTNMPWFKGWKVERKEGNAEGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (770),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++PTKP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPTKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_005181516.1| PREDICTED: elongation factor 1-alpha 1 [Musca domestica]
Length=463

 Score =   421 bits (1081),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/265 (77%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN++W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTNMNWFKGWKIERKEGNAEGKTLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALAEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQICNGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|NP_571338.1| elongation factor 1-alpha [Danio rerio]
 sp|Q92005.1|EF1A_DANRE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Danio 
rerio]
 gb|AAA50025.1| elongation factor 1-alpha [Danio rerio]
 emb|CAA54771.1| translational elongation factor-1 alpha [Danio rerio]
 gb|AAB50569.1| translation elongation factor 1 alpha [Danio rerio]
 gb|AAQ97968.1| eukaryotic translation elongation factor 1 alpha 1 [Danio rerio]
 gb|AAH64291.1| Elongation factor 1-alpha [Danio rerio]
 prf||2021264A elongation factor 1alpha
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+N+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGTTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+ +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AANF +QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAANFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKKLEDNPKALKSGDAAIVEMVPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>emb|CDS13811.1| Putative Elongation factor 1-alpha (Fragment) [Absidia idahoensis 
var. thermophila]
 emb|CDS03090.1| Putative Elongation factor 1-alpha (Fragment) [Absidia idahoensis 
var. thermophila]
 emb|CDS03159.1| Putative Elongation factor 1-alpha (Fragment) [Absidia idahoensis 
var. thermophila]
 emb|CDS03725.1| Putative Elongation factor 1-alpha (Fragment) [Absidia idahoensis 
var. thermophila]
 emb|CDS09823.1| Putative Elongation factor 1-alpha (Fragment) [Absidia idahoensis 
var. thermophila]
Length=458

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 228/265 (86%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D+T  KYS+ARY+EIVKEVS+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KYSEARYNEIVKEVSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +G+NP+ +PFVPISG+ GDNM+E STN+ W+K            G TLLEA+D I+ P R
Sbjct  179  IGFNPKSVPFVPISGWNGDNMLEESTNMPWFKGWTKETKAGAKSGKTLLEAIDNIDPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+ +TTEVKSVEMHHE L E +PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKPGMVVTFAPANVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK +A+FT+QVI++NHPGQIG GY+PVLDCHT+HIA KF+EL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKESASFTAQVIVLNHPGQIGAGYSPVLDCHTAHIACKFSELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE ++EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  381   SGKKLEDSPKFVKSGDSAIVKMVPSKPMCVEAYTEYPPLGRFAVRDMRQTVAVGVIKAVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>ref|XP_806829.1| elongation factor 1-alpha (EF-1-alpha) [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN84978.1| elongation factor 1-alpha (EF-1-alpha), putative [Trypanosoma 
cruzi]
Length=449

 Score =   422 bits (1085),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KK+
Sbjct  431   KKE  433



>emb|CAA34756.1| unnamed protein product [Homo sapiens]
Length=462

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEA+D I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEAVDCILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM VE+FS+YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>tpg|DAA05867.1| TPA_inf: eukaryotic translation elongation factor 1A [Xiphinema 
index]
 tpg|DAA05875.1| TPA_inf: eukaryotic translation elongation factor 1A [Xiphinema 
index]
Length=466

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREH LLA+TLGVKQMI CCNK+D T P +S +R++E+V EVS+YLKK
Sbjct  121  GEFEAGISKNGQTREHGLLAYTLGVKQMIVCCNKMDTTEPPFSDSRFNEVVTEVSNYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ IP+VPISGF GDNM+E S  + WYK            G TLLEALD I  P R
Sbjct  181  IGYNPKAIPYVPISGFHGDNMLEASDRMSWYKGWSVERKEGNASGKTLLEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+K LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKALRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (764),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  LTTEVKS+EMHHEALQEALPGDNVGFN+KNV+VK+++R
Sbjct  263   PVGRVETGVMKPGMVVTFAPQNLTTEVKSIEMHHEALQEALPGDNVGFNIKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP K  A+FT+QVII+NHPGQI  GY PVLDCHT+HIA KFAEL  K DRR
Sbjct  323   GNVAGDSKNDPPKETASFTAQVIILNHPGQISAGYTPVLDCHTAHIACKFAELKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PK LK+GDAG V ++P+KPM VE+FS+YPPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   SGKTLEENPKALKSGDAGIVDLIPSKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVK  442

Query  1415  KKD  1423
             K D
Sbjct  443   KSD  445



>ref|XP_011194365.1| PREDICTED: elongation factor 1-alpha 1 [Bactrocera cucurbitae]
Length=463

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTNMPWFKGWKVERKEGNAEGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK +P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>emb|CDH48285.1| elongation factor 1-alpha [Lichtheimia corymbifera JMRC:FSU:9682]
Length=458

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 228/265 (86%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D+T  KYS+ARY+EIVKEVS+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KYSEARYNEIVKEVSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +G+NP+ +PFVPISG+ GDNM+E STN+ W+K            G TLLEA+D I+ P R
Sbjct  179  IGFNPKSVPFVPISGWNGDNMLEESTNMPWFKGWNKETKAGAKTGKTLLEAIDNIDPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+ +TTEVKSVEMHHE L E +PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKPGMVVTFAPANVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK +A+FT+QVI++NHPGQIG GY+PVLDCHT+HIA KF+EL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKESASFTAQVIVLNHPGQIGAGYSPVLDCHTAHIACKFSELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE ++EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  381   SGKKLEDSPKFVKSGDSAIVKMVPSKPMCVEAYTEYPPLGRFAVRDMRQTVAVGVIKAVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>gb|AAY85516.1| eukaryotic translation elongation factor 1 alpha 1 [Danio rerio]
Length=462

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE +KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFEISKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+N+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGTTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+ +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AANF +QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAANFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELE  PK LK+GDA  V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKELEDNPKALKSGDAAIVEMVPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>emb|CDH55674.1| elongation factor 1-alpha [Lichtheimia corymbifera JMRC:FSU:9682]
Length=526

 Score =   414 bits (1065),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/267 (75%), Positives = 229/267 (86%), Gaps = 14/267 (5%)
 Frame = +1

Query  118  LRMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAW  297
            + MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAW
Sbjct  67   VTMGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAW  126

Query  298  VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS  477
            VLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII +
Sbjct  127  VLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAA  186

Query  478  TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYL  657
             TG FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D+T  KYS+ARY+EIVKEVS+++
Sbjct  187  GTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KYSEARYNEIVKEVSTFI  244

Query  658  KKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEP  801
            KK+G+NP+ +PFVPISG+ GDNM+E STN+ W+K            G TLLEA+D I+ P
Sbjct  245  KKIGFNPKSVPFVPISGWNGDNMLEESTNMPWFKGWNKETKAGAKTGKTLLEAIDNIDPP  304

Query  802  KRPTDKPLRLPLQDVYKIGGIGTVPCG  882
             RP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  305  VRPSDKPLRLPLQDVYKIGGIGTVPVG  331


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+ +TTEVKSVEMHHE L E +PGDNVGFNVKNV+VKD++R
Sbjct  329   PVGRVETGVIKPGMVVTFAPANVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKDIRR  388

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK +A+FT+QVI++NHPGQIG GY+PVLDCHT+HIA KF+EL+ KIDRR
Sbjct  389   GNVCSDSKNDPAKESASFTAQVIVLNHPGQIGAGYSPVLDCHTAHIACKFSELLEKIDRR  448

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE ++EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  449   SGKKLEDSPKFVKSGDSAIVKMVPSKPMCVEAYTEYPPLGRFAVRDMRQTVAVGVIKAVE  508

Query  1415  KKDPTG  1432
             K D  G
Sbjct  509   KVDKAG  514



>ref|XP_005802895.1| PREDICTED: elongation factor 1-alpha-like [Xiphophorus maculatus]
 ref|XP_007560080.1| PREDICTED: elongation factor 1-alpha [Poecilia formosa]
Length=461

 Score =   414 bits (1065),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST ++W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTKMNWFKGWKVERKDGNANGTTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  LTTEVKSVEMHHE+L EA+PGDNVGFNVKNV+VK+++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPPNLTTEVKSVEMHHESLTEAVPGDNVGFNVKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP K A +F +QVII+NHPGQI  GYAPVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKAADSFNAQVIILNHPGQINEGYAPVLDCHTAHIACKFKELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GDA  VK++P KPMVVE FS YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKLEDNPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KKDPTG  1432
              K+ +G
Sbjct  443   TKEVSG  448



>gb|AEZ67032.1| eukaryotic translation elongation factor a alpha [Strongyloides 
papillosus]
Length=462

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P YS+AR++E+V EV +++KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPYSEARFNEVVTEVQNFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E STN+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPKAVAFVPISGFHGDNMLEPSTNMPWFKGWAVERKEGNASGKTLLEALDAIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (763),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P G++TEVKSVEMHHE+L EA+PGDNVGFNVKN++VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPQGVSTEVKSVEMHHESLTEAVPGDNVGFNVKNISVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +FT+QVIIMNHPGQI  GY PVLDCHT+HIA +FAEL  K+DRR
Sbjct  323   GSVCSDSKNDPAKEAKSFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACRFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK++E  PKFLK+GDAG V+++P+KP+ VE F++YPPLGRFAVRDMRQTVAVGVIK V 
Sbjct  383   TGKKVEDAPKFLKSGDAGIVELIPSKPLCVEAFTDYPPLGRFAVRDMRQTVAVGVIKGVT  442

Query  1415  KKD  1423
             K D
Sbjct  443   KSD  445



>ref|XP_002091158.1| GE12389 [Drosophila yakuba]
 gb|EDW90870.1| GE12389 [Drosophila yakuba]
Length=463

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN++W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMNWFKGWKVERKEGNADGKTLIDALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK +P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_008421113.1| PREDICTED: elongation factor 1-alpha [Poecilia reticulata]
Length=461

 Score =   414 bits (1065),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST ++W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTKMNWFKGWKVERKEGNANGVTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  LTTEVKSVEMHHE+L EA+PGDNVGFNVKNV+VK+++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPPNLTTEVKSVEMHHESLTEAVPGDNVGFNVKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP K A +F +QVII+NHPGQI  GYAPVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKAADSFNAQVIILNHPGQINEGYAPVLDCHTAHIACKFKELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GDA  VK++P KPMVVE FS YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKLEDNPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KKDPTG  1432
              K+ +G
Sbjct  443   TKEVSG  448



>gb|ESA10680.1| hypothetical protein GLOINDRAFT_348113 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX70967.1| Tef1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX70968.1| Tef1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX70969.1| Tef1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX70970.1| Tef1p [Rhizophagus irregularis DAOM 197198w]
Length=459

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/266 (74%), Positives = 223/266 (84%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T   +S+ R++EIVKEVS ++K+
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTTN--WSEERFNEIVKEVSGFIKR  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY-------------KGPTLLEALDMINEPK  804
            VGYNP+ + FVPISG+ GDNM+E S+N+ W+             KG TLLEA+D I  P 
Sbjct  179  VGYNPKTVAFVPISGWHGDNMLEESSNMTWFKGWEKEIKGGAKVKGKTLLEAIDSIEPPS  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPTDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   308 bits (789),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P GLTTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  262   PVGRVETGIIKAGMVVTFAPVGLTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYV S+SK+DPAK AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  322   GYVCSDSKNDPAKEAASFQAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELQEKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GDA  VKM+P+KPM VE FS+YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  382   SGKKLEDNPKFVKSGDAAIVKMIPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVE  441

Query  1415  KKDPTG  1432
             K D +G
Sbjct  442   KVDKSG  447



>emb|CEJ91279.1| Putative Elongation factor 1-alpha [Torrubiella hemipterigena]
Length=460

 Score =   407 bits (1045),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/266 (76%), Positives = 225/266 (85%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKE-KVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            MGK+ K H++IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWV
Sbjct  1    MGKDDKTHLNIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWV  60

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALWKFET K+Y TVIDAPGHRDFIKNMITGTSQADC +LII + 
Sbjct  61   LDKLKAERERGITIDIALWKFETPKFYVTVIDAPGHRDFIKNMITGTSQADCGILIIAAG  120

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
            TG FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D  T ++S+ARY+EI+KE S+++K
Sbjct  121  TGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMD--TAQWSQARYEEIIKETSNFVK  178

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPK  804
            KVGYNP+ IPFVPISGF GDNM+E STN  WYK            G TLLEA+D +  PK
Sbjct  179  KVGYNPKTIPFVPISGFNGDNMLEPSTNCPWYKGWNKEGKSGNVTGKTLLEAIDAVEPPK  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPSDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   308 bits (790),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  262   PVGRVETGVIKPGMVVTFAPANVTTEVKSVEMHHEQLPEGLPGDNVGFNVKNVSVKDIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP +G A+FT+QVI+MNHPGQIGNGYAPVLDCHT+HIA KF  L+ KIDRR
Sbjct  322   GNVAGDSKNDPPQGCASFTAQVIVMNHPGQIGNGYAPVLDCHTAHIACKFETLLEKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E EPKF+KNGDA  VKM+P+KPM VE+F+EYPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  382   TGKSVEAEPKFVKNGDAAMVKMVPSKPMCVESFTEYPPLGRFAVRDMRQTVAVGVIKAVD  441

Query  1415  KKDPTG  1432
             K   TG
Sbjct  442   KSAATG  447



>ref|XP_966355.1| PREDICTED: elongation factor 1-alpha [Tribolium castaneum]
 ref|XP_008200463.1| PREDICTED: elongation factor 1-alpha [Tribolium castaneum]
 ref|XP_008200464.1| PREDICTED: elongation factor 1-alpha [Tribolium castaneum]
 gb|EFA03028.1| hypothetical protein TcasGA2_TC010452 [Tribolium castaneum]
Length=461

 Score =   412 bits (1058),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSDKMPWFKGWSVERKEGKAEGKTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKTTEENPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDTTG  448



>gb|AAC01751.1| elongation factor 1-alpha [Trypanosoma cruzi]
Length=449

 Score =   419 bits (1076),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 224/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERE GITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGT QAD AVL+I S+ 
Sbjct  61   DKLKAEREPGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTPQADAAVLVIASSQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  311   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  371   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>gb|EWC48307.1| elongation factor 1-alpha [Drechslerella stenobrocha 248]
Length=461

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/263 (79%), Positives = 224/263 (85%), Gaps = 14/263 (5%)
 Frame = +1

Query  130  KEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDK  309
            KEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDK
Sbjct  4    KEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDK  63

Query  310  LKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGG  489
            LKAERERGITIDIALWKFET+KYY TVIDAPGHRDFIKNMITGTSQADCA+LII S TG 
Sbjct  64   LKAERERGITIDIALWKFETSKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIASGTGE  123

Query  490  FEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVG  669
            FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D  T  +S+ARY+EIVKEVS+++KKVG
Sbjct  124  FEAGISKDGQTREHALLAFTLGVKQLIVALNKMD--TNGWSQARYEEIVKEVSNFIKKVG  181

Query  670  YNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKRPT  813
            YNP+ +PFVPISGF GDNMIE STN  WYK            G TLLEA+D I  P RP+
Sbjct  182  YNPKAVPFVPISGFNGDNMIEVSTNCPWYKGWNKETKAGKSTGKTLLEAIDAIEAPVRPS  241

Query  814  DKPLRLPLQDVYKIGGIGTVPCG  882
            DKPLRLPLQDVYKIGGIGTVP G
Sbjct  242  DKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  262   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  322   GNVAGDSKNDPPKGADSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELIEKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  382   TGKAVEASPKFVKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKTVE  441

Query  1415  KKDPTG  1432
             K + +G
Sbjct  442   KSEKSG  447



>ref|XP_002369268.1| elongation factor 1-alpha, putative [Toxoplasma gondii ME49]
 ref|XP_002370249.1| elongation factor 1-alpha, putative [Toxoplasma gondii ME49]
 ref|XP_008884118.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Hammondia hammondi]
 ref|XP_008886810.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Hammondia hammondi]
 emb|CAJ20335.1| elongation factor 1-alpha, putative [Toxoplasma gondii RH]
 gb|EPT31029.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Toxoplasma 
gondii ME49]
 gb|EPT32559.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Toxoplasma 
gondii ME49]
 gb|ESS29201.1| putative elongation factor 1-alpha (EF-1-ALPHA) [Toxoplasma gondii 
VEG]
 gb|ESS30701.1| putative elongation factor 1-alpha (EF-1-ALPHA) [Toxoplasma gondii 
VEG]
 gb|KEP62604.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Hammondia hammondi]
 gb|KEP65342.1| elongation factor 1-alpha (EF-1-ALPHA), putative [Hammondia hammondi]
Length=448

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 222/253 (88%), Gaps = 2/253 (1%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVL
Sbjct  1    MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQAD A+L++ +  
Sbjct  61   DKLKAERERGITIDIALWQFETPKYHYTVIDAPGHRDFIKNMITGTSQADVALLVVPAEA  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFE   SK+GQTREHALLAFTLGVKQMI   NK+D+    YS+ R++EI KEV+ YLKK
Sbjct  121  GGFEGAFSKEGQTREHALLAFTLGVKQMIVGINKMDSCN--YSEDRFNEIQKEVAMYLKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PFV ISGF GDNM+E+STN+ WYKG TL+EALD +  PKRP+DKPLRLPLQD
Sbjct  179  VGYNPEKVPFVAISGFVGDNMVEKSTNMSWYKGKTLVEALDTMEAPKRPSDKPLRLPLQD  238

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  239  VYKIGGIGTVPVG  251


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LK GMV+TF P GLTTE KSVEMHHE +++A+PGDNVGFNVKNV+VK+LKR
Sbjct  249   PVGRVETGILKAGMVLTFAPVGLTTECKSVEMHHEVMEQAVPGDNVGFNVKNVSVKELKR  308

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAKG A F +QVI++NHPG+I NGY+PV+DCHT+HIA KFAE+ TK+D+R
Sbjct  309   GYVASDSKNDPAKGCATFLAQVIVLNHPGEIKNGYSPVIDCHTAHIACKFAEIKTKMDKR  368

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PK +K+GDA  V M P+KPMVVE F++YPPLGRFAVRDM+QTVAVGVIKSV+
Sbjct  369   SGKTLEEAPKCIKSGDAAMVNMEPSKPMVVEAFTDYPPLGRFAVRDMKQTVAVGVIKSVE  428

Query  1415  KKDP  1426
             KK+P
Sbjct  429   KKEP  432



>ref|XP_002604724.1| hypothetical protein BRAFLDRAFT_58879 [Branchiostoma floridae]
 gb|EEN60734.1| hypothetical protein BRAFLDRAFT_58879 [Branchiostoma floridae]
Length=463

 Score =   417 bits (1072),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETGKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+AR+ EI KEV +Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSEARFGEITKEVGAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNMIE STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPKSVAFVPISGWHGDNMIEESTNMSWFKGWSIERKSGKSSGHTLMQALDAIEPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  LTTEVKSVEMHHE+L EALPGDNVGFNVKNV+VK+++R
Sbjct  263   PVGRVETGILKPGMVVTFAPVNLTTEVKSVEMHHESLTEALPGDNVGFNVKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP K AA+F +QVI++NHPGQI  GYAPVLDCHT+HIA KFAEL  K DRR
Sbjct  323   GYVAGDSKNDPPKEAASFIAQVIVLNHPGQIQAGYAPVLDCHTAHIACKFAELKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK +K+GDA  V+MLP+KPM VE FS YPPLGRFAVRDM+QTVAVGVIKSV+
Sbjct  383   SGKKLEDNPKSVKSGDAAIVEMLPSKPMCVEAFSSYPPLGRFAVRDMKQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
             K +  G
Sbjct  443   KTEKAG  448



>dbj|BAN33726.1| elongation factor 1alpha [Eukaryota sp. PCbi66]
Length=446

 Score =   426 bits (1095),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/253 (81%), Positives = 224/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H++IVVIGHVDSGKSTTTGHLIYK GGIDKRVIE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNIVVIGHVDSGKSTTTGHLIYKCGGIDKRVIEKFEKEAAELGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKYY T+IDAPGHRDFIKNMITGTSQAD A+LI+ S T
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYFTIIDAPGHRDFIKNMITGTSQADVAILIVASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQMI   NK+D  +  Y + RY EI  EVS +LKK
Sbjct  121  GEFEAGISKEGQTREHALLAYTLGVKQMIVAINKMDDKSVNYGEKRYSEIKDEVSKFLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNPEK+PF+PISG+ GDNM+E+STN+ WYKG TLLEALD I  PKRP+DKPLRLPLQD
Sbjct  181  VGYNPEKVPFIPISGWNGDNMLEKSTNMPWYKGHTLLEALDDITPPKRPSDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   289 bits (739),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P+ ++TEVKSVEMHH AL EA+PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIIKPGMVVTFAPANVSTEVKSVEMHHTALPEAVPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK  + F +QVI++NHPGQI  GY PVLDCHT+HIA +F EL++K DRR
Sbjct  311   GMVCSDSKNDPAKETSEFQAQVIVLNHPGQISAGYTPVLDCHTAHIACRFNELVSKCDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V ++P+KPM VE+F EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  371   SGKELEKAPKAVKSGDAAIVNLVPSKPMCVESFMEYPPLGRFAVRDMRQTVAVGVIKSVT  430

Query  1415  KK  1420
             KK
Sbjct  431   KK  432



>gb|AAO49408.1|AF485331_1 elongation factor 1-alpha [Cyprinus carpio]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEPSTNMGWFKGWKIERKEGNANGVTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+ LTTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPANLTTEVKSVEMHHESLAEATPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   A +F +QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAGSFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKKLEDNPKALKSGDAAIVEMIPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>ref|XP_002059330.1| GJ17887 [Drosophila virilis]
 gb|EDW58742.1| GJ17887 [Drosophila virilis]
Length=463

 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGCVVVFAPANITTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_005993968.1| PREDICTED: elongation factor 1-alpha, oocyte form-like [Latimeria 
chalumnae]
Length=461

 Score =   410 bits (1055),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EI KEV +Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSEKRYNEITKEVGAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TLLEALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEASPKMAWFKGWKITRKDGNANGVTLLEALDSIIPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTF P+ +TTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGFLKPGMVVTFAPANITTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   A +FT+QVII+NHPGQIG GYAPVLDCHT+HI+ KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAGSFTAQVIILNHPGQIGAGYAPVLDCHTAHISCKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  + M+P KPM VETFS YPPLGRFAVRDMRQTVAVGVIK VD
Sbjct  383   SGKKLEDNPKFLKSGDAAIIVMVPGKPMCVETFSSYPPLGRFAVRDMRQTVAVGVIKGVD  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>gb|KIW01140.1| elongation factor 1-alpha [Verruconis gallopava]
Length=457

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY+EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEERYNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE STN  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEPSTNCPWYKGWEKETKAKVTGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
             DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  VDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   298 bits (763),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +K GMVVTF P+G+TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGSIKAGMVVTFAPAGVTTEVKSVEMHHEQLAEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVEASPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVA  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KVDKAG  445



>ref|XP_001551786.1| elongation factor 1-alpha [Botrytis cinerea B05.10]
 emb|CCD47840.1| EF1a, translation elongation factor-1 alpha [Botrytis cinerea 
T4]
 gb|EMR80911.1| putative elongation factor 1-alpha protein [Botrytis cinerea 
BcDW1]
Length=460

 Score =   415 bits (1067),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 224/266 (84%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCAVLII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-------------GPTLLEALDMINEPK  804
            VGYNP+ +PFVPISGF GDNMI+ STN  WYK             G TLLEA+D I+ P 
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDNSTNCPWYKGWEKEAKGGAKSTGKTLLEAIDAIDPPS  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPTDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  262   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  322   GNVAGDSKQDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLQKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  382   TGKSMEDSPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVE  441

Query  1415  KKDPTG  1432
             K+D  G
Sbjct  442   KQDKAG  447



>emb|CEF65912.1| Elongation factor 1-alpha [Strongyloides ratti]
 emb|CEF66491.1| Elongation factor 1-alpha [Strongyloides ratti]
Length=462

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P YS+AR++E+  EV +++KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPYSEARFNEVTTEVQNFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E STN+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPKAVAFVPISGFHGDNMLEPSTNMPWFKGWSVERKEGNASGKTLLEALDSIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGM+VTF P G++TEVKSVEMHHE+L EA+PGDNVGFNVKN++VKD++R
Sbjct  263   PVGRVETGILKPGMIVTFAPQGVSTEVKSVEMHHESLTEAVPGDNVGFNVKNISVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +FT+QVIIMNHPGQI  GY PVLDCHT+HIA +FAEL  K+DRR
Sbjct  323   GSVCSDSKNDPAKEAKSFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACRFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK++E  PKFLK+GDAG V+++P+KP+ VE F++YPPLGRFAVRDMRQTVAVGVIK V 
Sbjct  383   TGKKVEDAPKFLKSGDAGIVELIPSKPLCVEAFTDYPPLGRFAVRDMRQTVAVGVIKGVT  442

Query  1415  KKD  1423
             K D
Sbjct  443   KSD  445



>gb|ESZ89813.1| elongation factor 1-alpha [Sclerotinia borealis F-4157]
Length=460

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 224/266 (84%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKVHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET +YY TVIDAPGHRDFIKNMITGTSQADCAVLII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPRYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-------------GPTLLEALDMINEPK  804
            VGYNP+ +PFVPISGF GDNMI+ S N  WYK             G TLLEA+D I EP 
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDNSPNCPWYKGWNKEGKGGAKTTGKTLLEAIDAIEEPS  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPTDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  262   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  322   GNVAGDSKQDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLQKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  382   TGKSMEDSPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVE  441

Query  1415  KKDPTG  1432
             K+D  G
Sbjct  442   KQDKAG  447



>ref|NP_477375.1| elongation factor 1alpha48D, isoform A [Drosophila melanogaster]
 ref|NP_725085.1| elongation factor 1alpha48D, isoform C [Drosophila melanogaster]
 ref|NP_001286321.1| elongation factor 1alpha48D, isoform D [Drosophila melanogaster]
 ref|NP_001286322.1| elongation factor 1alpha48D, isoform E [Drosophila melanogaster]
 ref|XP_001976015.1| GG20229 [Drosophila erecta]
 sp|P08736.2|EF1A1_DROME RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha-1; 
AltName: Full=50 kDa female-specific protein [Drosophila melanogaster]
 gb|AAF58608.1| elongation factor 1alpha48D, isoform A [Drosophila melanogaster]
 gb|AAM68698.1| elongation factor 1alpha48D, isoform C [Drosophila melanogaster]
 gb|AAR30199.1| LP10071p [Drosophila melanogaster]
 gb|EDV56415.1| GG20229 [Drosophila erecta]
 gb|ACL88303.1| Ef1alpha48D-PA, partial [synthetic construct]
 gb|ACU43535.1| RH01053p [Drosophila melanogaster]
 gb|AHN56119.1| elongation factor 1alpha48D, isoform D [Drosophila melanogaster]
 gb|AHN56120.1| elongation factor 1alpha48D, isoform E [Drosophila melanogaster]
Length=463

 Score =   415 bits (1067),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK +P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>emb|CEJ01865.1| Putative Elongation factor 1-alpha (Fragment) [Rhizopus microsporus]
Length=458

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 225/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ARY+EIVKEVSS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEARYNEIVKEVSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ +PFVPISG+ GDNM+E STN+ W+K            G TLLEA+D I+ P R
Sbjct  179  IGYNPKSVPFVPISGWHGDNMLEESTNMPWFKGWTKETKAGNKTGKTLLEAIDNIDPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PVDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPANVTTEVKSVEMHHETLAEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK + +FT+QVII+NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKESGSFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE +++YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   SGKKLEDAPKFVKSGDSAIVKMVPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>tpg|DAA05874.1| TPA_inf: eukaryotic translation elongation factor 1A [Strongyloides 
stercoralis]
Length=462

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P YS+AR++E++ EV +++KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPYSEARFNEVITEVQNFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISGF GDNM+E STN+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPKAVAFVPISGFHGDNMLEPSTNMPWFKGWSVERKEGNASGKTLLEALDAIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P G++TEVKSVEMHHE+L EA+PGDNVGFNVKN++VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPQGVSTEVKSVEMHHESLTEAVPGDNVGFNVKNISVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +FT+QVIIMNHPGQI  GY PVLDCHT+HIA +FAEL  K+DRR
Sbjct  323   GSVCSDSKNDPAKEAKSFTAQVIIMNHPGQIAAGYTPVLDCHTAHIACRFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK++E  PKFLK+GDAG V+++P+KP+ VE F++YPPLGRFAVRDMRQTVAVGVIK V 
Sbjct  383   TGKKVEDAPKFLKSGDAGIVELIPSKPLCVEAFTDYPPLGRFAVRDMRQTVAVGVIKGVT  442

Query  1415  KKD  1423
             K +
Sbjct  443   KSE  445



>gb|ACO50116.1| elongation factor 1 alpha [Reclinomonas americana]
Length=452

 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKAHLNLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEANEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY CT+IDAPGHRDFIKNMITGTSQAD A+LI+ S T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYVCTIIDAPGHRDFIKNMITGTSQADAAILIVASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGI K+GQTREHALLA+TLGVKQ++   NKID  +  YS+ARY+EI  EVS+YLKK
Sbjct  121  GEFEAGIGKEGQTREHALLAYTLGVKQILVAVNKIDDKSVNYSEARYNEIKGEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+K+ F+PISG+ GDNM+ERS N  WYKGP L+EA+D   EPKRP+DKPLR+PLQD
Sbjct  181  VGYNPDKVNFIPISGWNGDNMLERSPNTAWYKGPILIEAIDQFEEPKRPSDKPLRIPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+L+PGMVVTF P GL+TEVKS+EMHH  L EALPGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGILRPGMVVTFAPGGLSTEVKSIEMHHTQLPEALPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAK A +FT+QVII+NHPGQI  GY PVLDCHT+HIA +F EL+ KIDRR
Sbjct  311   GYVASDSKNDPAKEATSFTAQVIILNHPGQIAAGYTPVLDCHTAHIACRFNELLQKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GKELE  PKF+K+GDA   +++P+KP+ VE FSEY PLGRFAVRDMRQTVAVGVIK VD
Sbjct  371   TGKELEATPKFVKSGDAVIAQLVPSKPLCVEKFSEYAPLGRFAVRDMRQTVAVGVIKEVD  430

Query  1415  K  1417
             K
Sbjct  431   K  431



>gb|EFX85477.1| hypothetical protein DAPPUDRAFT_300308 [Daphnia pulex]
Length=462

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/265 (77%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P +S+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPFSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  +PFVPISGF GDNMIE S+NL WYK            G TLLEALD I  P R
Sbjct  181  IGYNPVTVPFVPISGFHGDNMIEASSNLPWYKGWAVERKEGKADGKTLLEALDAIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (764),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  LTTEVKSVEMHHEAL+EA PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVIKPGMVVTFAPCQLTTEVKSVEMHHEALEEACPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+F +QVI++NHPGQIGNGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFYAQVIVLNHPGQIGNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PKF+K+GDA  + ++P+KP+ VE+FS++PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKTTEENPKFIKSGDAAMITLVPSKPLCVESFSDFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKD  1423
              KD
Sbjct  443   FKD  445



>emb|CDQ66697.1| unnamed protein product [Oncorhynchus mykiss]
Length=462

 Score =   417 bits (1072),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 226/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET++YY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSRYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GY+P+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYSPDMVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSSSGTTLLEALDAIQPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P  +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGMIKPGMVVTFAPVNVTTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAAVFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMVPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK P+
Sbjct  443   KKAPS  447



>ref|XP_001986652.1| GH21478 [Drosophila grimshawi]
 gb|EDW01519.1| GH21478 [Drosophila grimshawi]
Length=463

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKDGNADGKTLIEALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGCVVVFAPANITTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_011502849.1| PREDICTED: elongation factor 1-alpha [Ceratosolen solmsi marchali]
Length=461

 Score =   410 bits (1054),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLESSTKMPWFKGWAVERKEGKADGKCLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VKDL+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKDLRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGA++FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGASDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V + PTKP+ VE F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKTTEENPKAIKSGDAAIVNLTPTKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDVAG  448



>ref|NP_001166227.1| elongation factor 1-alpha [Nasonia vitripennis]
 ref|XP_008208182.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208192.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208200.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208204.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208209.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208212.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208215.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
 ref|XP_008208227.1| PREDICTED: elongation factor 1-alpha isoform X1 [Nasonia vitripennis]
Length=461

 Score =   411 bits (1057),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWAVERKEGKADGKCLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKDL+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDLRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   TGKTTEENPKAIKSGDAAIVNLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDVSG  448



>dbj|BAO56800.1| elongation factor 1-alpha [Clarias batrachus]
Length=462

 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMGWFKGWKVERKEGNASGTTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHESLPEATPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   A +FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAGSFTAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKKLEDNPKNLKSGDAAIVEMIPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>ref|XP_001361821.2| GA20951 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26400.2| GA20951 [Drosophila pseudoobscura pseudoobscura]
Length=463

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS++RY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSESRYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN++W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMNWFKGWKVERKDGNADGKTLIEALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG +V F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTLVVFAPANITTEVKSVEMHHEALVEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK +P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>gb|AAD56406.1|AF184170_1 elongation factor 1-alpha [Sparus aurata]
Length=461

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET++YY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETSRYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TLLEALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLETSEKMSWFKGWKVERKEGNANGTTLLEALDAIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  LTTEVKSVEMHHE+L EA+PGDNVGFN+KNV+VK+++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPPQLTTEVKSVEMHHESLPEAVPGDNVGFNIKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP KGA NF +QVII+NHPGQI   YAPVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKGADNFNAQVIILNHPGQINARYAPVLDCHTAHIACKFTELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GDA  VK+ P KPMVVE FS YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDAPKFVKSGDAAIVKLHPQKPMVVEPFSSYPPLGRFAVRDMRQTVAVGVIKAVE  442

Query  1415  KKDPTG  1432
              K+ +G
Sbjct  443   LKEVSG  448



>ref|XP_008547400.1| PREDICTED: elongation factor 1-alpha [Microplitis demolitor]
 ref|XP_008547401.1| PREDICTED: elongation factor 1-alpha [Microplitis demolitor]
Length=461

 Score =   414 bits (1063),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGID+R IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDRRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLETSSKMGWFKGWKVERKDGNAEGTTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+GLTTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGLLKPGMVVTFAPAGLTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KP+ VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVS  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDATG  448



>ref|XP_001594091.1| elongation factor 1-alpha [Sclerotinia sclerotiorum 1980]
 gb|EDO03042.1| elongation factor 1-alpha [Sclerotinia sclerotiorum 1980 UF-70]
Length=460

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 224/266 (84%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCAVLII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEERYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-------------GPTLLEALDMINEPK  804
            VGYNP+ +PFVPISGF GDNMI+ STN  WYK             G TLLEA+D I+ P 
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDNSTNCPWYKGWEKEAKGGAKSTGKTLLEAIDAIDPPS  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPTDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  262   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  322   GNVAGDSKQDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLQKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  382   TGKSIEDSPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVE  441

Query  1415  KKDPTG  1432
             K++  G
Sbjct  442   KQEKAG  447



>ref|XP_001959909.1| GF13105 [Drosophila ananassae]
 gb|EDV36731.1| GF13105 [Drosophila ananassae]
Length=463

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGCVVVFAPANITTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_007671812.1| hypothetical protein BAUCODRAFT_28973 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00628.1| hypothetical protein BAUCODRAFT_28973 [Baudoinia compniacensis 
UAMH 10762]
Length=459

 Score =   414 bits (1064),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRFNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMI+ STN  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDVSTNCPWYKGWEKETKTKSTGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA ++K+DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  320   GNVAGDTKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSIENAPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVA  439

Query  1415  KKDPTG  1432
             K D +G
Sbjct  440   KSDKSG  445



>gb|AAV38607.1| eukaryotic translation elongation factor 1 alpha 2 [synthetic 
construct]
 gb|AAX43033.1| eukaryotic translation elongation factor 1 alpha 2, partial [synthetic 
construct]
Length=464

 Score =   417 bits (1072),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RYDEIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  +PFVPISG+ GDNM+E S N+ W+K            G +LLEA D I  P R
Sbjct  181  IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEAPDTILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+L+PGMVVTF P  +TTEVKSVEMHHEAL EALPGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  +SK DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V+M+P KPM VE+FS+YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>gb|KIO31120.1| hypothetical protein M407DRAFT_241866 [Tulasnella calospora MUT 
4182]
Length=459

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKGHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYVVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+AR++EI+KE S ++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEARFNEIIKETSGFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY------------KGPTLLEALDMINEPKR  807
            VGYNP+ +PFVPISG+ GDNM+E S N+ WY            KG TLL+A+D I+ P R
Sbjct  179  VGYNPKSVPFVPISGWHGDNMLEDSANMTWYKGWTKENKAGTVKGKTLLDAIDAIDPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   304 bits (779),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L++  PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLEQGNPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK AANFT+QVI++NHPGQI NGY+PVLDCHT+HIA KF+E+ +KIDRR
Sbjct  321   GNVASDSKNDPAKEAANFTAQVIVLNHPGQISNGYSPVLDCHTAHIACKFSEIKSKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +G+E+E  PKF+K+GDAG V ++P+KPM VET+S+YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  381   TGQEIEASPKFIKSGDAGMVVLVPSKPMCVETYSDYPPLGRFAVRDMRQTVAVGVIKAVD  440

Query  1415  KKDPTG  1432
             K + +G
Sbjct  441   KTEKSG  446



>gb|EFX85268.1| hypothetical protein DAPPUDRAFT_300259 [Daphnia pulex]
Length=463

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/265 (77%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P +S+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPFSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  +PFVPISGF GDNMIE S+NL WYK            G TLLEALD I  P R
Sbjct  181  IGYNPVTVPFVPISGFHGDNMIEASSNLPWYKGWAVERKEGKADGKTLLEALDAIVPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  LTTEVKSVEMHHEAL+EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVIKPGMVVTFAPCQLTTEVKSVEMHHEALEEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VA +SK++P KGAA+F +QVI++NHPGQIGNGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GFVAGDSKNNPPKGAADFYAQVIVLNHPGQIGNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PKF+K+GDA  + ++P+KP+ VE+FS++PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKTTEENPKFIKSGDAAMITLVPSKPLCVESFSDFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKD  1423
              KD
Sbjct  443   FKD  445



>gb|KIO08245.1| hypothetical protein M404DRAFT_997171 [Pisolithus tinctorius 
Marx 270]
Length=459

 Score =   405 bits (1042),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 223/265 (84%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ R++EIVKE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEDRFNEIVKETSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY------------KGPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNM+E STN+ WY            KG TLL+A+D I  P R
Sbjct  179  VGYNPKAVAFVPISGWHGDNMLEDSTNMPWYKGWTKETKGGVVKGKTLLDAIDAIEPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   307 bits (786),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF PS +TTEVKSVEMHHE L E +PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPSNVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK A++FT+QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVASDSKNDPAKEASSFTAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PKF+K+GDA  VK++P+KPM VE+++EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   SGKSLEQAPKFVKSGDACIVKLVPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  KKDPTG  1432
             K D TG
Sbjct  441   KTDKTG  446



>ref|XP_007921049.1| hypothetical protein MYCFIDRAFT_209593 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME87707.1| hypothetical protein MYCFIDRAFT_209593 [Pseudocercospora fijiensis 
CIRAD86]
Length=459

 Score =   412 bits (1059),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY+EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMI+ S N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDASPNCPWYKGWEKETKTKSTGKTLLEAIDSIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            +DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  SDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLSEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGCESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   SGKSIEASPKFIKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVQ  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KSDKGG  445



>dbj|BAM29151.1| elongation factor 1 alpha 1 [Daphnia magna]
Length=463

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/265 (77%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P +S+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPFSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  +PFVPISGF GDNMIE S+NL WYK            G TLLEALD I  P R
Sbjct  181  IGYNPVAVPFVPISGFHGDNMIEASSNLPWYKGWAVERKEGKADGKTLLEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  LTTEVKSVEMHHEAL+EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVIKPGMVVTFAPCQLTTEVKSVEMHHEALEEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VA +SK++P KGAA+F +QVI++NHPGQIGNGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GFVAGDSKNNPPKGAADFFAQVIVLNHPGQIGNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PKF+K+GDA  + ++P+KP+ VE+FS++PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKTTEENPKFIKSGDAAMITLVPSKPLCVESFSDFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKD  1423
              KD
Sbjct  443   FKD  445



>gb|AAT91089.1| elongation factor 1-alpha [Pimephales promelas]
Length=462

 Score =   420 bits (1079),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+N+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKVERKEGNASGVTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   293 bits (749),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+ +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGILKPGMVVTFAPANVTTEVKSVEMHHESLSEASPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   A +F +QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAGSFLAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMIPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>ref|XP_011159441.1| PREDICTED: elongation factor 1-alpha [Solenopsis invicta]
Length=461

 Score =   409 bits (1051),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKAEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVVLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDQTG  448



>ref|XP_003835133.1| similar to translation elongation factor 1 alpha [Leptosphaeria 
maculans JN3]
 emb|CBX91768.1| similar to translation elongation factor 1 alpha [Leptosphaeria 
maculans JN3]
Length=457

 Score =   417 bits (1072),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/264 (78%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKMHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE STN  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEVSTNCPWYKGWEKEIKSKVTGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KADKAG  445



>ref|XP_010890618.1| PREDICTED: elongation factor 1-alpha 1 [Esox lucius]
Length=462

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ R++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRFEEIQKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGNASGTTLLEALDAIQPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P  +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGMIKPGMVVTFAPVNVTTEVKSVEMHHEALSEAMPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAALFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PK LK+GDA  V M+P KPM VE+FSEYPPLGRFAVRDMRQTVAVGVIK V+
Sbjct  383   SGKKLEDNPKALKSGDAAIVDMVPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVE  442

Query  1415  KKDPT  1429
             KK P+
Sbjct  443   KKAPS  447



>emb|CEG63380.1| Putative Elongation factor 1-alpha [Rhizopus microsporus]
 emb|CEI93942.1| Putative Elongation factor 1-alpha [Rhizopus microsporus]
Length=458

 Score =   411 bits (1057),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ARY+EIVKEVSS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEARYNEIVKEVSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ +PFVPISG+ GDNM+E S N+ W+K            G TLLEA+D I+ P R
Sbjct  179  IGYNPKSVPFVPISGWHGDNMLEESNNMPWFKGWTKETKAGNKTGKTLLEAIDNIDPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PVDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPANVTTEVKSVEMHHETLSEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK + +FT+QVII+NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKESGSFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFSELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+PTKPM VE +++YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  381   SGKKLEDAPKFVKSGDSAIVKMIPTKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>gb|EPY27955.1| elongation factor 1-alpha [Strigomonas culicis]
 gb|EPY31042.1| elongation factor 1-alpha [Strigomonas culicis]
 gb|EPY32346.1| elongation factor 1-alpha [Strigomonas culicis]
 gb|EPY32802.1| elongation factor 1-alpha [Strigomonas culicis]
 gb|EPY33510.1| elongation factor 1-alpha [Strigomonas culicis]
Length=446

 Score =   412 bits (1058),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAA++ K SFKYAWVL
Sbjct  1    MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+IDST 
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLMIDSTQ  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            GGFEAGISKDGQTREHALLAFTLGVKQMI CCNK+D  T  +S+ RY+EI KEV +YLKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMIVCCNKMDDKTVNWSQDRYNEITKEVGAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ F+PISG+ GDNMIE+S N+ WYKG TLLE+LD +  P R  DKPLRLPLQD
Sbjct  181  VGYNVEKVRFIPISGWLGDNMIEKSDNMSWYKGMTLLESLDSLEPPVRLVDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+ PG VVTF P+ +TTEVKS+EMHHE + +A+PGDN+GFNVKNV+VKD++R
Sbjct  251   PVGRVETGVMNPGDVVTFAPANVTTEVKSIEMHHEQIPQAVPGDNIGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K A +FT+QVII+NHPGQI NGYAPVLDCHTSHIA KFA++M+KIDRR
Sbjct  311   GNVCGNSKNDPPKEAEDFTAQVIILNHPGQISNGYAPVLDCHTSHIACKFADIMSKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PKF+K+GDA  VKM+P KPM VE F++YPPLGRFAVRDMRQTVAVG+IK V 
Sbjct  371   SGKELEKNPKFVKSGDAAMVKMIPQKPMCVEVFNDYPPLGRFAVRDMRQTVAVGIIKGVS  430

Query  1415  KKD  1423
             KKD
Sbjct  431   KKD  433



>ref|XP_002004478.1| GI19955 [Drosophila mojavensis]
 gb|EDW08413.1| GI19955 [Drosophila mojavensis]
Length=463

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 225/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNAEGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGCVVVFAPANITTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P +GAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_002066234.1| GK22048 [Drosophila willistoni]
 gb|EDW77220.1| GK22048 [Drosophila willistoni]
Length=463

 Score =   415 bits (1067),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D++ P YS++RY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSESRYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E STN+ W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEAL EA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGCVVVFAPANITTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK  P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKASPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>ref|XP_007876992.1| hypothetical protein PFL1_01298 [Pseudozyma flocculosa PF-1]
 gb|EPQ31109.1| hypothetical protein PFL1_01298 [Pseudozyma flocculosa PF-1]
Length=459

 Score =   404 bits (1039),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 222/265 (84%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H+++VVIGHVDSGKSTTTGHLIYK GGIDKR +E+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTVEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  KYS+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KYSEDRFNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNMIE +T + WYK            G TLL+A+D I  P R
Sbjct  179  VGYNPKTVAFVPISGWHGDNMIEPTTQMPWYKGWEKETKSGKSTGKTLLDAIDAIEPPSR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PTDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   307 bits (787),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGM+VTF PS +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKPGMIVTFAPSNVTTEVKSVEMHHEQLPEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPA  AA+F +QVI+MNHPGQIGNGYAPVLDCHT+HIA KF+E++ KIDRR
Sbjct  321   GNVASDSKNDPAMEAASFNAQVIVMNHPGQIGNGYAPVLDCHTAHIACKFSEILEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+PTKPM VE+F+EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  381   TGKSVETAPKFIKSGDAAMVKMIPTKPMCVESFNEYPPLGRFAVRDMRQTVAVGVIKSVD  440

Query  1415  K  1417
             K
Sbjct  441   K  441



>ref|XP_007579636.1| putative elongation factor 1-alpha protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD52917.1| putative elongation factor 1-alpha protein [Neofusicoccum parvum 
UCRNP2]
Length=459

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEERYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE STN  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIEASTNCPWYKGWEKETKTKSTGKTLLEAIDSIDTPVRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            +DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  SDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSIENSPKFIKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KSDKQG  445



>gb|KFH42761.1| Elongation factor 1-alpha-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=460

 Score =   409 bits (1050),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/266 (75%), Positives = 223/266 (84%), Gaps = 15/266 (6%)
 Frame = +1

Query  124  MGKE-KVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            MGKE K HI++VVIGHVDSGKSTTTGHLIY+ GGIDKR IE+FEKEAAE+ K SFKYAWV
Sbjct  1    MGKEEKTHINVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV  60

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII S 
Sbjct  61   LDKLKAERERGITIDIALWRFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIASG  120

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
            TG FEAGISKDGQTREHALLA+TLGV+Q+I   NK+D     YS+ARY EI+KE SS++K
Sbjct  121  TGEFEAGISKDGQTREHALLAYTLGVRQLIVAINKMDIAN--YSEARYQEIIKETSSFIK  178

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPK  804
            KVGYNP+ +PFVPI+GF GDNMI  +TN+ WYK            G TLLEA+D I  PK
Sbjct  179  KVGYNPKTVPFVPITGFHGDNMINATTNMPWYKGWEKETKTGKATGKTLLEAIDAIEPPK  238

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RP+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  RPSDKPLRLPLQDVYKIGGIGTVPVG  264


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGR+ETG+LKPGMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  262   PVGRIETGILKPGMVVTFAPANVTTEVKSVEMHHEQLSEGLPGDNVGFNVKNVSVKDIRR  321

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPA GAA+F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+E++ KIDRR
Sbjct  322   GNVASDSKNDPAMGAASFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSEILEKIDRR  381

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GD+  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  382   TGKSVESNPKFIKSGDSAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVE  441

Query  1415  KKDPTG  1432
             K   TG
Sbjct  442   KAAATG  447



>ref|XP_007861104.1| translation elongation factor 1a [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60775.1| translation elongation factor 1a [Gloeophyllum trabeum ATCC 11539]
Length=460

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/265 (74%), Positives = 225/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q++   NK+D T  K+S+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLVVAVNKMDTT--KWSEDRFNEIIKETSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY------------KGPTLLEALDMINEPKR  807
            VGYNP+ +PFVPISG+ GDNM+E S+N+ WY            KG TLL+A+D I  P R
Sbjct  179  VGYNPKAVPFVPISGWHGDNMLEESSNMPWYKGWTKETKAGVVKGKTLLDAIDAIEPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+ +TTEVKSVEMHHE L++ +PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGIIKAGMVVTFAPANVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+VAS+SK+DPAK AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ K+DRR
Sbjct  321   GFVASDSKNDPAKEAASFNAQVIVINHPGQIGAGYAPVLDCHTAHIACKFAELIEKMDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE  PKF+K+GD+  VK++P+KP+ VET++EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   SGKSLEASPKFIKSGDSCIVKLVPSKPLCVETYNEYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  KKDPTG  1432
             K D +G
Sbjct  441   KTDKSG  446



>gb|ACO50111.1| elongation factor 1 alpha [Histiona aroides]
Length=445

 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 222/253 (88%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIY+ GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKAHLNLVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY CT+IDAPGHRDFIKNMITGTSQAD AVL++ S T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYVCTIIDAPGHRDFIKNMITGTSQADAAVLVVASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+    NK+D  +  Y + RYDEI KEVS+YLKK
Sbjct  121  GEFEAGISKEGQTREHALLAFTLGVKQIAVAVNKMDDKSVNYGQDRYDEIKKEVSAYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYNP+K+ F+PISG+ GDNM+E+S N+ WYKGPTL+EALD   EPKRP D+PLR+PLQD
Sbjct  181  VGYNPDKVNFIPISGWNGDNMLEKSANMPWYKGPTLVEALDQFEEPKRPNDRPLRVPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   290 bits (742),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPG  V F P GL+TEVKS+EMHH  L EA+PGDNVGFNVKN++VKD++R
Sbjct  251   PVGRVETGVMKPGTTVVFAPCGLSTEVKSIEMHHTQLPEAVPGDNVGFNVKNLSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVAS+SK+DPAK A +FT+QVII+NHPGQIG GY PVLDCHT+HIA +FAEL+ KIDRR
Sbjct  311   GYVASDSKNDPAKEAESFTAQVIILNHPGQIGAGYTPVLDCHTAHIACRFAELLQKIDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             + KELE  PKF+K+GDA   KM PTKPM VE FSEY PLGRFAVRDMRQTVAVGVIK V 
Sbjct  371   TRKELEASPKFVKSGDAVIAKMEPTKPMCVEKFSEYAPLGRFAVRDMRQTVAVGVIKEVA  430

Query  1415  K  1417
             K
Sbjct  431   K  431



>ref|XP_011340017.1| PREDICTED: elongation factor 1-alpha [Cerapachys biroi]
 ref|XP_011340018.1| PREDICTED: elongation factor 1-alpha [Cerapachys biroi]
 gb|EZA53539.1| Elongation factor 1-alpha [Cerapachys biroi]
Length=461

 Score =   409 bits (1050),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSAKMPWFKGWTVERKEGKGEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   TGKTTEENPKAIKSGDAAIVTLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDAAG  448



>ref|XP_007829723.1| Elongation factor 1-alpha [Pestalotiopsis fici W106-1]
 gb|ETS84926.1| Elongation factor 1-alpha [Pestalotiopsis fici W106-1]
Length=459

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET +Y  TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETNEYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D  T K+S+ARY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQLIVAINKMD--TAKWSEARYKEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP+++PFVPISGF GDNM+E +TN  WYK            G TL +A+D IN P R
Sbjct  179  VGYNPKEVPFVPISGFNGDNMLEETTNASWYKGWEKEVKGVKKEGKTLFQAIDAINPPSR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PTDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGR+ETG +KPGMVVTF PS +TTEVKSVEMHH+ L E  PGDNVGFNVKNV+VK+++R
Sbjct  261   PVGRIETGTIKPGMVVTFAPSNVTTEVKSVEMHHQQLPEGFPGDNVGFNVKNVSVKEIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP +GAA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  321   GNVAGDSKNDPPQGAASFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFSELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   TGKSVESSPKFVKSGDAAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  K  1417
             K
Sbjct  441   K  441



>ref|XP_011644434.1| PREDICTED: elongation factor 1-alpha [Pogonomyrmex barbatus]
 ref|XP_011644435.1| PREDICTED: elongation factor 1-alpha [Pogonomyrmex barbatus]
 ref|XP_011644436.1| PREDICTED: elongation factor 1-alpha [Pogonomyrmex barbatus]
 ref|XP_011644437.1| PREDICTED: elongation factor 1-alpha [Pogonomyrmex barbatus]
Length=461

 Score =   409 bits (1052),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKAEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVTLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDQAG  448



>ref|XP_011149357.1| PREDICTED: elongation factor 1-alpha [Harpegnathos saltator]
 gb|EFN77947.1| Elongation factor 1-alpha [Harpegnathos saltator]
Length=461

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSAKMPWFKGWTVERKDSKAEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVTLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDATG  448



>dbj|BAJ15871.1| elongation factor 1 alpha [Locusta migratoria]
Length=462

 Score =   412 bits (1059),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TL+EALD I  P R
Sbjct  181  IGYNPVAVAFVPISGWHGDNMLEHSDKMSWFKGWSIERKEGKAEGKTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P+ LTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGILKPGMVVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE+F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKSIKSGDAAIVNLVPSKPMCVESFQEFPPLGRFAVRDMRQTVAVGVIKNVS  442

Query  1415  KKDPT  1429
              KD T
Sbjct  443   FKDVT  447



>dbj|BAB64567.1| elongation factor-1 alpha [Carassius auratus]
Length=462

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+N+ W+K            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGVTLLDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   293 bits (750),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+ LTTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPANLTTEVKSVEMHHESLAEATPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   A +F +QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAGSFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
              GK+LE  PK LK+GDA  V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   FGKKLEDNPKALKSGDAAIVEMIPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVE  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>gb|AAY17225.1| eukaryotic translation elongation factor 1A [Oscheius tipulae]
Length=460

 Score =   414 bits (1065),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/266 (76%), Positives = 223/266 (84%), Gaps = 13/266 (5%)
 Frame = +1

Query  124  MGK-EKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            MGK +K HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWV
Sbjct  1    MGKGDKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV  60

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   
Sbjct  61   LDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACG  120

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
            TG FEAGISK+GQTREHALLA TLGVKQMI  CNK+D+T P +S+ R+DEIV EV S+LK
Sbjct  121  TGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFDEIVTEVKSFLK  180

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPK  804
            KVGYNP  IPFVPISGF GDNM+E S+N+ WYK            G TL+EALD I  P+
Sbjct  181  KVGYNPATIPFVPISGFNGDNMLEPSSNMSWYKGWSVERKEGNASGKTLIEALDCIIPPQ  240

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTD+PLRLPLQDVYKIGGIGTVP G
Sbjct  241  RPTDRPLRLPLQDVYKIGGIGTVPVG  266


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  264   PVGRVETGVIKPGMVVTFAPQNVTTEVKSVEMHHESLPEASPGDNVGFNVKNVSVKDIRR  323

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK + NFT+QVI+MNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  324   GSVCSDSKNDPAKESKNFTAQVIVMNHPGQISAGYTPVLDCHTAHIACKFAELKEKVDRR  383

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E  PKFLK+GDAG V+++PTKP+ VE+F++Y PLGRFAVRDMRQTVAVGVIKSV 
Sbjct  384   TGKSTEASPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVT  443

Query  1415  KKDPTG  1432
             K D +G
Sbjct  444   KDDGSG  449



>dbj|GAM88379.1| hypothetical protein ANO11243_064120 [fungal sp. No.11243]
Length=460

 Score =   415 bits (1067),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ R++EI+KE SS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEERFNEIIKETSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE S N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEASPNCPWYKGWEKETKSKSTGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            +DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  SDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E  PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLAEGAPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK DP KG  +F +QVI++NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKQDPPKGCDSFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSIENSPKFVKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D +G
Sbjct  440   KSDKSG  445



>emb|CEG69500.1| Putative Elongation factor 1-alpha [Rhizopus microsporus]
 emb|CEG68984.1| Putative Elongation factor 1-alpha [Rhizopus microsporus]
 emb|CEI93589.1| Putative Elongation factor 1-alpha [Rhizopus microsporus]
Length=458

 Score =   411 bits (1056),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ARY+EIVKEVSS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEARYNEIVKEVSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ +PFVPISG+ GDNM+E S N+ W+K            G TLLEA+D I+ P R
Sbjct  179  IGYNPKAVPFVPISGWHGDNMLEESNNMPWFKGWTKETKAGNKTGKTLLEAIDNIDPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PVDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPANVTTEVKSVEMHHETLTEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK + +FT+QVII+NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKESGSFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE +++YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  381   SGKKLEDAPKFVKSGDSAIVKMVPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>ref|XP_001930631.1| elongation factor 1-alpha [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU39736.1| elongation factor 1-alpha [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|AFO66289.1| elongation factor-1a [Pyrenophora tritici-repentis]
Length=457

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKMHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE S N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEASPNCPWYKGWEKETKAKATGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KADKAG  445



>gb|EUN23392.1| hypothetical protein COCVIDRAFT_40940 [Bipolaris victoriae FI3]
Length=457

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE S+N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEASSNCPWYKGWEKETKSKATGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   293 bits (750),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP K + +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKASESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVA  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KVDKAG  445



>gb|AFO66284.1| elongation factor-1a [Pyrenophora teres f. maculata]
Length=457

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKMHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMI+ S+N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIDSSSNCPWYKGWEKETKAKATGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KADKAG  445



>gb|EMD90278.1| hypothetical protein COCHEDRAFT_1139445 [Bipolaris maydis C5]
 gb|ENI09508.1| hypothetical protein COCC4DRAFT_30240 [Bipolaris maydis ATCC 
48331]
Length=457

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/264 (78%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE STN  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEASTNCPWYKGWEKETKSKATGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   293 bits (749),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP K + +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKASESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVA  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KVDKAG  445



>emb|CCJ09439.1| elongation factor 1 alpha [Phaedon cochleariae]
Length=462

 Score =   412 bits (1059),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLESSAKMPWFKGWAVERKEGKANGNCLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (764),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA ++K  P KGA +F +QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDTKVSPPKGATDFNAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PK +K+GDA  V ++PTKPM VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKTTEENPKAIKSGDAAIVNLVPTKPMCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPT  1429
              KDPT
Sbjct  443   FKDPT  447



>gb|KFH71585.1| elongation factor 1-alpha [Mortierella verticillata NRRL 6337]
Length=460

 Score =   411 bits (1056),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 225/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D T  K+S+ R++EI+KEVS+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVKQLIVAVNKMDTT--KWSQDRFEEIIKEVSTFVKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDW------------YKGPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNM+E STN+ W            +KG TLLEA+D I  P R
Sbjct  179  VGYNPKSVAFVPISGWHGDNMLEESTNMPWFKGWTKETKGGSFKGKTLLEAIDAIEPPSR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PTEKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF PS +TTEVKSVEMHHE L E +PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGIIKAGMVVTFAPSNVTTEVKSVEMHHEVLTEGIPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK AA+F +QVI++NHPGQI NGYAPVLDCHT+HIA KF E++ KIDRR
Sbjct  321   GNVCSDSKNDPAKEAASFNAQVIVLNHPGQISNGYAPVLDCHTAHIACKFGEILEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E+ PKF+K+GDA  VKM+P+KP+ VE+F EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   TGKAMEEFPKFIKSGDAAIVKMIPSKPLCVESFQEYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KTDGKG  446



>gb|AEE61578.1| unknown [Dendroctonus ponderosae]
 gb|ENN80320.1| hypothetical protein YQE_03313, partial [Dendroctonus ponderosae]
 gb|ERL94779.1| hypothetical protein D910_12053 [Dendroctonus ponderosae]
Length=463

 Score =   414 bits (1064),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ++   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLVVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TL++ALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASAKMPWFKGWNVERKEGKAEGKTLIDALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGR+ETGVLKPGMVV F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRIETGVLKPGMVVMFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P + AA+F +QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKNNPPRAAADFLAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIQQKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PK +K+GD+  V ++PTKPM VE+FSE+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   SGKATEENPKAIKSGDSAIVNLVPTKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKD  1423
              KD
Sbjct  443   FKD  445



>gb|KIK43550.1| hypothetical protein CY34DRAFT_699467 [Suillus luteus UH-Slu-Lm8-n1]
Length=460

 Score =   403 bits (1036),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/265 (74%), Positives = 222/265 (84%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEDRFNEIIKETSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY------------KGPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNM+E S N+ WY            KG TLL+A+D I  P R
Sbjct  179  VGYNPKAVAFVPISGWHGDNMLEESPNMPWYKGWTKETKGGVVKGKTLLDAIDAIEPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   307 bits (786),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF PS +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPSNVTTEVKSVEMHHEQLVEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVASDSKNDPAKEAASFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE  PKF+K+GDA  VK++P+KPM VE+++EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  381   SGKSLEASPKFVKSGDACIVKLVPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGVIKSVD  440

Query  1415  KKDPTG  1432
             K D +G
Sbjct  441   KTDKSG  446



>emb|CBY09087.1| unnamed protein product [Oikopleura dioica]
Length=461

 Score =   412 bits (1060),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H++IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHVNIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQMI   NK+D+T P YS+AR++EI  EVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQMIVGVNKMDSTEPPYSEARFNEISSEVSTYVKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNMIE S+ + WYK            G TL+EALD +  P R
Sbjct  181  VGYNPKSVAFVPISGWHGDNMIEASSKMPWYKGWNKEVKEGKFSGKTLVEALDSVIPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P++KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PSNKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+++PGMV TF PS LTTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGIIRPGMVATFAPSQLTTEVKSVEMHHESLSEAFPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAKGA  FT+QVI++NHPG+IGNGY+PVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GNVASDSKNDPAKGAKTFTAQVIVLNHPGEIGNGYSPVLDCHTAHIACKFQELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK++E  PK +K+GDA  VKM+P+KPM VE FS+Y PLGRFAVRDMRQTVAVGV+KSV+
Sbjct  383   SGKKMEDFPKKVKSGDAAIVKMIPSKPMCVEPFSQYAPLGRFAVRDMRQTVAVGVVKSVE  442

Query  1415  KKDPTG  1432
               + +G
Sbjct  443   HDEVSG  448



>dbj|BAJ15870.1| elongation factor 1 alpha [Gryllus bimaculatus]
 dbj|BAJ15872.1| elongation factor 1 alpha [Gryllus bimaculatus]
Length=462

 Score =   412 bits (1060),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSNYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G TL+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEHSDKMGWFKGWNIERKEGKAEGKTLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT+KPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTEKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+ LTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P K AA+F +QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKSAADFLAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E  PK +K+GDA  V ++PTKPM VE+F E+PPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  383   TGKTTEDNPKSIKSGDAAIVNLVPTKPMCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVT  442

Query  1415  KKDPT  1429
              KD T
Sbjct  443   AKDVT  447



>gb|AAX40342.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40343.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40344.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40347.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40348.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40349.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40354.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40355.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40356.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40357.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40358.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40359.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40372.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40389.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
Length=436

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 220/247 (89%), Gaps = 0/247 (0%)
 Frame = +1

Query  142  HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  321
            H+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAE
Sbjct  1    HMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAE  60

Query  322  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  501
            RERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ G FEAG
Sbjct  61   RERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAG  120

Query  502  ISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPE  681
            ISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKKVGYN E
Sbjct  121  ISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKKVGYNVE  180

Query  682  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  861
            K+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQDVYKIGG
Sbjct  181  KVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGG  240

Query  862  IGTVPCG  882
            IGTVP G
Sbjct  241  IGTVPVG  247


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  245   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  304

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  305   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  364

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  365   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  424

Query  1415  KKD  1423
             KKD
Sbjct  425   KKD  427



>gb|EIE83783.1| elongation factor 1-alpha [Rhizopus delemar RA 99-880]
 gb|EIE85380.1| elongation factor 1-alpha [Rhizopus delemar RA 99-880]
 gb|EIE86442.1| elongation factor 1-alpha [Rhizopus delemar RA 99-880]
 gb|EIE90336.1| elongation factor 1-alpha [Rhizopus delemar RA 99-880]
 gb|EIE90640.1| elongation factor 1-alpha [Rhizopus delemar RA 99-880]
Length=458

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 225/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+K +IS+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKDKTNISVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYQITVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+AR++EIVKEVSS++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEARFNEIVKEVSSFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ +PFVPISG+ GDNM++ STN+ WYK            G TLL+A+D I+ P R
Sbjct  179  IGYNPKSVPFVPISGWHGDNMLDESTNMPWYKGWNKETKAGAKSGKTLLDAIDNIDPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PVDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPAAVTTEVKSVEMHHETLSEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +FT+QVII+NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKEAGSFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELIEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE  PKF+K+GD+  VKM+P+KPM VE +++YPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  381   SGKSLEATPKFVKSGDSAIVKMIPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKSVE  440

Query  1415  KKD  1423
             K D
Sbjct  441   KVD  443



>sp|P28295.1|EF1A_ABSGL RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Absidia 
glauca]
 emb|CAA38529.1| elongation factor 1-alpha [Absidia glauca]
Length=458

 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/265 (74%), Positives = 227/265 (86%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D+T  K+S+ R++EI+KEVS ++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KWSEQRFNEIIKEVSGFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +G+NP+ +PFVPISG+ GDNM+E STN+ WYK            G TLL+A+D I+ P+R
Sbjct  179  IGFNPKSVPFVPISGWHGDNMLEESTNMPWYKGWNKETKAGAKSGKTLLDAIDAIDPPQR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKAGMVVTFAPANVTTEVKSVEMHHEQLVEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A +FT+QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVCSDSKNDPAKEAGSFTAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GD+  VKM+P+KPM VE +++YPPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  381   SGKKLEDAPKFVKSGDSAIVKMIPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVE  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KVDKAG  446



>ref|XP_011304459.1| PREDICTED: elongation factor 1-alpha [Fopius arisanus]
 ref|XP_011304460.1| PREDICTED: elongation factor 1-alpha [Fopius arisanus]
Length=461

 Score =   409 bits (1052),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+AR++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSSKMPWFKGWNVERKEGKAEGKCLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEAL EA+PGDNVGFNVKNVAVK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALLEAVPGDNVGFNVKNVAVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVTLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>tpg|DAA05872.1| TPA_inf: eukaryotic translation elongation factor 1A [Pristionchus 
pacificus]
Length=466

 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET++YY T+IDAPGHRDFIKNMITGTSQADCAVL++   T
Sbjct  61   DKLKAERERGITIDIALWKFETSRYYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA TLGVKQ+I  CNK+D+T P +S+AR+ EI  EVS ++KK
Sbjct  121  GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEIKTEVSGFIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISGF GDNM+E S+N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPATVAFVPISGFNGDNMLEASSNMPWFKGWEIERAEGKASGKTLLEALDAIVPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PT++PLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTNRPLRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  +TTEVKSVEMHHE+L EA+PGDNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK A  F +QVIIMNHPGQIG GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  323   GSVCSDSKNDPAKEARTFNAQVIIMNHPGQIGAGYTPVLDCHTAHIACKFAELKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK++E  PKFLK+GDAG V++ PTKP+ VE+F++Y PLGRFAVRDMRQTVAVGVIKSVD
Sbjct  383   TGKKVEDNPKFLKSGDAGIVELHPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVD  442

Query  1415  KKDPTG  1432
             K D +G
Sbjct  443   KSDGSG  448



>ref|XP_011561146.1| PREDICTED: elongation factor 1-alpha [Plutella xylostella]
Length=463

 Score =   410 bits (1054),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWAVERKEGKADGKCLIEALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG +V F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTIVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P +GAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K+DRR
Sbjct  323   GYVAGDSKNNPPRGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E  PK +K+GDA  V ++P+KP+ VE+F EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKSTEDNPKSIKSGDAAIVILVPSKPLCVESFQEYPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KDP+G
Sbjct  443   FKDPSG  448



>gb|ACO50114.1| elongation factor 1 alpha [Malawimonas californiana]
Length=446

 Score =   414 bits (1064),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 225/253 (89%), Gaps = 0/253 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H++IVVIGHVD GKSTTTGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHVNIVVIGHVDVGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKASFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQAD AVL++ + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYFTIIDAPGHRDFIKNMITGTSQADAAVLVVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA TLGVKQM+C  NK+D  T  + + RY+EI KEVS+Y+KK
Sbjct  121  GEFEAGISKDGQTREHALLAITLGVKQMVCAINKMDDKTVNWGQDRYEEIKKEVSNYVKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            +GYNPEKIPFVPISG+ GDNMIERS+N+ WYKGPTLLEALD I  PKRP++KPLRLPLQD
Sbjct  181  IGYNPEKIPFVPISGWLGDNMIERSSNMGWYKGPTLLEALDAIEPPKRPSEKPLRLPLQD  240

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  241  VYKIGGIGTVPVG  253


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P G+TTEVKSVEMHHE++ EA PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGIIKPGMVVTFAPVGVTTEVKSVEMHHESMPEAQPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  +SK+DP K +A+FT+QVI++NHPGQIG GY PVLDCHT+HIA KFAEL+ K+DRR
Sbjct  311   GNVCGDSKNDPPKESADFTAQVIVLNHPGQIGAGYTPVLDCHTAHIACKFAELLQKVDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK LE+EPKF+K+GDA  VK++P+KPM VETFSEY PLGRFAVRDMRQTVAVGVIK+V 
Sbjct  371   TGKVLEEEPKFVKSGDAAMVKLIPSKPMCVETFSEYSPLGRFAVRDMRQTVAVGVIKAVT  430

Query  1415  KKD  1423
             K +
Sbjct  431   KTE  433



>emb|CCX05343.1| Similar to Elongation factor 1-alpha; acc. no. Q01520, partial 
[Pyronema omphalodes CBS 100304]
Length=457

 Score =   405 bits (1041),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/263 (76%), Positives = 220/263 (84%), Gaps = 14/263 (5%)
 Frame = +1

Query  130  KEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDK  309
            KEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDK
Sbjct  2    KEKSHLNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDK  61

Query  310  LKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGG  489
            LKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG 
Sbjct  62   LKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGE  121

Query  490  FEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVG  669
            FEAGISKDGQTREHALLAFTLGVKQ+I   NK+D T  K+S+ RY EIVKEVS+++KKVG
Sbjct  122  FEAGISKDGQTREHALLAFTLGVKQLIVAINKMDTT--KWSEDRYKEIVKEVSNFIKKVG  179

Query  670  YNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKRPT  813
            YNP+ + FVPISGF GDNMIE STN  WYK            G TLLEA+D +  P RP+
Sbjct  180  YNPKSVAFVPISGFNGDNMIEASTNCPWYKGWEKETKEGKSTGKTLLEAIDAVEPPVRPS  239

Query  814  DKPLRLPLQDVYKIGGIGTVPCG  882
             KPLRLPLQDVYKIGGIGTVP G
Sbjct  240  GKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   305 bits (780),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++KPGMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKPGMVVTFAPAGVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA  F +QVI+MNHPGQ+GNGYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGAETFNAQVILMNHPGQVGNGYAPVLDCHTAHIACKFAELIEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E++PKF+K+GDA  VKM P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVEQQPKFIKSGDAAIVKMQPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KVDKAG  445



>ref|XP_007703566.1| hypothetical protein COCSADRAFT_29782 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD60564.1| hypothetical protein COCSADRAFT_29782 [Bipolaris sorokiniana 
ND90Pr]
Length=457

 Score =   417 bits (1073),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE S+N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKHVPFVPISGFNGDNMIEASSNCPWYKGWEKETKSKSTGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   292 bits (747),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP K + +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKASESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSVENSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KVDKAG  445



>emb|CCU97773.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=460

 Score =   406 bits (1044),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK H+++VVIGHVDSGKSTTTGHLIYK GGIDKR +E+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKQHVNLVVIGHVDSGKSTTTGHLIYKCGGIDKRTVEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  KYS+ R++EIV+EVS+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KYSEDRFNEIVREVSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VG+NP+ + FVPISG+ GDNMIE +TN+ WYK            G TLL+A+D I  P R
Sbjct  179  VGFNPKTVAFVPISGWHGDNMIEATTNMPWYKGWEKETKSGKVTGKTLLDAIDAIEPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PTDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF PS +TTEVKSVEMHHE+L E LPGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGVIKPGMVVTFAPSNVTTEVKSVEMHHESLPEGLPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPA+ AA+F +QVI+MNHPGQI NGY+PVLDCHT+HIA +F  ++ KIDRR
Sbjct  321   GNVASDSKNDPAQEAASFNAQVIVMNHPGQISNGYSPVLDCHTAHIACRFNNILQKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK LE+ PKF+K+GDA  V+M+PTKPM VE+F+EYPPLGRFAVRDMRQTVAVGVIKSVD
Sbjct  381   SGKVLEENPKFIKSGDAAMVEMIPTKPMCVESFNEYPPLGRFAVRDMRQTVAVGVIKSVD  440

Query  1415  KKDPTG  1432
             K    G
Sbjct  441   KTSGKG  446



>ref|XP_005980684.1| PREDICTED: elongation factor 1-alpha 1 [Pantholops hodgsonii]
Length=462

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GG DKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGGDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLA+TLGVKQ+I   NK+D+T P YS+ RY+EIVKEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP+ + FVPISG+ GDNM+E S N+ W+K            G TLLEALD I  P R
Sbjct  181  IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPPR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P  +TTEVKSVEMHHEAL EALP DNVGFNVKNV+VKD++R
Sbjct  263   PVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPVDNVGFNVKNVSVKDVRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFAEL  KIDRR
Sbjct  323   GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKFLK+GDA  V M+P KPM V++FS+YPPLGRFAVRDMRQTVAVGVIK+VD
Sbjct  383   SGKKLEDGPKFLKSGDAAIVDMVPGKPMCVDSFSDYPPLGRFAVRDMRQTVAVGVIKAVD  442

Query  1415  KK  1420
             KK
Sbjct  443   KK  444



>ref|XP_003696535.1| PREDICTED: elongation factor 1-alpha-like [Apis florea]
Length=462

 Score =   409 bits (1052),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFA++  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFADIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   NGKTTEENPKSIKSGDAAIVMLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDAAG  448



>emb|CBJ32893.1| EEF1A2, eukaryotic translation elongation factor 1 alpha [Ectocarpus 
siliculosus]
 emb|CBJ32894.1| EEF1A1, eukaryotic translation elongation factor 1 alpha [Ectocarpus 
siliculosus]
Length=440

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/259 (78%), Positives = 222/259 (86%), Gaps = 0/259 (0%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVD+GKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHINLVVIGHVDAGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKSSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            D LKAERERGITIDIALWKFE+ KY  TVIDAPGHRDFIKNMITGTSQAD AVL++ S  
Sbjct  61   DNLKAERERGITIDIALWKFESPKYNFTVIDAPGHRDFIKNMITGTSQADVAVLVVASGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQMI C NK+D ++  Y + RY EI +EV+ YLKK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQMIVCINKMDDSSVMYGEPRYTEIKEEVAIYLKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGY P KIPFVPISG+ GDNMI++STN+ WYKGP LLEALD + EP RPTDKPLRLPLQD
Sbjct  181  VGYKPAKIPFVPISGWAGDNMIDKSTNMPWYKGPYLLEALDTMKEPTRPTDKPLRLPLQD  240

Query  844  VYKIGGIGTVPCGSCGDWC  900
            VYKIGGIGTVP G     C
Sbjct  241  VYKIGGIGTVPVGRVETGC  259


 Score =   293 bits (750),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG LKPGMVVTF P  L TEVKSVEMHHEAL EA+PGDNVGFNVKNV+VKD++R
Sbjct  251   PVGRVETGCLKPGMVVTFAPCMLDTEVKSVEMHHEALPEAVPGDNVGFNVKNVSVKDIRR  310

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK DP KGA+ F +QVI+MNHPGQI NGYAPVLDCHT+H+A KF E+  K+DRR
Sbjct  311   GYVAGDSKRDPPKGASAFNAQVIVMNHPGQISNGYAPVLDCHTAHVACKFKEITQKMDRR  370

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E+ PKF+K GDA  V M P+KPM VE+F EYPPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  371   SGKVMEENPKFVKTGDACMVNMEPSKPMCVESFQEYPPLGRFAVRDMRQTVAVGVIKSVE  430



>gb|AAV84215.1| elongation factor 1 alpha [Culicoides sonorensis]
Length=463

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS++R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWAIERKEGKADGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVV F P  LTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVVFAPVNLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA ++K++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRR
Sbjct  323   GYVAGDTKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFSEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PK +K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIKSV+
Sbjct  383   TGKSVEDNPKSIKSGDAAIVILVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>gb|AAX40361.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40362.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
Length=436

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 220/247 (89%), Gaps = 0/247 (0%)
 Frame = +1

Query  142  HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  321
            H+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAE
Sbjct  1    HMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAE  60

Query  322  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  501
            RERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ G FEAG
Sbjct  61   RERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAG  120

Query  502  ISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPE  681
            ISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKKVGYN E
Sbjct  121  ISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKKVGYNVE  180

Query  682  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  861
            K+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQDVYKIGG
Sbjct  181  KVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGG  240

Query  862  IGTVPCG  882
            IGTVP G
Sbjct  241  IGTVPVG  247


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  245   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  304

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  305   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  364

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  365   SGKELEKNPKLIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  424

Query  1415  KKD  1423
             KK+
Sbjct  425   KKE  427



>ref|XP_003492701.1| PREDICTED: elongation factor 1-alpha 1 isoform 1 [Bombus impatiens]
 ref|XP_003492702.1| PREDICTED: elongation factor 1-alpha 1 isoform 2 [Bombus impatiens]
Length=461

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPVAVAFVPISGWHGDNMLEVSAKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFA++  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFADIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   NGKTTEENPKAIKSGDAAIVMLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDATG  448



>ref|XP_006569953.1| PREDICTED: elongation factor 1-alpha isoform X1 [Apis mellifera]
 ref|XP_006569954.1| PREDICTED: elongation factor 1-alpha isoform X2 [Apis mellifera]
 ref|XP_006569955.1| PREDICTED: elongation factor 1-alpha isoform X3 [Apis mellifera]
 ref|XP_006569956.1| PREDICTED: elongation factor 1-alpha isoform X4 [Apis mellifera]
 ref|XP_006569957.1| PREDICTED: elongation factor 1-alpha isoform X5 [Apis mellifera]
 ref|XP_006622057.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Apis dorsata]
 ref|XP_006622058.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Apis dorsata]
 ref|XP_006622059.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Apis dorsata]
Length=461

 Score =   409 bits (1051),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFA++  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFADIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   NGKTTEENPKSIKSGDAAIVMLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDAAG  448



>dbj|BAO53973.1| elongation factor 1 alpha [Paralichthys olivaceus]
Length=461

 Score =   409 bits (1050),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFETTKY  T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  
Sbjct  61   DKLKAERERGITIDIALWKFETTKYCVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVS+Y+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQKRFEEITKEVSTYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNMIE S  + WYK            G TLL+ALD I  P R
Sbjct  181  IGYNPASVAFVPISGWHGDNMIETSEKMSWYKGWKVERKDGNANGTTLLDALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (768),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG+LKPGMVVTF P  LTTEVKSVEMHHE++ EA+PGDNVGFN+KNV+VK+++R
Sbjct  263   PVGRVETGLLKPGMVVTFAPPNLTTEVKSVEMHHESMPEAVPGDNVGFNIKNVSVKEIRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+DP K AA+F +QVII+NHPGQI  GYAPVLDCHT+HIA KF EL+ KIDRR
Sbjct  323   GYVAGDSKNDPPKAAASFNAQVIILNHPGQINEGYAPVLDCHTAHIACKFKELIEKIDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK+LE  PKF+K+GDA  VK++P KPMVVE FS Y PLGRFAVRDMRQTVAVGVIKSVD
Sbjct  383   SGKKLEDSPKFVKSGDAAIVKLIPQKPMVVEPFSNYAPLGRFAVRDMRQTVAVGVIKSVD  442

Query  1415  KKDPTG  1432
              K+ +G
Sbjct  443   NKEISG  448



>ref|XP_012055308.1| PREDICTED: elongation factor 1-alpha [Atta cephalotes]
Length=461

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSAKMPWFKGWAVERKEGKAEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVVLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDQAG  448



>sp|Q2HJN6.1|EF1A3_OSCTI RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha-3 
[Oscheius tipulae]
 gb|AAY17224.1| eukaryotic translation elongation factor 1A [Oscheius tipulae]
Length=460

 Score =   414 bits (1064),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/266 (76%), Positives = 223/266 (84%), Gaps = 13/266 (5%)
 Frame = +1

Query  124  MGK-EKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  300
            MGK +K HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWV
Sbjct  1    MGKGDKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV  60

Query  301  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  480
            LDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   
Sbjct  61   LDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACG  120

Query  481  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLK  660
            TG FEAGISK+GQTREHALLA TLGVKQMI  CNK+D+T P +S+ R+DEIV EV S+LK
Sbjct  121  TGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFDEIVTEVKSFLK  180

Query  661  KVGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPK  804
            KVGYNP  IPFVPISGF GDNM+E S+N+ WYK            G TL+EALD I  P+
Sbjct  181  KVGYNPATIPFVPISGFNGDNMLEPSSNMSWYKGWSVERKEGNASGKTLIEALDCIIPPQ  240

Query  805  RPTDKPLRLPLQDVYKIGGIGTVPCG  882
            RPTD+PLRLPLQDVYKIGGIGTVP G
Sbjct  241  RPTDRPLRLPLQDVYKIGGIGTVPVG  266


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+KPGMVVTF P  +TTEVKSVEMHHE+L EA PGDNVGFNVKNV+VKD++R
Sbjct  264   PVGRVETGVIKPGMVVTFAPQNVTTEVKSVEMHHESLPEASPGDNVGFNVKNVSVKDIRR  323

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V S+SK+DPAK + NFT+QVI+MNHPGQI  GY PVLDCHT+HIA KFAEL  K+DRR
Sbjct  324   GSVCSDSKNDPAKESKNFTAQVIVMNHPGQISAGYTPVLDCHTAHIACKFAELKEKVDRR  383

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E  PKFLK+GDAG V+++PTKP  VE+F++Y PLGRFAVRDMRQTVAVGVIKSV 
Sbjct  384   TGKSTEASPKFLKSGDAGIVELIPTKPPCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVT  443

Query  1415  KKDPTG  1432
             K D +G
Sbjct  444   KDDGSG  449



>emb|CAA29993.1| EF-1-alpha [Drosophila melanogaster]
 gb|AAA28526.1| F1 protein [Drosophila melanogaster]
 prf||1110268A gene F1
Length=463

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAV I  + T
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+ QTREHALLAFTLGVKQ+I   NK+D++ P YS+ARY+EI KEVSSY+KK
Sbjct  121  GEFEAGISKNDQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP  + FVPISG+ GDNM+E STN+ W+K            G TL++ALD I  P R
Sbjct  181  VGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWEVGRKEGNADGKTLVDALDAILPPAR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P+ +TTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK +P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE++ K+DRR
Sbjct  323   GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEILEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E+ PKF+K+GDA  V ++P+KP+ VE F E+PPLGRFAVRDMRQTVAVGVIK+V+
Sbjct  383   SGKTTEENPKFIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVN  442

Query  1415  KKDPTG  1432
              KD +G
Sbjct  443   FKDASG  448



>gb|ADK90074.1| elongation factor 1 alpha [Bodo saltans]
Length=447

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/253 (77%), Positives = 222/253 (88%), Gaps = 2/253 (1%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGK+KVH+S+VVIGHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKY WVL
Sbjct  1    MGKDKVHMSLVVIGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYVWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S T
Sbjct  61   DKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAG+SKDGQTREHALLAFTLGVKQM+  CN++D+    +S+ARYDEIV  V  YLKK
Sbjct  121  GEFEAGLSKDGQTREHALLAFTLGVKQMVVACNEMDSIN--FSQARYDEIVSNVGQYLKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  843
            VGYN EK+ FVPISG+EGDNMIE+S+ ++WYKGPTLLE+LD++  P RP+DKPLRLPLQD
Sbjct  179  VGYNIEKVRFVPISGWEGDNMIEKSSRMEWYKGPTLLESLDLLEPPTRPSDKPLRLPLQD  238

Query  844  VYKIGGIGTVPCG  882
            VYKIGGIGTVP G
Sbjct  239  VYKIGGIGTVPVG  251


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVL+PG VVTF P+ +TTEVKSVEMHHE+L EA+PGDNVGFNVKN+++KD++R
Sbjct  249   PVGRVETGVLRPGDVVTFAPANITTEVKSVEMHHESLPEAIPGDNVGFNVKNLSIKDIRR  308

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G+V  ++K DP K   +FT+QVII+NHPGQ+GNGY+PVLDCHTSHIA KFA + +KIDRR
Sbjct  309   GFVCGSAKVDPPKECESFTAQVIILNHPGQVGNGYSPVLDCHTSHIACKFAMIESKIDRR  368

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKE+EKEPK +K+GDA  VKM+P KPM VE+F EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  369   SGKEVEKEPKAIKSGDAAIVKMVPQKPMCVESFVEYPPLGRFAVRDMRQTVAVGVIKSVA  428

Query  1415  KKDPT  1429
             KK+ +
Sbjct  429   KKEAS  433



>gb|AAX40345.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
Length=436

 Score =   411 bits (1056),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 220/247 (89%), Gaps = 0/247 (0%)
 Frame = +1

Query  142  HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  321
            H+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAE
Sbjct  1    HMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAE  60

Query  322  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  501
            RERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ G FEAG
Sbjct  61   RERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAG  120

Query  502  ISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPE  681
            ISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKKVGYN E
Sbjct  121  ISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKKVGYNVE  180

Query  682  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  861
            K+ F+PISG++GDNMI++S N+ WY+GPTLLEALDM+  P RP+DKPLRLPLQDVYKIGG
Sbjct  181  KVRFIPISGWQGDNMIDKSENMPWYEGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGG  240

Query  862  IGTVPCG  882
            IGTVP G
Sbjct  241  IGTVPVG  247


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  245   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  304

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  305   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  364

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  365   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  424

Query  1415  KKD  1423
             KKD
Sbjct  425   KKD  427



>ref|XP_003705350.1| PREDICTED: elongation factor 1-alpha [Megachile rotundata]
Length=461

 Score =   408 bits (1048),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S+ + W+KG +            L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWSVERKEGKVEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVK+V+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKSVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEQNPKAIKSGDAAIVTLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDAVG  448



>ref|XP_003037261.1| translation elongation factor 1a [Schizophyllum commune H4-8]
 gb|EFJ02359.1| translation elongation factor 1a [Schizophyllum commune H4-8]
Length=460

 Score =   405 bits (1040),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 223/265 (84%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+H+++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLAFTLGV+Q+I   NK+D T  K+S+ R++EIVKE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEDRFNEIVKETSTFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWY------------KGPTLLEALDMINEPKR  807
            VGYNP+ + FVPISG+ GDNM+E STN+ WY            KG TLL+A+D I  P R
Sbjct  179  VGYNPKTVAFVPISGWHGDNMLEESTNMPWYKGWTKETKAGVVKGKTLLDAIDAIEPPVR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            P+DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PSDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   303 bits (777),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF PS +TTEVKSVEMHHE L E  PGDNVGFNVKNV+VKD++R
Sbjct  261   PVGRVETGIIKAGMVVTFAPSNVTTEVKSVEMHHEQLAEGKPGDNVGFNVKNVSVKDIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VAS+SK+DPAK AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVASDSKNDPAKEAASFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK LE  PKF+K+GDA  VK++P+KPM VE+++EYPPLGRFAVRDMRQTVAVG+IKSVD
Sbjct  381   TGKSLEASPKFVKSGDACIVKLVPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGIIKSVD  440

Query  1415  KKDPTG  1432
             K D +G
Sbjct  441   KTDKSG  446



>gb|AFQ55278.1| elongation factor 1 alpha [Peltigera malacea]
Length=459

 Score =   414 bits (1063),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 225/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGID+R IE+FEKEAAEM K SFKYAWVL
Sbjct  1    MGKEKMHINVVVIGHVDSGKSTTTGHLIYKCGGIDRRTIEKFEKEAAEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY+EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRYNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE S+N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIEVSSNCPWYKGWEKETKTKTSGKTLLEAIDAIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            TDK LRLPLQDVYKIGGIGTVP G
Sbjct  239  TDKALRLPLQDVYKIGGIGTVPVG  262


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGIIKAGMVVTFAPANVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGADSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   SGKSIENTPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K +  G
Sbjct  440   KSEKAG  445



>gb|EKG17287.1| HR1 repeat rho-binding protein [Macrophomina phaseolina MS6]
Length=459

 Score =   412 bits (1058),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 224/264 (85%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ RY EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEERYQEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKG-----------PTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMIE STN  WYKG            TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIEASTNCPWYKGWEKETKTKTTGKTLLEAIDNIDPPVRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            +DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  SDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   TGKSIENSPKFIKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKDPTG  1432
             K D  G
Sbjct  440   KSDKAG  445



>gb|AAX40350.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40364.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40365.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40366.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40367.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40368.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40374.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
 gb|AAX40375.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
Length=436

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 220/247 (89%), Gaps = 0/247 (0%)
 Frame = +1

Query  142  HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  321
            H+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAE
Sbjct  1    HMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAE  60

Query  322  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  501
            RERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ G FEAG
Sbjct  61   RERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAG  120

Query  502  ISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPE  681
            ISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKKVGYN E
Sbjct  121  ISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKKVGYNVE  180

Query  682  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  861
            K+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQDVYKIGG
Sbjct  181  KVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGG  240

Query  862  IGTVPCG  882
            IGTVP G
Sbjct  241  IGTVPVG  247


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  245   PVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  304

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  305   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  364

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  365   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  424

Query  1415  KKD  1423
             KK+
Sbjct  425   KKE  427



>gb|AAX40346.1| elongation factor 1-alpha, partial [Trypanosoma cruzi]
Length=436

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 220/247 (89%), Gaps = 0/247 (0%)
 Frame = +1

Query  142  HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  321
            H+++VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVLDKLKAE
Sbjct  1    HMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAE  60

Query  322  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  501
            RERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD AVL+I S+ G FEAG
Sbjct  61   RERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAG  120

Query  502  ISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKKVGYNPE  681
            ISKDGQTREHALLAFTLGVKQM+ CCNK+D  +  +++ RYDEIVKEVS+YLKKVGYN E
Sbjct  121  ISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERYDEIVKEVSAYLKKVGYNVE  180

Query  682  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  861
            K+ F+PISG++GDNMI++S N+ WYKGPTLLEALDM+  P RP+DKPLRLPLQDVYKIGG
Sbjct  181  KVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGG  240

Query  862  IGTVPCG  882
            IGTVP G
Sbjct  241  IGTVPVG  247


 Score =   295 bits (756),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +KPG VVTF P+ +TTEVKS+EMHHE L EA PGDNVGFNVKNV+VKD++R
Sbjct  245   PVGRVETGTMKPGDVVTFVPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRR  304

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G V  NSK+DP K AA+FT+QVII+NHPGQIGNGYAPVLDCHT HIA KFAE+ +KIDRR
Sbjct  305   GNVCGNSKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRR  364

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGKELEK PK +K+GDA  V+M+P KPM VE F++Y PLGRFAVRDMRQTVAVG+IK+V 
Sbjct  365   SGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVT  424

Query  1415  KKD  1423
             KKD
Sbjct  425   KKD  427



>ref|XP_003401992.1| PREDICTED: elongation factor 1-alpha 1 [Bombus terrestris]
Length=461

 Score =   406 bits (1044),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPT------------LLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+KG T            L+EALD I  P R
Sbjct  181  IGYNPVAVAFVPISGWHGDNMLEVSGKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFA++  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFADIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   NGKTTEENPKAIKSGDAAIVMLVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD TG
Sbjct  443   FKDATG  448



>gb|KFY60178.1| hypothetical protein V496_05406 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY97471.1| hypothetical protein V498_02034 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=459

 Score =   412 bits (1058),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 226/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKLHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGV+Q+I   NK+D T  K+S+AR++EI+KE ++++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVRQIIVAINKMDTT--KWSEARFNEIIKETTNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP+ I FVPISGF GDNMIE STN  WYK            G TLLEA+D I+ P R
Sbjct  179  VGYNPKSIAFVPISGFNGDNMIEVSTNCPWYKGWEKETKEGKKSGKTLLEAIDGIDPPSR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  PTDKPLRLPLQDVYKIGGIGTVPVG  263


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG++K GMVVTF P+G+TTEVKSVEMHHE L E +PGDNVGFNVKNV+VK+++R
Sbjct  261   PVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  321   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFSELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  381   TGKSMEDSPKFVKSGDAAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KSDKAG  446



>gb|EME49524.1| translation elongation factor 1 alpha-like protein [Dothistroma 
septosporum NZE10]
Length=458

 Score =   410 bits (1055),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/264 (76%), Positives = 226/264 (86%), Gaps = 13/264 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKIHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEDRFNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK-----------GPTLLEALDMINEPKRP  810
            VGYNP+ +PFVPISGF GDNMI+ S+N  WYK           G TLLEA+D I+ P RP
Sbjct  179  VGYNPKTVPFVPISGFNGDNMIDVSSNCPWYKGWEKETKSKVTGKTLLEAIDGIDPPSRP  238

Query  811  TDKPLRLPLQDVYKIGGIGTVPCG  882
            +DKPLRLPLQDVYKIGGIGTVP G
Sbjct  239  SDKPLRLPLQDVYKIGGIGTVPVG  262


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGV+K GMVVTF P+G+TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  260   PVGRVETGVIKAGMVVTFAPAGVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRR  319

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KG  +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR
Sbjct  320   GNVAGDSKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRR  379

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK +E  PKF+K+GDA  VKM+P+KPM VE F+EYPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  380   SGKSIEASPKFIKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVV  439

Query  1415  KKD  1423
             K D
Sbjct  440   KAD  442



>ref|XP_011051761.1| PREDICTED: elongation factor 1-alpha [Acromyrmex echinatior]
 gb|EGI67159.1| Elongation factor 1-alpha [Acromyrmex echinatior]
Length=461

 Score =   405 bits (1042),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E+ K SFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEIGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P YS+ R++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E S  + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEVSAKMPWFKGWAVERKEGKAEGKCLIEALDAILPPTR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDK LRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKALRLPLQDVYKIGGIGTVPVG  265


 Score =   302 bits (774),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK++P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFAE+  K DRR
Sbjct  323   GYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK  E+ PK +K+GDA  V ++P+KPM VE F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   TGKTTEENPKAIKSGDAAIVALVPSKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVT  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDQAG  448



>ref|XP_009154950.1| elongation factor 1-alpha [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54489.1| elongation factor 1-alpha [Exophiala dermatitidis NIH/UT8656]
Length=460

 Score =   413 bits (1061),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 224/265 (85%), Gaps = 14/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEAAE+ K SFKYAWVL
Sbjct  1    MGKEKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + T
Sbjct  61   DKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISKDGQTREHALLA+TLGVKQ+I   NK+D T  K+S+ R++EI+KE S+++KK
Sbjct  121  GEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEERFNEIIKETSNFIKK  178

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            VGYNP+ +PFVPISGF GDNMIE STN  WYK            G TLLEA+D I+ P R
Sbjct  179  VGYNPKAVPFVPISGFNGDNMIEVSTNCPWYKGWEKESKAGKATGKTLLEAIDAIDPPTR  238

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKI GIGTVP G
Sbjct  239  PTDKPLRLPLQDVYKISGIGTVPVG  263


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETG +K GMVVTF P+ +TTEVKSVEMHHE L E LPGDNVGFNVKNV+VK+++R
Sbjct  261   PVGRVETGTIKAGMVVTFAPANVTTEVKSVEMHHEQLAEGLPGDNVGFNVKNVSVKEVRR  320

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             G VA +SK+DP KGA +F +QVI++NHPGQIG GYAPVLDCHT+HIA KFAEL+ KIDRR
Sbjct  321   GNVAGDSKNDPPKGAESFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELLEKIDRR  380

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             +GK +E  PKF+K+GDA  VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIKSV 
Sbjct  381   TGKSIENNPKFIKSGDAAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVV  440

Query  1415  KKDPTG  1432
             K D  G
Sbjct  441   KSDKGG  446



>ref|XP_308429.3| AGAP007406-PA [Anopheles gambiae str. PEST]
 gb|EAA04644.4| AGAP007406-PA [Anopheles gambiae str. PEST]
Length=463

 Score =   412 bits (1060),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 223/265 (84%), Gaps = 12/265 (5%)
 Frame = +1

Query  124  MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  303
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL  60

Query  304  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  483
            DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT  120

Query  484  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  663
            G FEAGISK+GQTREHALLAFTLGVKQ+I   NK+D+T P Y++AR++EI KEVSSY+KK
Sbjct  121  GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYNEARFEEIKKEVSSYIKK  180

Query  664  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYK------------GPTLLEALDMINEPKR  807
            +GYNP  + FVPISG+ GDNM+E ST + W+K            G  L+EALD I  P R
Sbjct  181  IGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR  240

Query  808  PTDKPLRLPLQDVYKIGGIGTVPCG  882
            PTDKPLRLPLQDVYKIGGIGTVP G
Sbjct  241  PTDKPLRLPLQDVYKIGGIGTVPVG  265


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  875   PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKR  1054
             PVGRVETGVLKPG VV F P  LTTEVKSVEMHHEALQEA+PGDNVGFNVKNV+VK+L+R
Sbjct  263   PVGRVETGVLKPGTVVVFAPVNLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322

Query  1055  GYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRR  1234
             GYVA +SK+ P KGAA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRR
Sbjct  323   GYVAGDSKNAPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFSEIKEKVDRR  382

Query  1235  SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVD  1414
             SGK  E  PKF+K+GDA  V ++P+KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V 
Sbjct  383   SGKSTEDNPKFIKSGDAAIVILVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVS  442

Query  1415  KKDPTG  1432
              KD  G
Sbjct  443   FKDAAG  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5150480793968