BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4620

Length=924
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU32062.1|  hypothetical protein MIMGU_mgv1a003954mg                319   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        321   5e-104   Nicotiana sylvestris
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        323   5e-104   Nicotiana tomentosiformis
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    323   4e-102   Solanum tuberosum [potatoes]
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        321   5e-101   Solanum lycopersicum
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        319   4e-100   Sesamum indicum [beniseed]
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        304   2e-94    
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             304   2e-94    Prunus persica
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        303   5e-94    Prunus mume [ume]
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        303   7e-94    
ref|XP_003551650.1|  PREDICTED: probable methyltransferase PMT16-...    299   3e-93    Glycine max [soybeans]
gb|ACN78962.1|  methyltransferase                                       301   7e-92    Glycine max [soybeans]
emb|CDP08881.1|  unnamed protein product                                293   1e-91    Coffea canephora [robusta coffee]
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        296   3e-91    Sesamum indicum [beniseed]
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    295   6e-91    Glycine max [soybeans]
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15        295   9e-91    Vitis vinifera
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             294   1e-90    Phaseolus vulgaris [French bean]
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        294   1e-90    Pyrus x bretschneideri [bai li]
gb|KJB09868.1|  hypothetical protein B456_001G171500                    292   2e-90    Gossypium raimondii
ref|XP_012083473.1|  PREDICTED: probable methyltransferase PMT15 ...    293   3e-90    Jatropha curcas
emb|CDP05238.1|  unnamed protein product                                294   3e-90    Coffea canephora [robusta coffee]
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15        293   3e-90    Fragaria vesca subsp. vesca
ref|XP_012083474.1|  PREDICTED: probable methyltransferase PMT15 ...    293   3e-90    
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        293   4e-90    Fragaria vesca subsp. vesca
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        291   6e-90    
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        293   6e-90    Nicotiana sylvestris
ref|XP_002511797.1|  ATP binding protein, putative                      292   8e-90    Ricinus communis
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        291   1e-89    
ref|XP_012090301.1|  PREDICTED: probable methyltransferase PMT16        292   1e-89    Jatropha curcas
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             291   1e-89    Citrus clementina [clementine]
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    291   1e-89    Citrus sinensis [apfelsine]
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             292   1e-89    Populus trichocarpa [western balsam poplar]
gb|KJB09867.1|  hypothetical protein B456_001G171500                    291   2e-89    Gossypium raimondii
gb|KHG14191.1|  hypothetical protein F383_16741                         291   2e-89    Gossypium arboreum [tree cotton]
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    291   3e-89    Nelumbo nucifera [Indian lotus]
gb|KEH18956.1|  methyltransferase                                       290   6e-89    Medicago truncatula
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        290   6e-89    Nicotiana tomentosiformis
gb|KDO86014.1|  hypothetical protein CISIN_1g006633mg                   287   7e-89    Citrus sinensis [apfelsine]
gb|KJB41226.1|  hypothetical protein B456_007G095700                    289   9e-89    Gossypium raimondii
ref|XP_002510829.1|  ATP binding protein, putative                      289   2e-88    Ricinus communis
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    288   2e-88    Nicotiana sylvestris
ref|XP_007051921.1|  S-adenosyl-L-methionine-dependent methyltran...    286   2e-88    
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        288   3e-88    Sesamum indicum [beniseed]
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    288   3e-88    Solanum tuberosum [potatoes]
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    288   4e-88    Nicotiana sylvestris
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        288   5e-88    Populus euphratica
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        288   5e-88    Solanum lycopersicum
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             287   5e-88    Citrus clementina [clementine]
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   287   6e-88    Citrus sinensis [apfelsine]
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                287   7e-88    Erythranthe guttata [common monkey flower]
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  287   7e-88    Medicago truncatula
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        287   9e-88    Cucumis melo [Oriental melon]
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        287   1e-87    Nicotiana tomentosiformis
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    286   1e-87    
ref|XP_008439398.1|  PREDICTED: probable methyltransferase PMT15        285   2e-87    Cucumis melo [Oriental melon]
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    285   5e-87    Solanum tuberosum [potatoes]
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    285   6e-87    Populus euphratica
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    285   6e-87    
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    285   6e-87    Solanum lycopersicum
ref|XP_011023413.1|  PREDICTED: probable methyltransferase PMT15        284   6e-87    Populus euphratica
ref|XP_011650766.1|  PREDICTED: probable methyltransferase PMT16        285   7e-87    Cucumis sativus [cucumbers]
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    284   1e-86    Populus euphratica
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        283   1e-86    Populus euphratica
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    284   1e-86    Vitis vinifera
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             283   2e-86    
gb|EPS68701.1|  hypothetical protein M569_06064                         283   2e-86    Genlisea aurea
ref|XP_002301329.1|  dehydration-responsive family protein              283   2e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        283   3e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    283   3e-86    
ref|XP_004228448.2|  PREDICTED: probable methyltransferase PMT15        283   3e-86    
ref|XP_006293834.1|  hypothetical protein CARUB_v10022818mg             283   4e-86    Capsella rubella
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     281   7e-86    Eucalyptus grandis [rose gum]
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15        282   7e-86    Eucalyptus grandis [rose gum]
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             281   1e-85    
ref|XP_006857883.1|  PREDICTED: probable methyltransferase PMT16        281   1e-85    Amborella trichopoda
ref|XP_010508116.1|  PREDICTED: probable methyltransferase PMT16        281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        282   1e-85    Nicotiana tomentosiformis
ref|XP_010506552.1|  PREDICTED: probable methyltransferase PMT16        281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002880195.1|  dehydration-responsive family protein              281   1e-85    
ref|XP_010518192.1|  PREDICTED: probable methyltransferase PMT16        281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        281   1e-85    Tarenaya hassleriana [spider flower]
emb|CDY18904.1|  BnaC04g04460D                                          281   2e-85    Brassica napus [oilseed rape]
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        281   2e-85    Eucalyptus grandis [rose gum]
emb|CDX74761.1|  BnaA05g05070D                                          280   2e-85    
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...    281   2e-85    Cicer arietinum [garbanzo]
ref|XP_009143165.1|  PREDICTED: probable methyltransferase PMT16        280   2e-85    Brassica rapa
ref|XP_006397756.1|  hypothetical protein EUTSA_v10001358mg             280   3e-85    Eutrema salsugineum [saltwater cress]
ref|NP_182099.1|  putative methyltransferase PMT16                      280   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140852.1|  PREDICTED: probable methyltransferase PMT15        279   3e-85    Cucumis sativus [cucumbers]
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    280   3e-85    Solanum tuberosum [potatoes]
ref|XP_009142361.1|  PREDICTED: probable methyltransferase PMT16        280   3e-85    Brassica rapa
ref|XP_010692380.1|  PREDICTED: probable methyltransferase PMT15        279   6e-85    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY37061.1|  BnaA04g26390D                                          279   6e-85    Brassica napus [oilseed rape]
gb|KEH17380.1|  methyltransferase PMT16, putative                       276   7e-85    Medicago truncatula
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15        279   8e-85    Tarenaya hassleriana [spider flower]
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        279   1e-84    Nicotiana sylvestris
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        278   1e-84    Nelumbo nucifera [Indian lotus]
gb|ABV72578.1|  dehydration-responsive family protein S51               278   1e-84    Brassica rapa
gb|KFK37364.1|  hypothetical protein AALP_AA4G247100                    278   2e-84    Arabis alpina [alpine rockcress]
ref|XP_003528883.1|  PREDICTED: probable methyltransferase PMT15-...    277   4e-84    Glycine max [soybeans]
ref|XP_010091548.1|  putative methyltransferase PMT15                   277   5e-84    Morus notabilis
ref|XP_010055227.1|  PREDICTED: probable methyltransferase PMT15 ...    276   5e-84    Eucalyptus grandis [rose gum]
ref|XP_011016489.1|  PREDICTED: probable methyltransferase PMT17        268   6e-84    Populus euphratica
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    276   6e-84    
gb|KEH17379.1|  methyltransferase PMT16, putative                       277   6e-84    Medicago truncatula
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             276   8e-84    Capsella rubella
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        276   8e-84    Eucalyptus grandis [rose gum]
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             276   9e-84    Phaseolus vulgaris [French bean]
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    276   1e-83    Eucalyptus grandis [rose gum]
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        276   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        276   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        277   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             276   1e-83    Eutrema salsugineum [saltwater cress]
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        275   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        275   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        275   2e-83    Populus euphratica
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    275   3e-83    Cicer arietinum [garbanzo]
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        274   3e-83    
gb|KHG13750.1|  hypothetical protein F383_08462                         275   4e-83    Gossypium arboreum [tree cotton]
gb|KJB18858.1|  hypothetical protein B456_003G072700                    273   4e-83    Gossypium raimondii
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        274   7e-83    Malus domestica [apple tree]
ref|XP_007134966.1|  hypothetical protein PHAVU_010G090800g             274   8e-83    Phaseolus vulgaris [French bean]
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        273   9e-83    Phoenix dactylifera
gb|KEH21299.1|  methyltransferase PMT16, putative                       273   9e-83    Medicago truncatula
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    274   9e-83    Glycine max [soybeans]
ref|XP_010501748.1|  PREDICTED: probable methyltransferase PMT18        270   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    273   1e-82    Glycine max [soybeans]
emb|CDY54063.1|  BnaA02g36490D                                          271   1e-82    Brassica napus [oilseed rape]
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    280   2e-82    
gb|KJB18848.1|  hypothetical protein B456_003G072700                    273   2e-82    Gossypium raimondii
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        273   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009128495.1|  PREDICTED: probable methyltransferase PMT15        273   2e-82    
ref|NP_191984.1|  putative methyltransferase PMT15                      273   3e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KHN16709.1|  Putative methyltransferase PMT18                        271   3e-82    Glycine soja [wild soybean]
gb|KJB18860.1|  hypothetical protein B456_003G072700                    273   3e-82    Gossypium raimondii
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        272   4e-82    Phoenix dactylifera
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             272   5e-82    Prunus persica
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    271   6e-82    Glycine max [soybeans]
ref|XP_002875017.1|  dehydration-responsive family protein              271   6e-82    
emb|CBI34642.3|  unnamed protein product                                270   7e-82    Vitis vinifera
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    271   8e-82    Cicer arietinum [garbanzo]
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        270   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        271   2e-81    
emb|CDX99540.1|  BnaC09g24520D                                          268   2e-81    
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        270   2e-81    Elaeis guineensis
ref|XP_002317647.1|  dehydration-responsive family protein              270   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        270   2e-81    Elaeis guineensis
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        270   2e-81    Fragaria vesca subsp. vesca
ref|XP_002518966.1|  ATP binding protein, putative                      270   2e-81    Ricinus communis
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        270   2e-81    Nelumbo nucifera [Indian lotus]
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg             270   3e-81    Capsella rubella
emb|CDP12267.1|  unnamed protein product                                270   3e-81    Coffea canephora [robusta coffee]
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        270   3e-81    Camelina sativa [gold-of-pleasure]
ref|NP_564419.1|  putative methyltransferase PMT18                      270   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891032.1|  dehydration-responsive family protein              270   4e-81    
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        269   4e-81    Populus euphratica
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        270   4e-81    Camelina sativa [gold-of-pleasure]
gb|AAF97349.1|AC021045_6  Unknown Protein                               270   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    269   5e-81    Vitis vinifera
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             268   5e-81    Phaseolus vulgaris [French bean]
gb|AFW63361.1|  hypothetical protein ZEAMMB73_276336                    261   6e-81    
emb|CDX99539.1|  BnaC09g24530D                                          269   6e-81    
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    269   6e-81    
gb|KJB24074.1|  hypothetical protein B456_004G127200                    268   6e-81    Gossypium raimondii
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                268   7e-81    Erythranthe guttata [common monkey flower]
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    268   1e-80    
ref|XP_002874627.1|  dehydration-responsive family protein              268   1e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        268   1e-80    Brassica rapa
emb|CDY27362.1|  BnaC04g50430D                                          275   1e-80    Brassica napus [oilseed rape]
ref|XP_011624208.1|  PREDICTED: probable methyltransferase PMT17 ...    268   1e-80    Amborella trichopoda
ref|XP_006846537.2|  PREDICTED: probable methyltransferase PMT17 ...    268   1e-80    Amborella trichopoda
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        268   1e-80    Nicotiana sylvestris
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        268   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        268   2e-80    
ref|NP_192782.1|  putative methyltransferase PMT17                      267   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        267   2e-80    Eucalyptus grandis [rose gum]
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        267   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    267   3e-80    Cicer arietinum [garbanzo]
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             267   4e-80    
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18        266   5e-80    Cucumis sativus [cucumbers]
gb|KJB18849.1|  hypothetical protein B456_003G072700                    264   5e-80    Gossypium raimondii
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        266   6e-80    Brassica rapa
emb|CDX84046.1|  BnaC08g07230D                                          266   6e-80    
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          267   7e-80    Sorghum bicolor [broomcorn]
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        265   1e-79    Cucumis melo [Oriental melon]
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             265   1e-79    Eutrema salsugineum [saltwater cress]
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    265   2e-79    Arabis alpina [alpine rockcress]
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             265   2e-79    Capsella rubella
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        265   2e-79    Brachypodium distachyon [annual false brome]
emb|CDX94256.1|  BnaC02g29160D                                          265   2e-79    
emb|CDY44966.1|  BnaA08g06660D                                          264   2e-79    Brassica napus [oilseed rape]
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             265   3e-79    
gb|KHM99867.1|  Putative methyltransferase PMT18                        262   3e-79    Glycine soja [wild soybean]
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        265   3e-79    Brassica rapa
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        264   4e-79    Brassica rapa
gb|EEE61530.1|  hypothetical protein OsJ_15834                          261   6e-79    Oryza sativa Japonica Group [Japonica rice]
emb|CDM86771.1|  unnamed protein product                                264   6e-79    Triticum aestivum [Canadian hard winter wheat]
gb|KDO43765.1|  hypothetical protein CISIN_1g038698mg                   253   6e-79    Citrus sinensis [apfelsine]
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    263   6e-79    Glycine max [soybeans]
ref|XP_012086579.1|  PREDICTED: probable methyltransferase PMT18 ...    264   7e-79    Jatropha curcas
ref|XP_012086580.1|  PREDICTED: probable methyltransferase PMT18 ...    263   7e-79    Jatropha curcas
ref|XP_012086578.1|  PREDICTED: probable methyltransferase PMT18 ...    263   8e-79    
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        263   8e-79    
ref|XP_002298987.1|  dehydration-responsive family protein              261   8e-79    
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  263   1e-78    Medicago truncatula
dbj|BAJ98046.1|  predicted protein                                      263   1e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        263   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791705.1|  PREDICTED: probable methyltransferase PMT17        261   2e-78    
ref|XP_010110846.1|  putative methyltransferase PMT18                   257   2e-78    
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        262   2e-78    
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        262   2e-78    Sesamum indicum [beniseed]
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        261   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        261   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             261   4e-78    Prunus persica
ref|NP_001053603.1|  Os04g0570800                                       261   4e-78    
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        261   4e-78    Zea mays [maize]
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    261   6e-78    Oryza brachyantha
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        261   7e-78    Pyrus x bretschneideri [bai li]
gb|EEC67295.1|  hypothetical protein OsI_34283                          261   7e-78    Oryza sativa Indica Group [Indian rice]
ref|NP_001065036.1|  Os10g0510400                                       261   7e-78    
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    261   7e-78    Zea mays [maize]
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        261   7e-78    
ref|XP_004953430.1|  PREDICTED: probable methyltransferase PMT16-...    261   8e-78    Setaria italica
dbj|BAJ84848.1|  predicted protein                                      260   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87212.1|  predicted protein                                      260   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             260   1e-77    
dbj|BAJ95401.1|  predicted protein                                      260   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             259   2e-77    Selaginella moellendorffii
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        260   2e-77    Phoenix dactylifera
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        259   2e-77    Malus domestica [apple tree]
ref|XP_008677769.1|  PREDICTED: hypothetical protein isoform X1         260   2e-77    
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549             259   2e-77    
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        259   2e-77    Elaeis guineensis
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          259   2e-77    Sorghum bicolor [broomcorn]
gb|EEC73773.1|  hypothetical protein OsI_08448                          259   2e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        259   2e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             259   3e-77    
ref|NP_001047721.1|  Os02g0675700                                       259   3e-77    
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    259   3e-77    Setaria italica
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             259   4e-77    Phaseolus vulgaris [French bean]
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    259   4e-77    Setaria italica
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        259   5e-77    Prunus mume [ume]
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    258   5e-77    
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    258   5e-77    
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   258   8e-77    Citrus sinensis [apfelsine]
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    258   8e-77    Citrus sinensis [apfelsine]
ref|NP_001056546.2|  Os06g0103900                                       258   1e-76    
gb|EEC79826.1|  hypothetical protein OsI_21282                          258   1e-76    Oryza sativa Indica Group [Indian rice]
gb|ABR16934.1|  unknown                                                 257   1e-76    Picea sitchensis
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    258   1e-76    Setaria italica
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        257   2e-76    Malus domestica [apple tree]
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        257   2e-76    Solanum lycopersicum
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    257   2e-76    Oryza brachyantha
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    257   2e-76    Oryza brachyantha
ref|XP_009405347.1|  PREDICTED: probable methyltransferase PMT17 ...    254   3e-76    
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    256   3e-76    Solanum tuberosum [potatoes]
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    256   4e-76    
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        256   5e-76    Brachypodium distachyon [annual false brome]
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    256   6e-76    Brachypodium distachyon [annual false brome]
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    255   7e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                252   7e-76    Erythranthe guttata [common monkey flower]
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    255   8e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        255   8e-76    Elaeis guineensis
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    255   9e-76    Phoenix dactylifera
gb|KJB51712.1|  hypothetical protein B456_008G228900                    253   1e-75    Gossypium raimondii
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    255   1e-75    Setaria italica
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    255   1e-75    Phoenix dactylifera
gb|KHN21029.1|  Putative methyltransferase PMT14                        253   1e-75    Glycine soja [wild soybean]
ref|XP_011018634.1|  PREDICTED: probable methyltransferase PMT14 ...    251   2e-75    Populus euphratica
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        254   2e-75    Elaeis guineensis
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    254   3e-75    Tarenaya hassleriana [spider flower]
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    254   3e-75    Tarenaya hassleriana [spider flower]
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             253   3e-75    Citrus clementina [clementine]
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    254   4e-75    Tarenaya hassleriana [spider flower]
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    254   4e-75    Tarenaya hassleriana [spider flower]
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    253   4e-75    Glycine max [soybeans]
ref|XP_008373611.1|  PREDICTED: probable methyltransferase PMT14        247   4e-75    
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        253   6e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB51709.1|  hypothetical protein B456_008G228900                    252   8e-75    Gossypium raimondii
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    254   9e-75    
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    254   1e-74    
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    252   1e-74    
gb|KHG27439.1|  hypothetical protein F383_15139                         253   1e-74    
gb|AAX94055.2|  dehydration-induced protein                             252   1e-74    
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        252   2e-74    
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             251   2e-74    
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    251   2e-74    
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        251   2e-74    
ref|XP_001778231.1|  predicted protein                                  251   2e-74    
ref|XP_010110495.1|  putative methyltransferase PMT14                   251   3e-74    
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              251   3e-74    
gb|KCW77891.1|  hypothetical protein EUGRSUZ_D02155                     249   4e-74    
gb|KFK45055.1|  hypothetical protein AALP_AA1G338100                    251   4e-74    
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    251   5e-74    
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    251   5e-74    
gb|EMT22301.1|  hypothetical protein F775_16518                         250   6e-74    
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        250   7e-74    
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             249   8e-74    
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    249   1e-73    
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        249   1e-73    
ref|NP_001147806.1|  methyltransferase                                  249   1e-73    
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        249   2e-73    
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             248   2e-73    
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    248   3e-73    
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    248   3e-73    
ref|XP_008362975.1|  PREDICTED: probable methyltransferase PMT14        246   3e-73    
dbj|BAK03905.1|  predicted protein                                      250   3e-73    
gb|EYU33038.1|  hypothetical protein MIMGU_mgv1a004747mg                245   3e-73    
gb|EMS62160.1|  putative methyltransferase PMT17                        250   4e-73    
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    248   5e-73    
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             248   6e-73    
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        247   8e-73    
emb|CDX78823.1|  BnaA01g08900D                                          247   9e-73    
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          255   9e-73    
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        247   9e-73    
gb|EPS57356.1|  hypothetical protein M569_17462                         235   9e-73    
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    247   1e-72    
gb|EMS54302.1|  putative methyltransferase PMT17                        247   1e-72    
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        246   3e-72    
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        245   3e-72    
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          246   3e-72    
ref|NP_001148962.1|  ankyrin protein kinase-like                        246   3e-72    
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        245   4e-72    
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        245   4e-72    
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        245   4e-72    
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        245   4e-72    
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        245   4e-72    
ref|XP_002868016.1|  dehydration-responsive family protein              245   7e-72    
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14        244   8e-72    
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             244   8e-72    
dbj|BAH19630.1|  AT4G18030                                              244   8e-72    
ref|NP_193537.2|  putative methyltransferase PMT14                      244   9e-72    
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        244   1e-71    
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        244   2e-71    
gb|ACA66248.1|  putative methyltransferase                              243   2e-71    
gb|ACB54686.1|  methyltransferase                                       243   2e-71    
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             243   2e-71    
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        243   2e-71    
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        243   3e-71    
emb|CDP12957.1|  unnamed protein product                                242   6e-71    
ref|XP_002528760.1|  ATP binding protein, putative                      242   7e-71    
ref|XP_001782639.1|  predicted protein                                  242   9e-71    
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             241   1e-70    
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    241   2e-70    
gb|EAY79581.1|  hypothetical protein OsI_34717                          240   2e-70    
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        241   2e-70    
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         241   2e-70    
ref|XP_012089660.1|  PREDICTED: probable methyltransferase PMT14        240   2e-70    
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        241   3e-70    
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         240   3e-70    
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        240   3e-70    
ref|NP_001146334.1|  uncharacterized protein LOC100279910               233   4e-70    
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         240   4e-70    
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          239   7e-70    
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        239   7e-70    
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    239   9e-70    
gb|KDO76124.1|  hypothetical protein CISIN_1g0367251mg                  230   9e-70    
ref|XP_001760613.1|  predicted protein                                  239   1e-69    
ref|NP_001065447.2|  Os10g0569300                                       239   1e-69    
ref|XP_001779831.1|  predicted protein                                  239   1e-69    
gb|AER13154.1|  putative methyltransferase                              229   1e-69    
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2         238   1e-69    
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         238   2e-69    
gb|AAL86466.1|AC077693_5  hypothetical protein                          239   3e-69    
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    238   3e-69    
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             238   3e-69    
ref|XP_006586024.1|  PREDICTED: probable methyltransferase PMT2-l...    235   6e-69    
emb|CDP00327.1|  unnamed protein product                                237   6e-69    
emb|CDY03207.1|  BnaC09g19490D                                          237   6e-69    
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         237   6e-69    
emb|CAA17146.1|  putative protein                                       237   6e-69    
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          237   7e-69    
gb|ACJ85858.1|  unknown                                                 236   8e-69    
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  236   9e-69    
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    236   1e-68    
emb|CDY35169.1|  BnaA09g18060D                                          238   1e-68    
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         236   1e-68    
ref|NP_001280936.1|  uncharacterized protein LOC103402903               236   2e-68    
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         236   2e-68    
dbj|BAJ85549.1|  predicted protein                                      237   2e-68    
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         235   2e-68    
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         235   2e-68    
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    235   2e-68    
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    235   2e-68    
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             235   2e-68    
gb|KHN17371.1|  Putative methyltransferase PMT2                         235   2e-68    
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    235   2e-68    
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         235   3e-68    
emb|CDP12320.1|  unnamed protein product                                240   3e-68    
gb|EAZ09099.1|  hypothetical protein OsI_31366                          235   3e-68    
ref|XP_006827213.1|  PREDICTED: probable methyltransferase PMT2         235   3e-68    
ref|NP_001063174.1|  Os09g0415700                                       235   3e-68    
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         234   3e-68    
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         234   3e-68    
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    234   4e-68    
gb|KHN12213.1|  Putative methyltransferase PMT2                         234   4e-68    
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         234   5e-68    
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    234   6e-68    
gb|KJB60758.1|  hypothetical protein B456_009G324300                    228   9e-68    
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    234   9e-68    
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         233   1e-67    
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         233   1e-67    
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         233   1e-67    
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         233   1e-67    
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  233   1e-67    
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    233   1e-67    
ref|NP_849711.1|  putative methyltransferase PMT2                       231   1e-67    
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             233   1e-67    
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    233   2e-67    
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         233   2e-67    
gb|EMS49438.1|  putative methyltransferase PMT2                         233   2e-67    
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         233   2e-67    
gb|EMT27426.1|  hypothetical protein F775_29617                         233   2e-67    
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         233   2e-67    
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         233   2e-67    
ref|NP_001152470.1|  ankyrin protein kinase-like                        233   2e-67    
gb|ABR16582.1|  unknown                                                 233   2e-67    
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         233   3e-67    
ref|XP_002893375.1|  dehydration-responsive family protein              232   3e-67    
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         232   3e-67    
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    232   3e-67    
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         232   3e-67    
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         232   3e-67    
dbj|BAH19504.1|  AT1G26850                                              232   3e-67    
ref|XP_010089758.1|  putative methyltransferase PMT2                    232   3e-67    
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             232   3e-67    
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    232   3e-67    
gb|ABO92980.1|  putative methyltransferase                              232   3e-67    
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             232   4e-67    
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         232   4e-67    
gb|KGN56551.1|  ATP binding protein                                     221   4e-67    
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    232   5e-67    
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    232   5e-67    
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             232   5e-67    
ref|XP_010029626.1|  PREDICTED: probable methyltransferase PMT2 i...    230   5e-67    
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         231   5e-67    
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    232   5e-67    
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         231   6e-67    
ref|XP_010091504.1|  putative methyltransferase PMT2                    231   6e-67    
tpg|DAA46388.1|  TPA: hypothetical protein ZEAMMB73_857191              231   6e-67    
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         231   6e-67    
ref|XP_002511570.1|  ATP binding protein, putative                      231   6e-67    
gb|AAD14491.1|  Unknown protein                                         231   6e-67    
ref|XP_008800812.1|  PREDICTED: probable methyltransferase PMT15        236   7e-67    
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    231   7e-67    
gb|EMT05545.1|  hypothetical protein F775_20122                         231   7e-67    
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         231   8e-67    
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         231   8e-67    
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         231   9e-67    
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         231   9e-67    
gb|KJB60755.1|  hypothetical protein B456_009G324300                    229   9e-67    
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         231   1e-66    
ref|NP_564265.1|  putative methyltransferase PMT2                       231   1e-66    
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         231   1e-66    
ref|XP_010551538.1|  PREDICTED: probable methyltransferase PMT2 i...    230   1e-66    
ref|XP_006439601.1|  hypothetical protein CICLE_v10019341mg             230   1e-66    
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    231   1e-66    
emb|CAH18000.1|  Ankyrin protein kinase-like                            231   1e-66    
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    231   1e-66    
gb|KJB60756.1|  hypothetical protein B456_009G324300                    229   1e-66    
gb|AAT38682.2|  Methyltransferase family protein, putative              231   2e-66    
emb|CDY45006.1|  BnaCnng12360D                                          230   2e-66    
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    230   2e-66    
gb|AAT39937.2|  Putative methyltransferase family protein               232   2e-66    
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             230   2e-66    
dbj|BAC24840.1|  dehydration-responsive protein-like                    230   3e-66    
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    230   3e-66    
gb|EPS59468.1|  hypothetical protein M569_15338                         229   3e-66    
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         229   3e-66    
gb|AAT38756.2|  Putative methyltransferase family protein               233   3e-66    
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    229   3e-66    
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             229   3e-66    
gb|AAU90305.2|  Methyltransferase, putative                             231   3e-66    
emb|CDY40268.1|  BnaA07g09320D                                          229   3e-66    
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         229   3e-66    
emb|CBI33946.3|  unnamed protein product                                227   4e-66    
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         229   4e-66    
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         229   4e-66    
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         229   4e-66    
gb|KJB60757.1|  hypothetical protein B456_009G324300                    229   4e-66    
gb|KHG10506.1|  hypothetical protein F383_11349                         229   5e-66    
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         229   5e-66    
gb|KHG23981.1|  hypothetical protein F383_09020                         229   7e-66    
emb|CDY46435.1|  BnaA08g19950D                                          228   8e-66    
gb|KJB80180.1|  hypothetical protein B456_013G084900                    228   8e-66    
gb|EYU22422.1|  hypothetical protein MIMGU_mgv1a003056mg                226   8e-66    
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                228   9e-66    
emb|CDY16198.1|  BnaA09g29320D                                          228   9e-66    
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         228   9e-66    
ref|XP_012067633.1|  PREDICTED: probable methyltransferase PMT2 i...    228   1e-65    
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    228   1e-65    
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         228   1e-65    
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         228   1e-65    
ref|XP_012067632.1|  PREDICTED: probable methyltransferase PMT2 i...    228   1e-65    
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         228   1e-65    
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    228   1e-65    
ref|NP_001050233.1|  Os03g0379100                                       228   1e-65    
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         228   1e-65    
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    228   1e-65    
gb|KJB08228.1|  hypothetical protein B456_001G071800                    228   2e-65    



>gb|EYU32062.1| hypothetical protein MIMGU_mgv1a003954mg [Erythranthe guttata]
Length=552

 Score =   319 bits (817),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ A  A +FPPC  + SEYTPCQ  ERSLKFDR ML YRERHCP K ELLKCRIPA
Sbjct  91   LVTLSPAARAAQFPPCDPKFSEYTPCQHVERSLKFDRDMLMYRERHCPEKNELLKCRIPA  150

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            P GYR P RWPESRD VWYANVPHKHLTVEKAGQNWVRF+G+RF+FPGGGTMFPRGADAY
Sbjct  151  PHGYRSPFRWPESRDVVWYANVPHKHLTVEKAGQNWVRFEGDRFSFPGGGTMFPRGADAY  210

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LINL+DGSIRTAIDTGCGVASWGAYLLSR+I P+SFAPKDTHEAQVQFALER +
Sbjct  211  IDDIGKLINLEDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPKDTHEAQVQFALERGV  270

Query  918  P  920
            P
Sbjct  271  P  271


 Score = 88.6 bits (218),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 6/90 (7%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  280
            MAI   L  +LS RTK+TNLYY+A TTVLCS+FYLIGI QHGG +    ++A LLPS+PC
Sbjct  1    MAIWGSLTHYLSLRTKKTNLYYMAITTVLCSIFYLIGIWQHGGAA----TSATLLPSLPC  56

Query  281  --EPlnkdstdttnltssssAVSLDFAAHH  364
              + +     +   L +++SAV+LDF AHH
Sbjct  57   NTDDIKTTGPNPKTLPTNASAVTLDFTAHH  86



>ref|XP_009804054.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=636

 Score =   321 bits (823),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +     FP C  ELSEYTPC+D++RSLKFDR ML YRERHCP K ELLKCRIPA
Sbjct  88   LVPLSPSARVNHFPSCNPELSEYTPCEDSKRSLKFDRNMLIYRERHCPEKNELLKCRIPA  147

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            PFGY+ P RWPESRDSVWYANVPHKHLTVEKAGQNWVRFK +RFTFPGGGTMFPRGADAY
Sbjct  148  PFGYKQPFRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKDDRFTFPGGGTMFPRGADAY  207

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I P+SFAPKDTHEAQVQFALER +
Sbjct  208  IDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPKDTHEAQVQFALERGV  267

Query  918  P  920
            P
Sbjct  268  P  268


 Score = 85.1 bits (209),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  280
            MAI   L  +L++++K+ NLYYVAAT VLC  FY+IG+   GG +  Q+S+  LLP++PC
Sbjct  1    MAIWTNLSHYLTSKSKKANLYYVAATVVLCCTFYVIGLWPQGGVNTTQLSSTTLLPTLPC  60

Query  281  EPlnkdstdttnltssssAVSLDFAAHH  364
             P     +     ++  S++SLDF AHH
Sbjct  61   NP-----SIKNTNSNYGSSISLDFTAHH  83



>ref|XP_009629797.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=636

 Score =   323 bits (829),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +     FP C  ELSEYTPC+D++RSLKFDR ML YRERHCP K ELLKCRIPA
Sbjct  88   LVPLSPSARVNHFPSCNPELSEYTPCEDSKRSLKFDRNMLIYRERHCPEKNELLKCRIPA  147

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            PFGY+ P RWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG+RFTFPGGGTMFPRGADAY
Sbjct  148  PFGYKPPFRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAY  207

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I P+SFAPKDTHEAQVQFALER +
Sbjct  208  IDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPKDTHEAQVQFALERGV  267

Query  918  P  920
            P
Sbjct  268  P  268


 Score = 83.2 bits (204),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  280
            MAI   L  +L++++K+ NLYYVAAT VLC  FY+IG+   GG +  Q+S+  LLP++PC
Sbjct  1    MAIWTNLSHYLTSKSKKANLYYVAATVVLCCTFYVIGLWPQGGVNTTQLSSTTLLPTLPC  60

Query  281  EPlnkdstdttnltssssAVSLDFAAHH  364
             P     +     ++  S++SL+F AHH
Sbjct  61   NP-----SIKNTNSNYGSSISLEFTAHH  83



>ref|XP_006339462.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=636

 Score =   323 bits (828),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +     +P C  ELSEYTPC+D++RSLKFDR ML YRERHCP K ELLKCRIPA
Sbjct  90   LVPLSSSASVNHYPSCNPELSEYTPCEDSKRSLKFDRNMLAYRERHCPEKNELLKCRIPA  149

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            PFGY+ P RWP+SRDSVWYANVPHKHLTVEKAGQNWVRFKG+RFTFPGGGTMFPRGADAY
Sbjct  150  PFGYKPPFRWPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAY  209

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LI LKDGSIRTAIDTGCGVASWGAYLLSRDI P+SFAPKDTHEAQVQFALER +
Sbjct  210  IDDIGKLIKLKDGSIRTAIDTGCGVASWGAYLLSRDILPISFAPKDTHEAQVQFALERGV  269

Query  918  P  920
            P
Sbjct  270  P  270


 Score = 77.0 bits (188),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGG--FSGQQISTAALLPSV  274
            MAI A+L   L++  K+TNLYYVAAT VLC  FY+IG+   GG   S Q  STA++LP++
Sbjct  1    MAILAKLSHSLTSIIKKTNLYYVAATIVLCCTFYVIGLWPQGGDVTSRQLSSTASILPTL  60

Query  275  PCEPlnkdstdttnltssssAVSLDFAAHH  364
            PC P     +      +S S++S+DF AHH
Sbjct  61   PCNP-----SIKNTNPNSGSSISIDFTAHH  85



>ref|XP_004229839.1| PREDICTED: probable methyltransferase PMT15 [Solanum lycopersicum]
Length=636

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +     +P C  ELSEYTPC+D++RSLKFDR ML YRERHCP K ELLKCRIPA
Sbjct  90   LVPLSSSARVNHYPSCNLELSEYTPCEDSKRSLKFDRSMLAYRERHCPEKSELLKCRIPA  149

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            PFGY+ P RWP+SRDSVWYANVPHKHLTVEKAGQNWVRFKG+RFTFPGGGTMFPRGADAY
Sbjct  150  PFGYKPPFRWPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAY  209

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LI LKDGSIRTAIDTGCGVASWGAYLLSRDI P+SFAPKDTHEAQVQFALER +
Sbjct  210  IDDIGKLIKLKDGSIRTAIDTGCGVASWGAYLLSRDILPISFAPKDTHEAQVQFALERGV  269

Query  918  P  920
            P
Sbjct  270  P  270


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGG--FSGQQISTAALLPSV  274
            M I A L   +++  K++NLYYVAAT VLC  FY+IG    GG   S Q  STA +LP++
Sbjct  1    MVILADLTHSITSIIKKSNLYYVAATIVLCCTFYVIGFWPQGGDVTSRQLSSTATILPTL  60

Query  275  PCEPlnkdstdttnltssssAVSLDFAAHH  364
            PC P     +      +S S++ +DF AHH
Sbjct  61   PCNP-----SIKNTNPNSRSSIPIDFTAHH  85



>ref|XP_011091674.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=645

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +  A +FPPC  + SEYTPCQDT RSLKFDR ML YRERHCP K ELLKCR+PA
Sbjct  93   LVPLSPSARALQFPPCDRKFSEYTPCQDTARSLKFDRDMLVYRERHCPEKSELLKCRVPA  152

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            P GY+ P RWPESRD VWYANVPHKHLTVEKAGQNWVRF+G+RF+FPGGGTMFPRGADAY
Sbjct  153  PHGYKTPFRWPESRDVVWYANVPHKHLTVEKAGQNWVRFEGDRFSFPGGGTMFPRGADAY  212

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSRDI P+SFAPKDTHEAQVQFALER +
Sbjct  213  IDDIGKLINLGDGSIRTAIDTGCGVASWGAYLLSRDILPMSFAPKDTHEAQVQFALERGV  272

Query  918  P  920
            P
Sbjct  273  P  273


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALL  265
            MA  A L  +LS RTK+TNLYY+A TTVLCS+FYLIGI QHGG  G   +T+A L
Sbjct  1    MAAWATLTHYLSLRTKKTNLYYMALTTVLCSIFYLIGIWQHGG--GATSTTSATL  53



>ref|XP_009343539.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 154/178 (87%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPA----KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PPA       PPC A+LSEYTPC+D  RSLKFDR+ L YRERHCP KEELLKCRIPAP G
Sbjct  82   PPAAARVDHLPPCNAKLSEYTPCEDLTRSLKFDRKRLVYRERHCPEKEELLKCRIPAPHG  141

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y +P+RWPESRDSVWYANVPHK LTVEK  QNWV + G+RF FPGGGTMFPRGADAYIDD
Sbjct  142  YTVPLRWPESRDSVWYANVPHKELTVEKKKQNWVHYDGDRFRFPGGGTMFPRGADAYIDD  201

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  202  IGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  259


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 13/80 (16%)
 Frame = +2

Query  125  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdst  304
            Q+ S + KR NLYY+    VLC++ YL+GI QH   SG  + TA++     C P      
Sbjct  8    QYFSLKPKRANLYYMTLAAVLCTLCYLVGIWQHS--SGGAVITASVSSVASCPP------  59

Query  305  dttnltssssAVSLDFAAHH  364
                  + +  + LDF AHH
Sbjct  60   -----ITINKTIHLDFKAHH  74



>ref|XP_007220534.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
 gb|EMJ21733.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
Length=632

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 153/178 (86%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PPA       PPC A+LSEYTPCQD  RSLKFDR  L YRERHCP KEELLKCRIPAP G
Sbjct  83   PPAAARVAHLPPCDAKLSEYTPCQDVTRSLKFDRERLVYRERHCPEKEELLKCRIPAPHG  142

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y +P RWPESRDSVWYANVPHK LTVEK  QNWV ++G+RF FPGGGTMFPRGADAYID+
Sbjct  143  YTVPFRWPESRDSVWYANVPHKELTVEKKKQNWVHYEGDRFRFPGGGTMFPRGADAYIDE  202

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI P+SFAP+DTHE QVQFALER +P
Sbjct  203  IGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILPMSFAPRDTHEGQVQFALERGVP  260



>ref|XP_008232735.1| PREDICTED: probable methyltransferase PMT15 [Prunus mume]
Length=632

 Score =   303 bits (776),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 155/178 (87%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPA----KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PPA       PPC A+LSEYTPCQD  RSLKFDR  L YRERHCP K ELLKCRIPAP G
Sbjct  83   PPAAARVSHLPPCDAKLSEYTPCQDVTRSLKFDRERLVYRERHCPEKGELLKCRIPAPHG  142

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y++P +WPESRDSVWYANVPHK LTVEK  QNWV+++G+RF FPGGGTMFPRGADAYID+
Sbjct  143  YKVPFQWPESRDSVWYANVPHKELTVEKKKQNWVQYEGDRFRFPGGGTMFPRGADAYIDE  202

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI P+SFAP+DTHEAQVQFALER +P
Sbjct  203  IGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILPMSFAPRDTHEAQVQFALERGVP  260



>ref|XP_008375906.1| PREDICTED: probable methyltransferase PMT15 [Malus domestica]
Length=632

 Score =   303 bits (775),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 153/178 (86%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPA----KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PPA       PPC A+LSEYTPC+D  RSLKFDR+ L YRERHCP KEELLKCRIPAP G
Sbjct  82   PPAAARVDHLPPCNAKLSEYTPCEDLTRSLKFDRKRLVYRERHCPEKEELLKCRIPAPHG  141

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y +P+RWPESRDSVWYANVPHK LTVEK  QNWV + G+RF FPGGGTMFPRGADAYIDD
Sbjct  142  YTVPLRWPESRDSVWYANVPHKELTVEKKKQNWVHYDGDRFRFPGGGTMFPRGADAYIDD  201

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  202  IGKLINLGDGSVRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  259


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 13/80 (16%)
 Frame = +2

Query  125  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdst  304
            Q+LS + KR NLYY+    VLC++ YL+GI QH   SG  + TA++     C P      
Sbjct  8    QYLSLKPKRANLYYMTLAAVLCTLCYLVGIWQHS--SGGAVITASVSAVASCPP------  59

Query  305  dttnltssssAVSLDFAAHH  364
                  + +  + LDF AHH
Sbjct  60   -----ITINKTIHLDFKAHH  74



>ref|XP_003551650.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=561

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 2/181 (1%)
 Frame = +3

Query  384  AVAQAPPAKEF--PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V  A  +++F  PPC A LSEYTPC+D +RSLKF R  L YRERHCP +EELL+CR+PA
Sbjct  17   VVIGAGASRDFHAPPCAASLSEYTPCEDVQRSLKFPRENLIYRERHCPTEEELLRCRVPA  76

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            PFGYR+P+RWPESRD+ W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGADAY
Sbjct  77   PFGYRVPLRWPESRDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAY  136

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIG+LI+LKDGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +
Sbjct  137  IDDIGKLIDLKDGSIRTALDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGV  196

Query  918  P  920
            P
Sbjct  197  P  197



>gb|ACN78962.1| methyltransferase [Glycine max]
Length=759

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  417  PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPES  596
            PPC A LSEYTPC+D +RSLKF R  L YRERHCP +EELL+CR+PAPFGYR+P+RWPES
Sbjct  91   PPCAASLSEYTPCEDVQRSLKFPRENLIYRERHCPTEEELLRCRVPAPFGYRVPLRWPES  150

Query  597  RDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDG  776
            RD+ W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGADAYIDDIG+LI+LKDG
Sbjct  151  RDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIDLKDG  210

Query  777  SIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            SIRTA+DTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  211  SIRTALDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGVP  258



>emb|CDP08881.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   293 bits (750),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  378  FVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
             V ++ +   ++ PPCK E SEYTPC+D  RSLKFDR    YRERHCP K+ELLKCRIPA
Sbjct  89   LVPLSSSARVEQIPPCKPEFSEYTPCEDVNRSLKFDRDRNIYRERHCPEKDELLKCRIPA  148

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            P GY+   RWP SRD VWYANVPHKHLTVEKA QNWV+FKG+RF FPGGGTMFPRGAD+Y
Sbjct  149  PHGYKTSFRWPASRDMVWYANVPHKHLTVEKAKQNWVQFKGDRFKFPGGGTMFPRGADSY  208

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            I DIG+ INLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH AQVQFALER +
Sbjct  209  IADIGKFINLKDGSIRTAIDTGCGVASWGAYLLSRNILSVSFAPRDTHVAQVQFALERGV  268

Query  918  P  920
            P
Sbjct  269  P  269


 Score = 72.0 bits (175),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  280
            MA  A LP +L+ +TK+T+L+Y+A TTVLCS+ YLIGI QHGG      S  A L  +PC
Sbjct  1    MATWANLPYYLTLKTKKTSLFYMAVTTVLCSLSYLIGIWQHGGLKIAAKSPMATLLELPC  60

Query  281  EPlnkdstdttnltssssAVSLDFAAHH  364
                 +          SS+V+LDF A H
Sbjct  61   S----NLNKNFTTIGGSSSVTLDFTARH  84



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            +P  K +PPC  + SEYTPC+D ERSLKFDR  L YRERHCP K ELLKCR+PAP+GY+ 
Sbjct  112  SPAIKSYPPCDIKYSEYTPCEDQERSLKFDRDRLIYRERHCPEKNELLKCRVPAPYGYKN  171

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYIDDIG+
Sbjct  172  PFQWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGK  231

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  232  LINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  286



>ref|XP_003533625.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=622

 Score =   295 bits (754),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = +3

Query  402  PAKEF--PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            PA++F  PPC   LSEYTPC+D +RSLKF R  L YRERHCP  EELL+CR+PAPFGYR+
Sbjct  77   PARDFYAPPCDPSLSEYTPCEDVQRSLKFPRENLIYRERHCPPAEELLRCRVPAPFGYRV  136

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P+RWPESRD+ W+ANVPHK LTVEK  QNWVRF+G++F FPGGGTMFPRGA AYIDDIG+
Sbjct  137  PLRWPESRDAAWFANVPHKELTVEKKNQNWVRFEGDQFRFPGGGTMFPRGAGAYIDDIGK  196

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LINL+DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  197  LINLEDGSIRTALDTGCGVASWGAYLLSRDIIAVSFAPRDTHEAQVQFALERGVP  251



>ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15 [Vitis vinifera]
 emb|CBI38771.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   295 bits (754),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +3

Query  387  VAQAPPAK--EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            +A   PA+   FP C   LSEYTPC+D +RSLKFDR ML YRERHCP   E+LKCR+PAP
Sbjct  82   IAPTSPARVNHFPACPTYLSEYTPCEDAQRSLKFDRVMLVYRERHCPEPNEVLKCRVPAP  141

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
             GY  P RWPESRDSVW+ANVPHK LTVEKA QNWVRF+G+RF FPGGGTMFPRGADAYI
Sbjct  142  NGYTTPFRWPESRDSVWFANVPHKELTVEKAVQNWVRFEGKRFRFPGGGTMFPRGADAYI  201

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            D+IG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  202  DEIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHEAQVQFALERGVP  261



>ref|XP_007139952.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
 gb|AER13155.1| putative methyltransferase [Phaseolus vulgaris]
 gb|ESW11946.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
Length=634

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  417  PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPES  596
            PPC A L+EYTPC+D  RSLKF R  L YRERHCP + E L+CRIPAPFGYR+P+RWPES
Sbjct  101  PPCDATLAEYTPCEDVNRSLKFPREDLIYRERHCPVEAEALRCRIPAPFGYRVPLRWPES  160

Query  597  RDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDG  776
            RD+ W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGA AYIDDIG+LINLKDG
Sbjct  161  RDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGASAYIDDIGKLINLKDG  220

Query  777  SIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            SIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  221  SIRTAIDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGVP  268



>ref|XP_009349944.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              P C A+ SEYTPC+D  RSLKFDR  L YRERHCP KEELLKCRIPAP GY++P RWP
Sbjct  90   HLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYKVPFRWP  149

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGGGTMFPRGADAYIDDIG+LINL+
Sbjct  150  ESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLR  209

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  210  EGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  259



>gb|KJB09868.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=564

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             FPPC    SEYTPC+D  RSLKFDR ML YR+RHCPAK ELLKCRIPAP+GY++P RWP
Sbjct  91   HFPPCNISFSEYTPCEDARRSLKFDRDMLIYRQRHCPAKNELLKCRIPAPYGYKVPFRWP  150

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR+  W+ANVPHK LTVEK  QNWV+ +GE+F FPGGGTMFPRGA AYIDDI +LINLK
Sbjct  151  ESREFAWFANVPHKELTVEKKAQNWVKVEGEKFRFPGGGTMFPRGAGAYIDDIDKLINLK  210

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  211  DGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDTHEAQVQFALERGVP  260



>ref|XP_012083473.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Jatropha 
curcas]
 gb|KDP28686.1| hypothetical protein JCGZ_14457 [Jatropha curcas]
Length=628

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
                PPC  + SEYTPC+D ERSLKFDR+ L YRERHCP K ELLKCR+PAPFGYR+P R
Sbjct  85   VSHLPPCDPKYSEYTPCEDRERSLKFDRKKLVYRERHCPEKNELLKCRVPAPFGYRVPFR  144

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SR+ VWYA+VPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGADAYIDDIG+LIN
Sbjct  145  WPVSREYVWYADVPHKELTVEKKKQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIN  204

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTA+DTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  205  LKDGSIRTAVDTGCGVASFGAYLLSRNILTVSFAPRDTHEAQVQFALERGVP  256


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 19/90 (21%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQH--GGFSGQQISTAALLPSV  274
            MAIS +    L ++TK+ NLY +   T+LC+VFY IG  Q+  G       +T A+L   
Sbjct  1    MAISIQT-SVLMSKTKKANLYKITVITILCTVFYFIGFYQNSRGSIPTSPAATIAIL---  56

Query  275  PCEPlnkdstdttnltssssAVSLDFAAHH  364
            PC P  ++              +LDF+AHH
Sbjct  57   PCSPPIRN-------------TTLDFSAHH  73



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            AK +PPC  + SEYTPC+D +RSLKF R  L YRERHCPAK ELLKCRIPAP+GYR P +
Sbjct  114  AKVYPPCDVKYSEYTPCEDPKRSLKFSRSRLIYRERHCPAKHELLKCRIPAPYGYRNPFK  173

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYIDDIG+LIN
Sbjct  174  WPLSRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLIN  233

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  234  LKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  285



>ref|XP_004306838.1| PREDICTED: probable methyltransferase PMT15 [Fragaria vesca subsp. 
vesca]
Length=627

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              PPC A L+EYTPC+D  RSLKF+R  L YRERHCP K ELLKCRIPAP GY++P RWP
Sbjct  86   HVPPCDARLAEYTPCEDATRSLKFERDRLVYRERHCPEKNELLKCRIPAPHGYQVPFRWP  145

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR SVWYANVPHK LTVEK  QNWV ++G+RF FPGGGTMFP GADAYIDDIGRLINL+
Sbjct  146  ESRGSVWYANVPHKELTVEKKNQNWVHYEGDRFRFPGGGTMFPNGADAYIDDIGRLINLR  205

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWG YLLSRDI  +SFAP+DTHEAQVQFALER IP
Sbjct  206  DGSIRTAIDTGCGVASWGGYLLSRDILTVSFAPRDTHEAQVQFALERGIP  255



>ref|XP_012083474.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Jatropha 
curcas]
Length=627

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
                PPC  + SEYTPC+D ERSLKFDR+ L YRERHCP K ELLKCR+PAPFGYR+P R
Sbjct  85   VSHLPPCDPKYSEYTPCEDRERSLKFDRKKLVYRERHCPEKNELLKCRVPAPFGYRVPFR  144

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SR+ VWYA+VPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGADAYIDDIG+LIN
Sbjct  145  WPVSREYVWYADVPHKELTVEKKKQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIN  204

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTA+DTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  205  LKDGSIRTAVDTGCGVASFGAYLLSRNILTVSFAPRDTHEAQVQFALERGVP  256


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 19/90 (21%)
 Frame = +2

Query  101  MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQH--GGFSGQQISTAALLPSV  274
            MAIS +    L ++TK+ NLY +   T+LC+VFY IG  Q+  G       +T A+L   
Sbjct  1    MAISIQT-SVLMSKTKKANLYKITVITILCTVFYFIGFYQNSRGSIPTSPAATIAIL---  56

Query  275  PCEPlnkdstdttnltssssAVSLDFAAHH  364
            PC P  ++              +LDF+AHH
Sbjct  57   PCSPPIRN-------------TTLDFSAHH  73



>ref|XP_004309222.1| PREDICTED: probable methyltransferase PMT16 [Fragaria vesca subsp. 
vesca]
Length=646

 Score =   293 bits (750),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K FPPC  + SEYTPC+D +RSLKF+R  L YRERHCPAK+ELLKCR+PAP GYR    W
Sbjct  108  KTFPPCDVKYSEYTPCEDAKRSLKFERERLIYRERHCPAKDELLKCRVPAPHGYRNTFTW  167

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WYANVPHK LT+EKA QNW+ ++G+RF FPGGGTMFP GADAYIDDIG+LINL
Sbjct  168  PKSRDLAWYANVPHKELTIEKAVQNWIIYQGDRFKFPGGGTMFPNGADAYIDDIGKLINL  227

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSRDI P+SFAP+DTHEAQVQFALER +P
Sbjct  228  KDGSIRTAIDTGCGVASWGAYLLSRDILPISFAPRDTHEAQVQFALERGVP  278



>ref|XP_008383220.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=583

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              P C A+ SEYTPC+D  RSLKFDR  L YRERHCP KEELLKCRIPAP GY +P RWP
Sbjct  41   HLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYTVPFRWP  100

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGGGTMFPRGADAYIDDIG+LINL+
Sbjct  101  ESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLR  160

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  161  GGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  210



>ref|XP_009770932.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=653

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AVA     K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP K ELLKCRIPAP+
Sbjct  108  AVAPDDAVKIYPPCDVKFSEYTPCEDQKRSLKFKRDRLIYRERHCPEKNELLKCRIPAPY  167

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYID
Sbjct  168  GYKNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFPNGADAYID  227

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  228  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  286



>ref|XP_002511797.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50466.1| ATP binding protein, putative [Ricinus communis]
Length=627

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 153/179 (85%), Gaps = 5/179 (3%)
 Frame = +3

Query  399  PPAK-----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            PP K       PPC  ELSEYTPC+D +RSL+FDR  L YRERHCP K+ELLKCR+PAPF
Sbjct  75   PPLKAARVLHLPPCDPELSEYTPCEDRQRSLQFDRDRLVYRERHCPEKKELLKCRVPAPF  134

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR+P RWP SR+  W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMFPRGADAYID
Sbjct  135  GYRVPFRWPVSREYGWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAYID  194

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  195  DIGKLINLKDGSIRTAIDTGCGVASFGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  253



>ref|XP_008354467.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=628

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              P C A+ SEYTPC+D  RSLKFDR  L YRERHCP KEELLKCRIPAP GY +P RWP
Sbjct  86   HLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYTVPFRWP  145

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGGGTMFPRGADAYIDDIG+LINL+
Sbjct  146  ESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLR  205

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  206  GGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  255



>ref|XP_012090301.1| PREDICTED: probable methyltransferase PMT16 [Jatropha curcas]
 gb|KDP22318.1| hypothetical protein JCGZ_26149 [Jatropha curcas]
Length=652

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            A   P K +PPC    SEYTPC+D  RSL+F RR L YRERHCP K+E +KCR+PAP+GY
Sbjct  104  AATSPVKVYPPCNVNFSEYTPCEDARRSLRFSRRQLIYRERHCPEKDERIKCRVPAPYGY  163

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDI  749
            + P  WP+SRD  WYANVPHKHLTVEKA QNW+R++G+RF FPGGGTMFP GADAYIDDI
Sbjct  164  KNPFAWPKSRDLAWYANVPHKHLTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDI  223

Query  750  GRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            G+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  224  GKLINLNDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  280



>ref|XP_006421866.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
 gb|ESR35106.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
Length=626

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            A +     K +P C    SEYTPCQD +RSLKF RR L YRERHCPAK ELLKCR+PAP+
Sbjct  80   ATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLIYRERHCPAKSELLKCRVPAPY  139

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR P  WP SRD VWYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYID
Sbjct  140  GYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYID  199

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  200  DIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTHEAQVQFALERGVP  258



>ref|XP_006490342.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|KDO60066.1| hypothetical protein CISIN_1g006905mg [Citrus sinensis]
Length=626

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            A +     K +P C    SEYTPCQD +RSLKF RR L YRERHCPAK ELLKCR+PAP+
Sbjct  80   ATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLIYRERHCPAKSELLKCRVPAPY  139

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR P  WP SRD VWYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYID
Sbjct  140  GYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYID  199

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  200  DIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTHEAQVQFALERGVP  258



>ref|XP_002318832.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
 gb|EEE97052.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
Length=655

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K +P C    SEYTPC+D +RSL+F R  L YRERHCP K E+LKCRIPAP GY+ P +
Sbjct  114  VKSYPSCNVNFSEYTPCEDAKRSLRFKRHQLIYRERHCPEKHEILKCRIPAPHGYKNPFK  173

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY NVPHKHLTVEKAGQNW+RF G+RF FPGGGTMFP GADAYIDDIGRLIN
Sbjct  174  WPASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGGGTMFPNGADAYIDDIGRLIN  233

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  234  LKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  285



>gb|KJB09867.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=628

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             FPPC    SEYTPC+D  RSLKFDR ML YR+RHCPAK ELLKCRIPAP+GY++P RWP
Sbjct  91   HFPPCNISFSEYTPCEDARRSLKFDRDMLIYRQRHCPAKNELLKCRIPAPYGYKVPFRWP  150

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESR+  W+ANVPHK LTVEK  QNWV+ +GE+F FPGGGTMFPRGA AYIDDI +LINLK
Sbjct  151  ESREFAWFANVPHKELTVEKKAQNWVKVEGEKFRFPGGGTMFPRGAGAYIDDIDKLINLK  210

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  211  DGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDTHEAQVQFALERGVP  260



>gb|KHG14191.1| hypothetical protein F383_16741 [Gossypium arboreum]
Length=629

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A +FPPC    SEYTPC+D +RSLKFDR ML YRERHCP K+ELLKCRIPAP+GY++P R
Sbjct  92   AAQFPPCDHSFSEYTPCEDVQRSLKFDRDMLIYRERHCPEKDELLKCRIPAPYGYKVPFR  151

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+ R+  W+ANVPHK LTVEK  QNW++ +G+RF FPGGGTMFP GADAYIDDI +LIN
Sbjct  152  WPQGREFAWFANVPHKELTVEKKNQNWIKVEGDRFRFPGGGTMFPHGADAYIDDIDKLIN  211

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  212  LRDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  263



>ref|XP_010255518.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C  + SEYTPC+DT+RSLKF+R  L YRERHCP K ELLKCR+PAP+GY+ P  WPE
Sbjct  105  FPACDVKYSEYTPCEDTKRSLKFERDRLIYRERHCPQKAELLKCRVPAPYGYKSPFTWPE  164

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  WYANVPHK LTVEKAGQNW+RF+G+RF FPGGGTMFP GADAYID+IG+LINL+D
Sbjct  165  SRDFAWYANVPHKELTVEKAGQNWIRFEGDRFRFPGGGTMFPNGADAYIDEIGKLINLRD  224

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  225  GSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVP  273



>gb|KEH18956.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  399  PPAK-----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            PP K       PPC+  L EYTPC+D +RSL+F R+ L YRERHCP  EE L+CRIPAPF
Sbjct  95   PPLKTARVSHLPPCEPSLYEYTPCEDQKRSLRFSRKKLIYRERHCPLPEETLRCRIPAPF  154

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR+P+RWPESRD  WYANVPHK LTVEK  QNWVRF G RF FPGGGTMFPRGA+AY+D
Sbjct  155  GYRLPLRWPESRDGAWYANVPHKELTVEKKNQNWVRFNGNRFRFPGGGTMFPRGANAYVD  214

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +S AP+DTHEAQVQFALER +P
Sbjct  215  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTVSVAPRDTHEAQVQFALERGVP  273



>ref|XP_009610423.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=651

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV      K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP K ELLKCRIPAP+
Sbjct  106  AVTADDAVKIYPPCDFKYSEYTPCEDQKRSLKFKRDRLIYRERHCPEKSELLKCRIPAPY  165

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYID
Sbjct  166  GYKNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFPNGADAYID  225

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  226  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  284



>gb|KDO86014.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=544

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
             PPC  +  E  PC+DT RSLKFDR  L YRERHCP K ELLKCR+PAP GY +P RWPE
Sbjct  97   IPPCDPKYVENVPCEDTHRSLKFDRDRLIYRERHCPEKTELLKCRVPAPHGYTVPFRWPE  156

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SR   WYANVPHK LTVEK  QNWVRF+G+RF+FPGGGTMFPRGADAYIDDIG+LINLKD
Sbjct  157  SRQFAWYANVPHKELTVEKKNQNWVRFQGDRFSFPGGGTMFPRGADAYIDDIGKLINLKD  216

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  217  GSIRTAIDTGCGVASWGAYLMSRNILAVSFAPRDTHEAQVQFALERGVP  265


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +2

Query  92   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  268
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  269  SVPCEPlnkdstdttnltssssAVSLDFAAHH  364
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>gb|KJB41226.1| hypothetical protein B456_007G095700 [Gossypium raimondii]
Length=629

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A +FPPC    SEYTPC+D +RSLKFDR ML YRERHCP K+ELLKCRIPAP+GY++P R
Sbjct  92   AAQFPPCDPSFSEYTPCEDVQRSLKFDRDMLIYRERHCPEKDELLKCRIPAPYGYKVPFR  151

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+ R+  W+ANVPHK LTVEK  QNW++ +G+RF FPGGGTMFP GADAYIDDI +LI+
Sbjct  152  WPQGREFAWFANVPHKELTVEKKNQNWIKVEGDRFRFPGGGTMFPHGADAYIDDIDKLIS  211

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  212  LRDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  263



>ref|XP_002510829.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51431.1| ATP binding protein, putative [Ricinus communis]
Length=649

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
             V  AP  K +PPC    SEYTPC+D  RSL+F+RR L YRERHCP   E +KCRIPAP+
Sbjct  100  GVTVAPEVKIYPPCNVNFSEYTPCEDDNRSLRFNRRQLIYRERHCPETYEKIKCRIPAPY  159

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P  WP SR+  WYANVPHKHLTVEKA QNW+R++G+RF FPGGGTMFP GADAYID
Sbjct  160  GYKNPFTWPASRNFAWYANVPHKHLTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYID  219

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  220  DIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  278



>ref|XP_009801988.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nicotiana 
sylvestris]
Length=648

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV      K +PPC  + SEYTPC+D ERSLKF+R  L YRERHCP K ELLKCRIPAP+
Sbjct  105  AVTPDDSIKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKNELLKCRIPAPY  164

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYID
Sbjct  165  GYKNPFKWPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYID  224

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  225  DIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVP  283



>ref|XP_007051921.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOX96078.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=548

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              PPC    SEYTPC+D +RSLKFDR ML YRERHCP K ELLKCR+PAP+GY++P RWP
Sbjct  94   HLPPCDLSFSEYTPCEDVKRSLKFDRGMLVYRERHCPEKNELLKCRVPAPYGYKVPFRWP  153

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SR+  W+ANVPHK LTVEK  QNWV+ +GE F FPGGGTMFPRGADAYIDDI  LINLK
Sbjct  154  RSREFAWFANVPHKELTVEKKNQNWVKVEGELFRFPGGGTMFPRGADAYIDDIDELINLK  213

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  214  DGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHEAQVQFALERGVP  263



>ref|XP_011101180.1| PREDICTED: probable methyltransferase PMT16 [Sesamum indicum]
Length=645

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            +  +PPC  + SEYTPC+D +RSLKF R  L YRERHCP K+E L+CR+PAP+GY+ P +
Sbjct  108  SSTYPPCSIKYSEYTPCEDQKRSLKFPRDRLIYRERHCPEKKERLRCRVPAPYGYKNPFK  167

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD VWYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYIDDIG+LIN
Sbjct  168  WPVSRDLVWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLIN  227

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGVASWGAYLLSR+I P+SFAP+DTHEAQVQFALER +P
Sbjct  228  LKDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPRDTHEAQVQFALERGVP  279



>ref|XP_006353348.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=647

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV      K +PPC  + SEYTPC+D  RSLK++R  L YRERHCP K E LKCRIPAP+
Sbjct  105  AVVPDDTVKIYPPCDVKYSEYTPCEDPARSLKYNRDRLIYRERHCPEKSEFLKCRIPAPY  164

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYID
Sbjct  165  GYKNPFKWPMSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYID  224

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  225  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVP  283



>ref|XP_009801989.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nicotiana 
sylvestris]
Length=647

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV      K +PPC  + SEYTPC+D ERSLKF+R  L YRERHCP K ELLKCRIPAP+
Sbjct  105  AVTPDDSIKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKNELLKCRIPAPY  164

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYID
Sbjct  165  GYKNPFKWPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYID  224

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  225  DIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVP  283



>ref|XP_011030063.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=655

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K +P C    SEYTPC+D +RSL+F R  L  RERHCP K E+LKCRIPAP GY+ P +
Sbjct  114  VKSYPSCNVNFSEYTPCEDAKRSLRFKRHQLICRERHCPEKHEILKCRIPAPHGYKNPFK  173

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY NVPHKHLTVEKAGQNW+RF G+RF FPGGGTMFP GADAYIDDIGRLIN
Sbjct  174  WPASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGGGTMFPNGADAYIDDIGRLIN  233

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHEAQVQFALER +P
Sbjct  234  LKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVP  285



>ref|XP_004234366.1| PREDICTED: probable methyltransferase PMT16 [Solanum lycopersicum]
Length=650

 Score =   288 bits (736),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV      K +PPC  + SEYTPC+D  RSLK++R  L YRERHCP K E LKCRIPAP+
Sbjct  108  AVVPDDTVKIYPPCDVKYSEYTPCEDPTRSLKYNRDRLIYRERHCPEKSEFLKCRIPAPY  167

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYID
Sbjct  168  GYKNPFKWPMSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYID  227

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  228  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVP  286



>ref|XP_006445150.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 ref|XP_006491016.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|ESR58390.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 gb|KDO86013.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=636

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
             PPC  +  E  PC+DT RSLKFDR  L YRERHCP K ELLKCR+PAP GY +P RWPE
Sbjct  97   IPPCDPKYVENVPCEDTHRSLKFDRDRLIYRERHCPEKTELLKCRVPAPHGYTVPFRWPE  156

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SR   WYANVPHK LTVEK  QNWVRF+G+RF+FPGGGTMFPRGADAYIDDIG+LINLKD
Sbjct  157  SRQFAWYANVPHKELTVEKKNQNWVRFQGDRFSFPGGGTMFPRGADAYIDDIGKLINLKD  216

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  217  GSIRTAIDTGCGVASWGAYLMSRNILAVSFAPRDTHEAQVQFALERGVP  265


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +2

Query  92   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  268
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  269  SVPCEPlnkdstdttnltssssAVSLDFAAHH  364
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>gb|KDO86012.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=637

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
             PPC  +  E  PC+DT RSLKFDR  L YRERHCP K ELLKCR+PAP GY +P RWPE
Sbjct  97   IPPCDPKYVENVPCEDTHRSLKFDRDRLIYRERHCPEKTELLKCRVPAPHGYTVPFRWPE  156

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SR   WYANVPHK LTVEK  QNWVRF+G+RF+FPGGGTMFPRGADAYIDDIG+LINLKD
Sbjct  157  SRQFAWYANVPHKELTVEKKNQNWVRFQGDRFSFPGGGTMFPRGADAYIDDIGKLINLKD  216

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  217  GSIRTAIDTGCGVASWGAYLMSRNILAVSFAPRDTHEAQVQFALERGVP  265


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +2

Query  92   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  268
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  269  SVPCEPlnkdstdttnltssssAVSLDFAAHH  364
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>gb|EYU19524.1| hypothetical protein MIMGU_mgv1a002864mg [Erythranthe guttata]
Length=629

 Score =   287 bits (734),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRIPV  581
             K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP K+ ELLKCR+PAP GY+ P 
Sbjct  94   VKPYPPCSGKYSEYTPCEDPKRSLKFPRDKLIYRERHCPEKKKELLKCRVPAPHGYKNPF  153

Query  582  RWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLI  761
            +WP SRD VWYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYIDDIG+LI
Sbjct  154  KWPASRDLVWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLI  213

Query  762  NLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            NLKDGSIRTAIDTGCGVASWGAYL+SR+I P+SFAP+DTHEAQVQFALER +P
Sbjct  214  NLKDGSIRTAIDTGCGVASWGAYLMSRNILPISFAPRDTHEAQVQFALERGVP  266



>ref|XP_003623835.1| hypothetical protein MTR_7g076170 [Medicago truncatula]
 gb|ABN08826.1| Generic methyltransferase [Medicago truncatula]
 gb|AES80053.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   287 bits (735),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  417  PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPES  596
            P C   LSEYTPC+DT+RSLKF R  L YRERHCP KEE+L+CRIPAP+GYR+P RWPES
Sbjct  102  PVCDVALSEYTPCEDTQRSLKFPRENLIYRERHCPEKEEVLRCRIPAPYGYRVPPRWPES  161

Query  597  RDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDG  776
            RD  WYANVPHK LT+EK  QNWV F+G+RF FPGGGTMFPRGA AYIDDIG+LINLKDG
Sbjct  162  RDWAWYANVPHKELTIEKKNQNWVHFEGDRFRFPGGGTMFPRGAGAYIDDIGKLINLKDG  221

Query  777  SIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            S+RTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  222  SVRTALDTGCGVASWGAYLLPRDILAVSFAPRDTHEAQVQFALERGVP  269



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score =   287 bits (734),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            V Q      FPPC ++L EYTPC+D +RSLKFDR  L YRERHCP   E+LKCR+PAP G
Sbjct  84   VVQKARRPNFPPCDSKLYEYTPCEDRDRSLKFDRDRLIYRERHCPEAGEILKCRVPAPPG  143

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y++P RWPESRD  W++NVPHK LTVEK  QNWVRF+ +RF FPGGGTMFPRGADAYIDD
Sbjct  144  YKVPFRWPESRDFAWFSNVPHKELTVEKKNQNWVRFENDRFRFPGGGTMFPRGADAYIDD  203

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  204  IGKLINLADGSIRTAVDTGCGVASWGAYLLSRNIVTMSFAPRDTHEAQVQFALERGVP  261



>ref|XP_009626220.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=650

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K +PPC  + SEYTPC+D ERSLKF+R  L YRERHCP K+ELLKCRIPAP+GY+ P +W
Sbjct  116  KIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKKELLKCRIPAPYGYKNPFKW  175

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW+R++G+RF FPGGGTMFP GADAYIDDIG+LINL
Sbjct  176  PISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLINL  235

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  236  NDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVP  286



>ref|XP_007051920.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX96077.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=635

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              PPC    SEYTPC+D +RSLKFDR ML YRERHCP K ELLKCR+PAP+GY++P RWP
Sbjct  94   HLPPCDLSFSEYTPCEDVKRSLKFDRGMLVYRERHCPEKNELLKCRVPAPYGYKVPFRWP  153

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SR+  W+ANVPHK LTVEK  QNWV+ +GE F FPGGGTMFPRGADAYIDDI  LINLK
Sbjct  154  RSREFAWFANVPHKELTVEKKNQNWVKVEGELFRFPGGGTMFPRGADAYIDDIDELINLK  213

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  214  DGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHEAQVQFALERGVP  263



>ref|XP_008439398.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=603

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            AK FP C    SEYTPC+DT RSLKF R  L YRERHCP KEE LKCRIPAP GYR P  
Sbjct  60   AKPFPACGLNYSEYTPCEDTHRSLKFSRDRLIYRERHCPEKEESLKCRIPAPPGYRNPFA  119

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY NVPHKHLTVEKA QNW+R++GE F FPGGGTMFP GADAYID+IG+LIN
Sbjct  120  WPVSRDLAWYVNVPHKHLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADAYIDNIGKLIN  179

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGV SWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  180  LKDGSIRTAIDTGCGVGSWGAYLLSRDIITMSFAPRDTHEAQVQFALERGVP  231



>ref|XP_006340522.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=654

 Score =   285 bits (730),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K +P C  + SEYTPC+D ERSLKF+RR L YRERHCP K ELLKCRIPAP+GY+ P +W
Sbjct  117  KIYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNELLKCRIPAPYGYKNPFKW  176

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW+R++G++F FPGGGTMFP GADAYIDDI +LINL
Sbjct  177  PVSRDVAWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINL  236

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  237  KDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVP  287



>ref|XP_011035186.1| PREDICTED: probable methyltransferase PMT15 isoform X3 [Populus 
euphratica]
Length=628

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  393  QAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYR  572
            Q   A   PPC  + SE+TPC+D ERSLKFDR  L YRERHCP   E+LKCR+PAP+GY+
Sbjct  83   QVARAHHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPESHEILKCRVPAPYGYK  142

Query  573  IPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIG  752
            +P RWPESR+  WYANVPHK LTVEK  QNWV  +GER  FPGGGTMFPRGADAYIDDIG
Sbjct  143  VPFRWPESREFAWYANVPHKELTVEKKNQNWVHVEGERLRFPGGGTMFPRGADAYIDDIG  202

Query  753  RLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER +P
Sbjct  203  QLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVP  258



>ref|XP_010321993.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K +P C  + SEYTPC+D ERSLKF+RR L YRERHCP K E+LKCRIPAP+GY+ P +W
Sbjct  114  KIYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNEVLKCRIPAPYGYKNPFKW  173

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD VWYANVPHK LTVEKA QNW+R++G++F FPGGGTMFP GADAYIDDI +LINL
Sbjct  174  PVSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINL  233

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  234  KDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVP  284



>ref|XP_004240739.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Solanum 
lycopersicum]
Length=651

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K +P C  + SEYTPC+D ERSLKF+RR L YRERHCP K E+LKCRIPAP+GY+ P +W
Sbjct  114  KIYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNEVLKCRIPAPYGYKNPFKW  173

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD VWYANVPHK LTVEKA QNW+R++G++F FPGGGTMFP GADAYIDDI +LINL
Sbjct  174  PVSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINL  233

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  234  KDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVP  284



>ref|XP_011023413.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=623

 Score =   284 bits (727),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 151/183 (83%), Gaps = 2/183 (1%)
 Frame = +3

Query  378  FVAVAQAPPAKE--FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRI  551
            F    + P A+E  FPPC+ + SEYTPC+D ERS++FDR  + YRERHCP   E+LKCR+
Sbjct  77   FAQDPKPPVAREHHFPPCEPKYSEYTPCEDAERSVRFDRNRVIYRERHCPESHEILKCRV  136

Query  552  PAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGAD  731
            P P+GY++P  WPESRD  WYANVPHK LTVEK  QNWVR +GER  FPGGGTMFPRGAD
Sbjct  137  PPPYGYKVPFSWPESRDWAWYANVPHKDLTVEKKNQNWVRVEGERLRFPGGGTMFPRGAD  196

Query  732  AYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALER  911
            AYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER
Sbjct  197  AYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHVSQVQFALER  256

Query  912  XIP  920
             +P
Sbjct  257  GVP  259



>ref|XP_011650766.1| PREDICTED: probable methyltransferase PMT16 [Cucumis sativus]
Length=635

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            V Q      FPPC ++L EYTPC+D ERSLKFDR  L YRERHCP   E+LKCR+PAP G
Sbjct  84   VVQKARRPNFPPCDSKLYEYTPCEDRERSLKFDRDRLIYRERHCPEAGEILKCRVPAPAG  143

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y++P RWPESRD  W++NVPHK LTVEK  QNWVRF+ +RF FPGGGTMFPRGADAYIDD
Sbjct  144  YKVPFRWPESRDFAWFSNVPHKELTVEKKNQNWVRFENDRFRFPGGGTMFPRGADAYIDD  203

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LINL DGSIRTA+DTG GVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  204  IGKLINLADGSIRTAVDTGWGVASWGAYLLSRNIVTMSFAPRDTHEAQVQFALERGVP  261



>ref|XP_011035172.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Populus 
euphratica]
 ref|XP_011035179.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Populus 
euphratica]
Length=628

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  393  QAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYR  572
            Q   A   PPC  + SE+TPC+D ERSLKFDR  L YRERHCP   E+LKCR+PAP+GY+
Sbjct  83   QVARAHHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPEIHEILKCRVPAPYGYK  142

Query  573  IPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIG  752
            +P RWPESR+  WYANVPHK LTVEK  QNWV  +GER  FPGGGTMFPRGADAYIDDIG
Sbjct  143  VPFRWPESREFAWYANVPHKELTVEKKNQNWVHVEGERLRFPGGGTMFPRGADAYIDDIG  202

Query  753  RLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER +P
Sbjct  203  QLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVP  258



>ref|XP_011041603.1| PREDICTED: probable methyltransferase PMT16 [Populus euphratica]
Length=631

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V      + +P C   LSEYTPC+D +RS KF R  L Y ERHCP K+E+LKCRIPAP
Sbjct  82   LDVTSTSEVRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLIYEERHCPEKDEILKCRIPAP  141

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
            +GYR P  WP SRD  WY NVPHKHLTVEKA QNW+RF+ +RF FPGGGTMFP GADAYI
Sbjct  142  YGYRNPFTWPASRDYAWYNNVPHKHLTVEKAVQNWIRFEADRFRFPGGGTMFPNGADAYI  201

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI+LKDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+D HEAQVQFALER +P
Sbjct  202  DDIGRLIDLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDNHEAQVQFALERGVP  261



>ref|XP_002279420.2| PREDICTED: probable methyltransferase PMT15 isoform X1 [Vitis 
vinifera]
 emb|CBI31829.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            VA       K +P C  E SEYTPC+ T+R+LKF+R  L YRERHCP K +LLKCRIPAP
Sbjct  110  VATVPEEKVKSYPACGVEYSEYTPCEGTKRALKFERERLIYRERHCPEKGDLLKCRIPAP  169

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
            +GYR P  WP SRD  WYANVPHK LTVEKA QNW+ ++G+RF FPGGGTMFP GADAYI
Sbjct  170  YGYRNPPAWPASRDVAWYANVPHKELTVEKAVQNWIIYEGDRFRFPGGGTMFPNGADAYI  229

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  230  DDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTHEAQVQFALERGVP  289



>ref|XP_002320758.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
 gb|EEE99073.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
Length=629

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A   PPC  + SE+TPC+D ERSLKFDR  L YRERHCP   E+LKCR+PAP+GY++P R
Sbjct  87   AHHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPESHEILKCRVPAPYGYKVPFR  146

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WPESR+  WYANVPHK LTVEK  QNWV  +G+R  FPGGGTMFPRGADAYIDDIG+LIN
Sbjct  147  WPESREFAWYANVPHKELTVEKKNQNWVHVEGKRLRFPGGGTMFPRGADAYIDDIGKLIN  206

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER +P
Sbjct  207  LKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVP  258



>gb|EPS68701.1| hypothetical protein M569_06064, partial [Genlisea aurea]
Length=638

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K +P C  + SEYTPC+DT RSL+F R  L YRERHCPA++E +KCRIPAP GY+ P RW
Sbjct  102  KSYPACDVKYSEYTPCEDTTRSLRFPRERLIYRERHCPAEDERVKCRIPAPSGYKTPFRW  161

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGGGTMFP GADAYIDDIG+LINL
Sbjct  162  PASRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINL  221

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  222  SDGSIRTAIDTGCGVASWGAYLLSRDIIAMSFAPRDSHEAQVQFALERGVP  272



>ref|XP_002301329.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE80602.1| dehydration-responsive family protein [Populus trichocarpa]
Length=622

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 150/183 (82%), Gaps = 2/183 (1%)
 Frame = +3

Query  378  FVAVAQAPPAKE--FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRI  551
            F    + P A+E  FPPC  + SEYTPC+D +RSL+FDR  L YRERHCP   E+LKCR+
Sbjct  76   FAQDPKPPVAREHHFPPCDPKYSEYTPCEDVDRSLRFDRDRLVYRERHCPESHEILKCRV  135

Query  552  PAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGAD  731
            P P+GY++P  WPESR+  WYANVPHK LTVEK  QNWVR +GER  FPGGGTMFPRGAD
Sbjct  136  PPPYGYKMPFSWPESRELAWYANVPHKDLTVEKKNQNWVRVEGERLRFPGGGTMFPRGAD  195

Query  732  AYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALER  911
            AYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER
Sbjct  196  AYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHVSQVQFALER  255

Query  912  XIP  920
             +P
Sbjct  256  GVP  258



>ref|XP_010693483.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=642

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            +PPC    SEYTPC+D  RS+KF R  L YRERHCP K ELLKCR+PAPFGY+ P +WP 
Sbjct  103  YPPCDITYSEYTPCEDRRRSVKFTRDRLIYRERHCPKKWELLKCRVPAPFGYKSPFKWPV  162

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD VWY NVPHKHLTVEKA QNW+RF+G+RF FPGGGTMFP GA AYID+IG+LINL D
Sbjct  163  SRDYVWYDNVPHKHLTVEKAVQNWIRFEGDRFKFPGGGTMFPNGAGAYIDEIGKLINLND  222

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYLLSR+I  +SFAPKDTHEAQVQFALER +P
Sbjct  223  GSIRTAIDTGCGVASWGAYLLSRNIVAMSFAPKDTHEAQVQFALERGVP  271



>ref|XP_007038610.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=642

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIP  578
            P  K +P C  + SEYTPC+D  RSLKF R  L YRERHCP K ELLKCR+PAP+ Y+ P
Sbjct  100  PDVKTYPSCSVKYSEYTPCEDHIRSLKFKRDRLIYRERHCPEKGELLKCRVPAPYDYKNP  159

Query  579  VRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRL  758
              WP+SRD  W+ANVPHK LTVEKAGQNW+R++G+RF FPGGGTMFP GADAYIDDIG+L
Sbjct  160  FPWPKSRDLAWFANVPHKELTVEKAGQNWIRYEGKRFRFPGGGTMFPHGADAYIDDIGKL  219

Query  759  INLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            INLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  220  INLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  273



>ref|XP_004228448.2| PREDICTED: probable methyltransferase PMT15, partial [Solanum 
lycopersicum]
Length=637

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            A +   K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP K +LLKCR+PAP+GY
Sbjct  94   AVSDDVKLYPPCDFKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKTQLLKCRVPAPYGY  153

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDI  749
            + P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGGGTMFP GADAY+DDI
Sbjct  154  KKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDI  213

Query  750  GRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  214  DKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVP  270



>ref|XP_006293834.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
 gb|EOA26732.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
Length=631

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 152/183 (83%), Gaps = 4/183 (2%)
 Frame = +3

Query  384  AVAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRI  551
            ++   PP  E    FP C  ELSE+TPC+D +RSLKF R  L+YR+RHCP +EE+LKCRI
Sbjct  73   SIQDPPPVPETAASFPSCAVELSEHTPCEDAKRSLKFPRERLEYRQRHCPEREEILKCRI  132

Query  552  PAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGAD  731
            PAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGAD
Sbjct  133  PAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGAD  192

Query  732  AYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALER  911
            AYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER
Sbjct  193  AYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALER  252

Query  912  XIP  920
             +P
Sbjct  253  GVP  255



>gb|KCW46397.1| hypothetical protein EUGRSUZ_K00230 [Eucalyptus grandis]
Length=603

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C    SEYTPC+D +RSL+FDR  L YRERHCP K E +KCR+PAP+GYRIP RW
Sbjct  69   RTYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPDKTEKVKCRVPAPYGYRIPFRW  128

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW++++G+RF FPGGGTMFP GA AYIDDIG LINL
Sbjct  129  PASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGGGTMFPHGASAYIDDIGELINL  188

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHEAQVQFALER +P
Sbjct  189  KDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVP  239



>ref|XP_010053660.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
 gb|KCW78011.1| hypothetical protein EUGRSUZ_D02245 [Eucalyptus grandis]
Length=650

 Score =   282 bits (722),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             FPPC  + SEYTPC+D +RSL+FDR  L YRERHCP K E LKCRIPAP GYR+P  WP
Sbjct  113  HFPPCDPKFSEYTPCEDVQRSLRFDRERLVYRERHCPEKRERLKCRIPAPHGYRLPFPWP  172

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMF  GADAYIDDIG++I+L+
Sbjct  173  ESRDKAWFANVPHKELTVEKKKQNWVRFEGDRFIFPGGGTMFSNGADAYIDDIGKMIDLR  232

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  233  GGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVP  282



>ref|XP_002321888.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
 gb|EEF06015.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
Length=631

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V      + +P C   LSEYTPC+D +RS KF R  L Y ERHCP K ELLKCRIPAP
Sbjct  82   LDVTLTSEVRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLIYEERHCPEKGELLKCRIPAP  141

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
            +GYR P  WP SRD  WY NVPHKHLTVEKA QNW+RF+G+RF FPGGGTMFP GADAYI
Sbjct  142  YGYRNPFTWPASRDYAWYNNVPHKHLTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYI  201

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI+L DGSIRTAIDTGCGVASWG YLLSR++  +SFAP+D HEAQVQFALER +P
Sbjct  202  DDIGRLIDLNDGSIRTAIDTGCGVASWGGYLLSRNVLTMSFAPRDNHEAQVQFALERGVP  261



>ref|XP_006857883.1| PREDICTED: probable methyltransferase PMT16 [Amborella trichopoda]
 gb|ERN19350.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
Length=639

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            A A  A+ FPPC+  LSEYTPC+D +RSLKF+R+ L YRERHCP K ELLKCRIPAPFGY
Sbjct  84   AAAAKARLFPPCEPRLSEYTPCEDRDRSLKFERQRLIYRERHCPEKGELLKCRIPAPFGY  143

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDI  749
            + P  WP+SRD  W+ NVPH+ L+VEKA QNW+R +GERF FPGGGTMFPRGADAYIDDI
Sbjct  144  KRPFPWPQSRDFAWFNNVPHRELSVEKAVQNWIRVEGERFRFPGGGTMFPRGADAYIDDI  203

Query  750  GRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +L+ L++GSIRTAIDTGCGVASWGAYL+SRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  204  EKLVPLRNGSIRTAIDTGCGVASWGAYLMSRDILAMSFAPRDTHEAQVQFALERGVP  260



>ref|XP_010508116.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            +   PP KE    FP C AELSE+TPC+D +RSLKF R  L+YR+RHCP +EE+LKCRIP
Sbjct  74   IQDPPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFPRERLEYRQRHCPEREEILKCRIP  133

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNWVR++ +RF FPGGGTMFPRGADA
Sbjct  134  APYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNWVRYENDRFWFPGGGTMFPRGADA  193

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            Y+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  194  YLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERG  253

Query  915  IP  920
            +P
Sbjct  254  VP  255



>ref|XP_009609846.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=657

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
             VA     K +P C  + SEYTPC+D +RSLKF R  L YRERHCP K +LLKCRIPAP+
Sbjct  109  GVAPDDSVKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKSQLLKCRIPAPY  168

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGGGTMFP GADAY+D
Sbjct  169  GYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVD  228

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DI +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  DIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVP  287



>ref|XP_010506552.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            +   PP KE    FP C AELSE+TPC+D +RSLKF R  L+YR+RHCP +EE+LKCRIP
Sbjct  74   IQDPPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFPRERLEYRQRHCPEREEILKCRIP  133

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNWVR++ +RF FPGGGTMFPRGADA
Sbjct  134  APYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNWVRYENDRFWFPGGGTMFPRGADA  193

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            Y+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  194  YLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERG  253

Query  915  IP  920
            +P
Sbjct  254  VP  255



>ref|XP_002880195.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56454.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            +   PP  E    FP C AELSE+TPC+D +RSL F R  L+YR+RHCP +EE+LKCRIP
Sbjct  74   IQDPPPVTETAVNFPSCGAELSEHTPCEDAKRSLIFARERLEYRQRHCPEREEILKCRIP  133

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADA
Sbjct  134  APYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADA  193

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            YIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  194  YIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERG  253

Query  915  IP  920
            +P
Sbjct  254  VP  255



>ref|XP_010518192.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            +   PP KE    FP C AELSE+TPC+D +RSLKF R  L+YR+RHCP +EE+LKCRIP
Sbjct  74   IQDPPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFPRERLEYRQRHCPEREEILKCRIP  133

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNWVR++ +RF FPGGGTMFPRGADA
Sbjct  134  APYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNWVRYENDRFWFPGGGTMFPRGADA  193

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            Y+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  194  YLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERG  253

Query  915  IP  920
            +P
Sbjct  254  VP  255



>ref|XP_010559094.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=620

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 155/183 (85%), Gaps = 5/183 (3%)
 Frame = +3

Query  387  VAQAPP---AKE--FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRI  551
             A+ PP   A+E  FP C  +LSEYTPC+D +RSLKF R  L+YRERHCP ++E+L+CRI
Sbjct  75   TAEDPPPTAAREVTFPACDVKLSEYTPCEDQKRSLKFPRERLEYRERHCPERDEVLRCRI  134

Query  552  PAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGAD  731
            PAP+GY++P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGAD
Sbjct  135  PAPYGYKMPFRWPESRDVSWFANVPHTELTVEKKDQNWVRYENDRFWFPGGGTMFPRGAD  194

Query  732  AYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALER  911
            AYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER
Sbjct  195  AYIDDIGRLIDLTDGSIRTAIDTGCGVASFGAYLLSRNIITMSFAPRDTHEAQVQFALER  254

Query  912  XIP  920
             +P
Sbjct  255  GVP  257



>emb|CDY18904.1| BnaC04g04460D [Brassica napus]
Length=633

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A  FP C A LSE+TPC+D +RSLKF R  L+YR+RHCP +EE LKCRIPAP+GY+ P R
Sbjct  86   AVSFPSCDAALSEHTPCEDAKRSLKFSRERLEYRQRHCPEREEALKCRIPAPYGYKTPFR  145

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIGRLI+
Sbjct  146  WPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLID  205

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  206  LSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  257



>ref|XP_010035103.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
Length=643

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C    SEYTPC+D +RSL+FDR  L YRERHCP K E +KCR+PAP+GYRIP RW
Sbjct  109  RTYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPDKTEKVKCRVPAPYGYRIPFRW  168

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW++++G+RF FPGGGTMFP GA AYIDDIG LINL
Sbjct  169  PASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGGGTMFPHGASAYIDDIGELINL  228

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHEAQVQFALER +P
Sbjct  229  KDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVP  279



>emb|CDX74761.1| BnaA05g05070D [Brassica napus]
Length=632

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            A  A  FP C A LSE+TPC+D +RSLKF R  L+YR+RHCP +EE LKCRIPAP+GY+ 
Sbjct  82   AVTAVSFPSCDAALSEHTPCEDAKRSLKFSRERLEYRQRHCPDREEALKCRIPAPYGYKT  141

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIGR
Sbjct  142  PFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGR  201

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  202  LIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  256



>ref|XP_004510859.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=644

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            + ++PP +     FPPC   L EYTPC+D+ RS KF R    YRERHCPA +E+L+CRIP
Sbjct  98   LHESPPTEARGPHFPPCDPSLYEYTPCEDSTRSSKFSRNRQVYRERHCPAPKEILRCRIP  157

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP GYR+P+RWPESRDS WYANVPHK L+VEK  QNW+R +G RF FPGGGT F RGA A
Sbjct  158  APLGYRLPLRWPESRDSTWYANVPHKELSVEKKKQNWIRLEGNRFKFPGGGTTFRRGASA  217

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            YIDDIG+LINLKDGSIRTA+DTGCGVASWG YLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  218  YIDDIGKLINLKDGSIRTAVDTGCGVASWGGYLLSRNILTVSFAPRDTHEAQVQFALERG  277

Query  915  IP  920
            +P
Sbjct  278  VP  279



>ref|XP_009143165.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A  FP C A LSE+TPC+D +RSLKF R  L+YR+RHCP +EE LKCRIPAP+GY+ P R
Sbjct  85   AVSFPSCDAALSEHTPCEDAKRSLKFSRERLEYRQRHCPDREEALKCRIPAPYGYKTPFR  144

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIGRLI+
Sbjct  145  WPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLID  204

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  205  LSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  256



>ref|XP_006397756.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
 gb|ESQ39209.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
Length=632

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 149/178 (84%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PP  E    FP C AELSE TPC+D +RSLKF R  L+YR+RHCP ++E LKCRIPAP+G
Sbjct  79   PPVTETAVNFPSCDAELSENTPCEDAKRSLKFPRERLEYRQRHCPERDETLKCRIPAPYG  138

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDD
Sbjct  139  YKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDD  198

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  199  IGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  256



>ref|NP_182099.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
 sp|O80844.1|PMTG_ARATH RecName: Full=Probable methyltransferase PMT16 [Arabidopsis thaliana]
 gb|AAC28550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10597.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
Length=631

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 4/182 (2%)
 Frame = +3

Query  387  VAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIP  554
            +   PP  E    FP C A LSE+TPC+D +RSLKF R  L+YR+RHCP +EE+LKCRIP
Sbjct  74   IQDPPPVTETAVSFPSCAAALSEHTPCEDAKRSLKFSRERLEYRQRHCPEREEILKCRIP  133

Query  555  APFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADA  734
            AP+GY+ P RWP SRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADA
Sbjct  134  APYGYKTPFRWPASRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADA  193

Query  735  YIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERX  914
            YIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER 
Sbjct  194  YIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERG  253

Query  915  IP  920
            +P
Sbjct  254  VP  255



>ref|XP_004140852.1| PREDICTED: probable methyltransferase PMT15 [Cucumis sativus]
 gb|KGN57350.1| hypothetical protein Csa_3G180380 [Cucumis sativus]
Length=604

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            AK FP C    SEYTPC+DT+RSLKF R  L YRERHCP KEE LKCRIPAP GYR P  
Sbjct  61   AKPFPACGLVYSEYTPCEDTQRSLKFSRDRLIYRERHCPEKEEALKCRIPAPPGYRNPFA  120

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY NVPHK LTVEKA QNW+R++GE F FPGGGTMFP GADAYID+IG+LIN
Sbjct  121  WPVSRDLAWYVNVPHKDLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADAYIDNIGKLIN  180

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LKDGSIRTAIDTGCGV SWGAYLLSR I  +SFAP+DTHEAQVQFALER +P
Sbjct  181  LKDGSIRTAIDTGCGVGSWGAYLLSRGIITMSFAPRDTHEAQVQFALERGVP  232



>ref|XP_006365768.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=637

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            A +   K +P C  + SEYTPC+D +RSLKF R  L YRERHCP K +LLKCR+PAP+GY
Sbjct  97   AVSDDVKVYPSCDFKFSEYTPCEDPQRSLKFKRDRLIYRERHCPDKTQLLKCRVPAPYGY  156

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDI  749
            + P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGGGTMFP GADAY+DDI
Sbjct  157  KKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDI  216

Query  750  GRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  217  DKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVP  273



>ref|XP_009142361.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PP K     FP C A+LSE+TPC+D +RSLKF R+ L+YR+RHCP +EE+LKCRIPAP+G
Sbjct  78   PPVKAAAVSFPSCGAQLSEHTPCEDAKRSLKFPRKRLEYRQRHCPEREEVLKCRIPAPYG  137

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFP GADAYIDD
Sbjct  138  YKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPSGADAYIDD  197

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  198  IGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_010692380.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK-EELLKCRIPAPFGYRIPV  581
               FPPC    SEYTPC D +RSL+F R  L YRERHCP +  E + CR+PAP GY  P 
Sbjct  88   VNHFPPCSLNFSEYTPCHDVDRSLRFPRDRLVYRERHCPMELGEFVTCRVPAPNGYTTPF  147

Query  582  RWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLI  761
            RWPESRD VWYANVPHK LTVEKAGQNWVRF+ +RFTFPGGGTMFPRGADAYID+IGR+I
Sbjct  148  RWPESRDMVWYANVPHKWLTVEKAGQNWVRFEEDRFTFPGGGTMFPRGADAYIDEIGRII  207

Query  762  NLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            NLKDGS+RTAIDTGCGVAS+GAYLLSR+I  +SFAPKDTHEAQVQFALER +P
Sbjct  208  NLKDGSVRTAIDTGCGVASFGAYLLSRNILTVSFAPKDTHEAQVQFALERGVP  260



>emb|CDY37061.1| BnaA04g26390D [Brassica napus]
Length=628

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PP K     FP C A+LSE+TPC+D +RSLKF R+ L+YR+RHCP +EE+LKCRIPAP+G
Sbjct  78   PPVKAVAVSFPSCGAKLSEHTPCEDAKRSLKFPRKRLEYRQRHCPEREEVLKCRIPAPYG  137

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFP GADAYIDD
Sbjct  138  YKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPSGADAYIDD  197

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  198  IGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  255



>gb|KEH17380.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=534

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            ++PPC   L++YTPC+D  RSLK+ R  + YRERHCP K E+LKCR+PAP GY+ P  WP
Sbjct  104  QYPPCTPSLTDYTPCEDHTRSLKYTRDKMIYRERHCPKKHEILKCRVPAPNGYKNPFPWP  163

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD  WYANVP++HLTVEKAGQNW+RF G++F FPGGGTMFP GAD YIDDIG+LI+L+
Sbjct  164  TSRDMAWYANVPYRHLTVEKAGQNWIRFDGDKFRFPGGGTMFPNGADKYIDDIGKLIDLE  223

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGS+RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  224  DGSVRTAVDTGCGVASWGAYLLSRDILTVSIAPRDTHEAQVQFALERGVP  273



>ref|XP_010540274.1| PREDICTED: probable methyltransferase PMT15 [Tarenaya hassleriana]
Length=630

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
             P C AELSEYTPC+D  RSL F R  L YRERHCP K E+L+CRIPAP+GY  P RWPE
Sbjct  95   IPACDAELSEYTPCEDVNRSLPFPRERLIYRERHCPEKGEILRCRIPAPYGYMAPFRWPE  154

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIG+LINL+D
Sbjct  155  SRDVAWFANVPHTELTVEKKSQNWVRYEKDRFLFPGGGTMFPRGADAYIDDIGQLINLRD  214

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYL+SR++  +SFAP+DTHEAQVQFALER +P
Sbjct  215  GSIRTAIDTGCGVASWGAYLMSRNVVAMSFAPRDTHEAQVQFALERGVP  263



>ref|XP_009794887.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=657

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
             VA     K +P C  + SEYTPC+D +RSLKF R  L YRERHCP K +LLKCRIPAP+
Sbjct  109  GVAPDDSVKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKSQLLKCRIPAPY  168

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGGGTMFP GADAY+D
Sbjct  169  GYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVD  228

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DI +L NLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  DIDKLFNLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVP  287



>ref|XP_010278559.1| PREDICTED: probable methyltransferase PMT15 [Nelumbo nucifera]
Length=633

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K FP C A+ SEYTPC+D  RSLKF+R  L YRERHCP K ELLKCR+PAP+GY+ P  W
Sbjct  91   KYFPACDAKYSEYTPCEDAVRSLKFERDRLIYRERHCPEKAELLKCRVPAPYGYKNPFTW  150

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LTVEKA QNW+RF+ +RF FPGGGTMFP GA AYIDDI +LINL
Sbjct  151  PTSRDFAWYANVPHKELTVEKAVQNWIRFQRDRFRFPGGGTMFPHGAGAYIDDIDKLINL  210

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  211  RDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVP  261



>gb|ABV72578.1| dehydration-responsive family protein S51 [Brassica rapa]
Length=632

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            A  A  FP C A LSE+TPC+D +RSLKF R  L+YR+RHCP +EE LKCRIPAP+GY+ 
Sbjct  82   AVTAVSFPSCDAALSEHTPCEDAKRSLKFSRERLEYRQRHCPDREEALKCRIPAPYGYKT  141

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIGR
Sbjct  142  PFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGR  201

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LI+L DGSIRTAIDT CGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  202  LIDLSDGSIRTAIDTSCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  256



>gb|KFK37364.1| hypothetical protein AALP_AA4G247100 [Arabis alpina]
Length=628

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 5/181 (3%)
 Frame = +3

Query  393  QAPP-----AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPA  557
            Q PP        FP C A LSE+TPC+D +RSLK+ R  L+YR+RHCP +EE LKCRIPA
Sbjct  71   QEPPPLIKTTVNFPSCDAVLSEHTPCEDAKRSLKYSRERLEYRQRHCPEREEALKCRIPA  130

Query  558  PFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAY  737
            P+GY+ P +WPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAY
Sbjct  131  PYGYKTPFKWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAY  190

Query  738  IDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXI  917
            IDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +
Sbjct  191  IDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGV  250

Query  918  P  920
            P
Sbjct  251  P  251



>ref|XP_003528883.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=641

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
             PPC +  SE+TPC+D +RSL F R  L YRERHCPA EE L+CRIPAP+GYR P+RWP 
Sbjct  102  LPPCASPFSEHTPCEDQQRSLSFPRHRLAYRERHCPAPEERLRCRIPAPYGYRQPLRWPA  161

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD+ WYAN PHK LTVEK GQNWVRF G RF FPGGGTMFPRGAD YI+DIG+LINL+D
Sbjct  162  SRDAAWYANAPHKELTVEKKGQNWVRFDGNRFRFPGGGTMFPRGADQYINDIGKLINLRD  221

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GS+RTAIDTGCGVAS+GAYLLSRDI  +SFAP+DTH +QVQFALER IP
Sbjct  222  GSVRTAIDTGCGVASFGAYLLSRDILTMSFAPRDTHISQVQFALERGIP  270



>ref|XP_010091548.1| putative methyltransferase PMT15 [Morus notabilis]
 gb|EXB44733.1| putative methyltransferase PMT15 [Morus notabilis]
Length=647

 Score =   277 bits (709),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FPPC AEL+EYTPC+D +RSL+FDR  L YRERHCP  EE+++CRIPAP GYRIP RWPE
Sbjct  103  FPPCAAELAEYTPCEDVKRSLRFDRDRLIYRERHCPTPEEVMRCRIPAPSGYRIPFRWPE  162

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGE--RFTFPGGGTMFPRGADAYIDDIGRLINL  767
            SR   WYANVPHK LTVEK  QNWV +     R TFPGGGTMFP GADAYIDDIG+ I+L
Sbjct  163  SRGVAWYANVPHKELTVEKKNQNWVHYDKNTGRLTFPGGGTMFPHGADAYIDDIGKFIDL  222

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            + GSIRTAIDTGCGVASWGAYL+SRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  223  QGGSIRTAIDTGCGVASWGAYLMSRDILAMSFAPRDSHEAQVQFALERGVP  273



>ref|XP_010055227.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Eucalyptus 
grandis]
Length=597

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 8/184 (4%)
 Frame = +3

Query  393  QAPPAK-----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP---AKEELLKCR  548
            +APP+       FPPC A  SEYTPC+D  RSL+F+R ML YRERHCP   A  E L+CR
Sbjct  87   RAPPSAAERGPRFPPCGANFSEYTPCEDVARSLRFEREMLVYRERHCPEGGAGGERLRCR  146

Query  549  IPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGA  728
            +PAP+GYR P RWPESR + W+ANVPHK LTVEK  QNWV+F+G RF FPGGGTMFP+GA
Sbjct  147  VPAPYGYRRPFRWPESRGTAWFANVPHKELTVEKRNQNWVKFEGNRFVFPGGGTMFPKGA  206

Query  729  DAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALE  908
            D YI+DIG++INL+DGSI+TA+DTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALE
Sbjct  207  DKYIEDIGKMINLRDGSIKTALDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALE  266

Query  909  RXIP  920
            R +P
Sbjct  267  RGVP  270



>ref|XP_011016489.1| PREDICTED: probable methyltransferase PMT17, partial [Populus 
euphratica]
Length=345

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
              E PPC    SEYTPCQD  R  KFDR MLKYRERHCP K+ELL C IPAP  Y+ P +
Sbjct  90   VNEIPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFK  149

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI 
Sbjct  150  WPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDISELIP  209

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  210  LTDGSIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVWFALERGVP  261



>ref|XP_003525323.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Glycine 
max]
 ref|XP_006580503.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Glycine 
max]
Length=623

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V  +  A+EFPPC    SEYTPCQD  R  KFDR MLKYRERHCPAKEELL C IPAP
Sbjct  81   IDVNDSGGAQEFPPCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCPAKEELLNCLIPAP  140

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  141  PKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  200

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  201  DDINELIPLTSGTIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  260



>gb|KEH17379.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=636

 Score =   277 bits (708),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            ++PPC   L++YTPC+D  RSLK+ R  + YRERHCP K E+LKCR+PAP GY+ P  WP
Sbjct  104  QYPPCTPSLTDYTPCEDHTRSLKYTRDKMIYRERHCPKKHEILKCRVPAPNGYKNPFPWP  163

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD  WYANVP++HLTVEKAGQNW+RF G++F FPGGGTMFP GAD YIDDIG+LI+L+
Sbjct  164  TSRDMAWYANVPYRHLTVEKAGQNWIRFDGDKFRFPGGGTMFPNGADKYIDDIGKLIDLE  223

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGS+RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  224  DGSVRTAVDTGCGVASWGAYLLSRDILTVSIAPRDTHEAQVQFALERGVP  273



>ref|XP_006287263.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
 gb|EOA20161.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
Length=634

 Score =   276 bits (707),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            + PPC  E SEYTPC+   RSL F R  L YRERHCP K E+L+CRIPAP+GY +P RWP
Sbjct  95   QIPPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPYGYTVPYRWP  154

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAY+D+IGRLINLK
Sbjct  155  ESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYLDEIGRLINLK  214

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  215  DGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  264



>ref|XP_010061323.1| PREDICTED: probable methyltransferase PMT16 [Eucalyptus grandis]
 gb|KCW90733.1| hypothetical protein EUGRSUZ_A02808 [Eucalyptus grandis]
Length=605

 Score =   276 bits (705),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             + +PPC  + SE+TPC+D +RS +FDRR L +RERHCP + E LKCR+PAP GYR P R
Sbjct  74   VRTYPPCDVKHSEHTPCEDPKRSHRFDRRRLIFRERHCPERNETLKCRVPAPPGYRNPFR  133

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WYANVPHK LTVEKA QNW++F+G+RF FPGGGTMFP GADAYIDDIG+LI+
Sbjct  134  WPTSRDMAWYANVPHKELTVEKAVQNWIQFEGDRFRFPGGGTMFPNGADAYIDDIGKLID  193

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L++GSIRTAIDTGCGVASWGAYLLSR I  +SFAP+DTHEAQVQFALER +P
Sbjct  194  LRNGSIRTAIDTGCGVASWGAYLLSRGILAMSFAPRDTHEAQVQFALERGVP  245



>ref|XP_007152322.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
 gb|ESW24316.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
Length=627

 Score =   276 bits (706),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            +PPC   LSEYTPC+D  RSL++ RR + YRERHCP K E LKCR+PAP GYR P  WP 
Sbjct  92   YPPCDVSLSEYTPCEDHARSLRYSRRRMVYRERHCPTKTEALKCRVPAPHGYRNPFPWPA  151

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  WYANVPH+ LTVEKA QNW+R++G+RF FPGGGTMFP GAD YIDDIG+L++L+D
Sbjct  152  SRDVAWYANVPHRELTVEKAVQNWIRYQGDRFHFPGGGTMFPDGADKYIDDIGKLVSLRD  211

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GS+RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  212  GSVRTAVDTGCGVASWGAYLLSRDIIAVSIAPRDTHEAQVQFALERGVP  260



>ref|XP_010055225.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71693.1| hypothetical protein EUGRSUZ_E00212 [Eucalyptus grandis]
Length=637

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 8/184 (4%)
 Frame = +3

Query  393  QAPPAK-----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP---AKEELLKCR  548
            +APP+       FPPC A  SEYTPC+D  RSL+F+R ML YRERHCP   A  E L+CR
Sbjct  87   RAPPSAAERGPRFPPCGANFSEYTPCEDVARSLRFEREMLVYRERHCPEGGAGGERLRCR  146

Query  549  IPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGA  728
            +PAP+GYR P RWPESR + W+ANVPHK LTVEK  QNWV+F+G RF FPGGGTMFP+GA
Sbjct  147  VPAPYGYRRPFRWPESRGTAWFANVPHKELTVEKRNQNWVKFEGNRFVFPGGGTMFPKGA  206

Query  729  DAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALE  908
            D YI+DIG++INL+DGSI+TA+DTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALE
Sbjct  207  DKYIEDIGKMINLRDGSIKTALDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALE  266

Query  909  RXIP  920
            R +P
Sbjct  267  RGVP  270



>ref|XP_010419631.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=630

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            + A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP K E+L+CRIPAPF
Sbjct  83   STATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPF  142

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGGGTMFPRGADAYID
Sbjct  143  GYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGGGTMFPRGADAYID  202

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  203  EIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  261


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 7/61 (11%)
 Frame = +2

Query  110  SARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAAL----LPSVP  277
            + R P  LS R ++TNLY+V    +LC+ FY IG+ QH   SG+ +S ++L    L SVP
Sbjct  3    NYRWPSKLSLRARQTNLYHVILIAILCAAFYYIGVWQH---SGRGLSRSSLSNHDLTSVP  59

Query  278  C  280
            C
Sbjct  60   C  60



>ref|XP_010456248.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=644

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            + A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP K E+L+CRIPAPF
Sbjct  97   STATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPF  156

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGGGTMFPRGADAYID
Sbjct  157  GYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGGGTMFPRGADAYID  216

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            +IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  217  EIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  275



>ref|XP_010523726.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=684

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C  +LSEYTPC+D +RSL+F R  L+YRERHCP ++E+L+CRIPAP+GY+ P RWPE
Sbjct  144  FPACGVKLSEYTPCEDQKRSLRFPRERLEYRERHCPERDEVLRCRIPAPYGYKTPFRWPE  203

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYIDDIGRLI+L D
Sbjct  204  SRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSD  263

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVAS+GAYLLSR +  +SFAP+DTHEAQVQFALER +P
Sbjct  264  GSIRTAIDTGCGVASFGAYLLSRKVMTMSFAPRDTHEAQVQFALERGVP  312



>ref|XP_006396270.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
 gb|ESQ37723.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
Length=633

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            + P C  E SEYTPC+  +RSL F R  L YRERHCP KEE+L+CRIPAP+GY++P RWP
Sbjct  90   KIPSCGVEFSEYTPCEFVKRSLSFPRERLIYRERHCPKKEEILRCRIPAPYGYKVPFRWP  149

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYID+IGRLINL+
Sbjct  150  ESRDKAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLINLR  209

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  259



>ref|XP_010427380.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=633

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
             A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP K E+L+CRIPAPFG
Sbjct  87   TATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPFG  146

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGGGTMFPRGADAYID+
Sbjct  147  YSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGGGTMFPRGADAYIDE  206

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  207  IGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  264



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            A A AP  +EFP C  + SEYTPC+D +RSL+FDR  L YRERHCP K ELLKC IPAP 
Sbjct  89   AAAGAPSVREFPACDIKYSEYTPCEDRDRSLRFDRDRLIYRERHCPTKGELLKCLIPAPP  148

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR P  WP SR++ W+ANVPHK LTVEKA QNW+   G++F FPGGGTMFP GADAYID
Sbjct  149  GYRNPFPWPASRETAWFANVPHKELTVEKAVQNWIHVDGDKFRFPGGGTMFPNGADAYID  208

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DI RLI+L DGSIRTA+DTGCGVASWGAYLLSR++  +SFAP+D+HEAQVQFALER +P
Sbjct  209  DIDRLISLSDGSIRTAVDTGCGVASWGAYLLSRNVLTMSFAPRDSHEAQVQFALERGVP  267



>ref|XP_011038052.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
 ref|XP_011038053.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
Length=628

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            +       EFPPC    SEYTPCQDT+R  KFDR MLKYRERHCP K+ELL C IPAP  
Sbjct  87   INNTTSVNEFPPCAMSFSEYTPCQDTQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPK  146

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDD
Sbjct  147  YKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDD  206

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            I  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  207  ISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVP  264



>ref|XP_004515722.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=649

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
              +PPC   L++YTPC+D  RSLK+ R  + YRERHCP K E+LKCR+PAP GY+ P  W
Sbjct  115  NHYPPCTPSLTDYTPCEDHARSLKYTRDKMIYRERHCPNKNEILKCRVPAPNGYKNPFPW  174

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVP++HLTVEKA QNW+RF G+RF FPGGGTMFP GAD YIDDIG+LINL
Sbjct  175  PTSRDMAWYANVPYRHLTVEKAVQNWIRFDGDRFRFPGGGTMFPDGADKYIDDIGKLINL  234

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  235  SDGSIRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVP  285



>ref|XP_008234471.1| PREDICTED: probable methyltransferase PMT16, partial [Prunus 
mume]
Length=601

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            +QA   K +PPC  + SEYTPC+D +RSLKFDR  L YRERHCP K ELLKCR+PAP GY
Sbjct  63   SQAVKPKAYPPCDFKFSEYTPCEDAKRSLKFDRDRLIYRERHCPEKNELLKCRVPAPHGY  122

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE--RFTFPGGGTMFPRGADAYID  743
            +    WP SRD  WYANVPHK LTVEKA QNW+ ++G+  R  FPGGGTMFP GADAYID
Sbjct  123  KTVFSWPMSRDLAWYANVPHKELTVEKAVQNWIIYEGDRNRLRFPGGGTMFPNGADAYID  182

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER +P
Sbjct  183  DIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHVSQVQFALERGVP  241



>gb|KHG13750.1| hypothetical protein F383_08462 [Gossypium arboreum]
Length=633

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP
Sbjct  90   VVLNSSKTVNQFPSCDMSFSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYI
Sbjct  150  PQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  269



>gb|KJB18858.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=558

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP
Sbjct  90   VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYI
Sbjct  150  PQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_008377156.1| PREDICTED: probable methyltransferase PMT16 [Malus domestica]
Length=647

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C A+ SEYTPC+D +RSLKFDR  L YRERHCP K ELLKCRIPAP GY+    WP 
Sbjct  111  FPRCDAKYSEYTPCEDDKRSLKFDRDRLIYRERHCPEKSELLKCRIPAPHGYKNVFPWPR  170

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  WYAN PHK LTVEKA QNW+ ++G+RF FPGGGTMFP GADAYIDDIG+ INLKD
Sbjct  171  SRDLAWYANAPHKELTVEKAVQNWIIYEGDRFRFPGGGTMFPNGADAYIDDIGKFINLKD  230

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTH +QVQFALER +P
Sbjct  231  GSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHVSQVQFALERGVP  279



>ref|XP_007134966.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
 gb|ESW06960.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
Length=640

 Score =   274 bits (700),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
              PPC    SEYTPC+D  RSL+F R  L YRERHCPA E++L+CRIPAP+GY+ P+RWP
Sbjct  100  HLPPCGWSFSEYTPCEDQNRSLQFPRARLAYRERHCPAAEDVLRCRIPAPYGYKQPLRWP  159

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD+ W+AN PHK LTVEK GQNWVRF+G+RF FPGGGTMFPRGAD YID++G+LINL+
Sbjct  160  ASRDAAWFANAPHKELTVEKKGQNWVRFEGDRFRFPGGGTMFPRGADRYIDELGKLINLR  219

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVAS+GAYLLSRDI  +SFAP+DTH +QVQFALER +P
Sbjct  220  DGSIRTAIDTGCGVASFGAYLLSRDILTVSFAPRDTHISQVQFALERGVP  269



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            AP  ++FP C+A+ SEYTPC+D  RSLKF R  L YRERHCP K E L+C IPAP GYR 
Sbjct  95   APARRDFPACEAKYSEYTPCEDVARSLKFPRDRLIYRERHCPVKGEELRCLIPAPAGYRN  154

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WPESR   W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYID+I R
Sbjct  155  PFPWPESRGVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPNGADAYIDEIDR  214

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LINL+DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  215  LINLRDGSVRTAIDTGCGVASWGAYLLSRDILTMSFAPRDSHEAQVQFALERGVP  269



>gb|KEH21299.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=629

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            KEFPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEELL C IPAP  Y+ P +W
Sbjct  96   KEFPPCDMTYSEYTPCQDPARGRKFDRNMLKYRERHCPTKEELLYCLIPAPPKYKTPFKW  155

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L
Sbjct  156  PQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPL  215

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  216  TTGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_003533217.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=633

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             +PPC   LSEYTPC+D  RSL++ RR + YRERHCP   +LLKCR+PAP GYR P  WP
Sbjct  97   HYPPCHVSLSEYTPCEDHARSLQYSRRRMVYRERHCPTNSDLLKCRVPAPHGYRNPFPWP  156

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FPGGGTMFP GAD YIDDI  L+NL+
Sbjct  157  ASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFRFPGGGTMFPNGADKYIDDIADLVNLR  216

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DG++RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  217  DGTVRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVP  266



>ref|XP_010501748.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=494

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  109  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  168

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  169  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  228

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  280



>ref|XP_003548213.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=632

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             FPPC   LSEYTPC+D  RSL++ RR + YRERHCP   E+LKCR+PAP GYR P  WP
Sbjct  96   HFPPCHVSLSEYTPCEDHARSLQYSRRRMVYRERHCPRNNEVLKCRVPAPHGYRNPFPWP  155

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FPGGGTMFP GAD YIDDI  L+NL+
Sbjct  156  ASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFHFPGGGTMFPDGADKYIDDIADLVNLR  215

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DG++RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEAQVQFALER +P
Sbjct  216  DGTVRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVP  265



>emb|CDY54063.1| BnaA02g36490D, partial [Brassica napus]
Length=554

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            + P C  E SEYTPC+   RSL F R  L YRERHCP+K+E+L+CRIPAP+GY +P RWP
Sbjct  87   QIPSCGVEFSEYTPCESVSRSLSFPRDRLIYRERHCPSKDEILRCRIPAPYGYSVPFRWP  146

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYI +IGRLINLK
Sbjct  147  ESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIGEIGRLINLK  206

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGS+R AIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  207  DGSVRAAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  256



>ref|XP_004492680.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=1073

 Score =   280 bits (717),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  417  PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPES  596
            P C   LSEYTPC+D +RSLKF R  L YRERHCP K+E+L+CRIPAPFGYR+P RWPES
Sbjct  113  PVCDVSLSEYTPCEDVQRSLKFPRENLMYRERHCPEKKEILRCRIPAPFGYRVPPRWPES  172

Query  597  RDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDG  776
            RD  WYANVPHK LT+EK  QNWV      F FPGGGTMFPRGA AYIDDIG+LINLKDG
Sbjct  173  RDWAWYANVPHKELTIEKMKQNWVXXXXXXFRFPGGGTMFPRGAGAYIDDIGKLINLKDG  232

Query  777  SIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            SIRTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  233  SIRTALDTGCGVASWGAYLLPRDIIAVSFAPRDTHEAQVQFALERGVP  280



>gb|KJB18848.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18854.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18855.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18856.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18859.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=633

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP
Sbjct  90   VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYI
Sbjct  150  PQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             KEFPPC    SEYTPCQD  R  KFDR MLKYRERHCP+KEE+++C IP P  Y+ P +
Sbjct  123  VKEFPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPSKEEMMQCLIPPPPKYKTPFK  182

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI 
Sbjct  183  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINALIP  242

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  243  LTDGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  294



>ref|XP_009128495.1| PREDICTED: probable methyltransferase PMT15 [Brassica rapa]
Length=665

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            + P C  E SEYTPC+   RSL F R  L YRERHCP+K+E+L+CRIPAP+GY +P RWP
Sbjct  131  QIPSCGVEFSEYTPCESVSRSLSFPRDRLIYRERHCPSKDEILRCRIPAPYGYSVPFRWP  190

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYI +IGRLINLK
Sbjct  191  ESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIGEIGRLINLK  250

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGS+RTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  251  DGSVRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  300



>ref|NP_191984.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
 sp|Q9ZPH9.1|PMTF_ARATH RecName: Full=Probable methyltransferase PMT15 [Arabidopsis thaliana]
 gb|AAD17339.1| F15P23.1 gene product [Arabidopsis thaliana]
 emb|CAB80884.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81929.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
Length=633

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            + P C  E SEYTPC+   RSL F R  L YRERHCP K E+++CRIPAP+GY +P RWP
Sbjct  95   QIPSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPEKHEIVRCRIPAPYGYSLPFRWP  154

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYID+IGRLINLK
Sbjct  155  ESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLINLK  214

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  215  DGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  264



>gb|KHN16709.1| Putative methyltransferase PMT18 [Glycine soja]
Length=594

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +  +  A+EFP C    SEYTPCQD  R  KFDR MLKYRERHCPAK ELL C IPAP
Sbjct  52   IDINNSGGAQEFPSCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCPAKNELLNCLIPAP  111

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  112  PKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  171

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  172  DDINELIPLTSGTIRTAIDTGCGVASWGAYLLRRDILAMSFAPRDTHEAQVQFALERGVP  231



>gb|KJB18860.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=669

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP
Sbjct  90   VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYI
Sbjct  150  PQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_008799521.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=639

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV   P  + FP C A+ SEYTPC+D +RSLKF R  L +RERHCP K E L+C IPAP 
Sbjct  92   AVDALPARRGFPACDAKYSEYTPCEDVKRSLKFPRDRLIFRERHCPGKGEELRCLIPAPA  151

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR P  WP SR+  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYID
Sbjct  152  GYRNPFPWPASREVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPNGADAYID  211

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIGRLINL DGSIRTAIDTGCGVASWG+YLLSRDI  +S AP+D+HEAQVQFALER +P
Sbjct  212  DIGRLINLHDGSIRTAIDTGCGVASWGSYLLSRDILTMSIAPRDSHEAQVQFALERGVP  270



>ref|XP_007220207.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
 gb|EMJ21406.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
Length=640

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            +PPC  + SEYTPC+D +RSLKFDR  L YRERHCP K ELLKCR+PAP GY+    WP 
Sbjct  101  YPPCDLKFSEYTPCEDAKRSLKFDRDRLIYRERHCPEKNELLKCRVPAPHGYKTVFSWPM  160

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGE--RFTFPGGGTMFPRGADAYIDDIGRLINL  767
            SRD  WYANVPHK LTVEKA QNW+ ++G+  R  FPGGGTMFP GADAYIDDIG+LINL
Sbjct  161  SRDLAWYANVPHKELTVEKAVQNWIIYEGDRNRLRFPGGGTMFPNGADAYIDDIGKLINL  220

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            KDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH +QVQFALER +P
Sbjct  221  KDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHVSQVQFALERGVP  271



>ref|XP_003530522.1| PREDICTED: probable methyltransferase PMT18-like [Glycine max]
Length=629

 Score =   271 bits (694),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +  +  A+EFP C    SEYTPCQD  R  KFDR MLKYRERHCPAK ELL C IPAP
Sbjct  87   IDINNSGGAQEFPSCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCPAKNELLNCLIPAP  146

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  147  PKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  206

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  207  DDINELIPLTSGTIRTAIDTGCGVASWGAYLLRRDILAMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_002875017.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51276.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   271 bits (694),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
             A A    + P C  E SEYTPC+   RSL F R  L YRERHCP K E+L+CRIPAP+G
Sbjct  87   TATAARVAQIPSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPKKHEILRCRIPAPYG  146

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y +  RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYID+
Sbjct  147  YTVSFRWPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDE  206

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IGRLINL+DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  207  IGRLINLRDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  264



>emb|CBI34642.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYRERHCP K+ELL C IPAP
Sbjct  69   VEINNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTKDELLLCLIPAP  128

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  129  PKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  188

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  189  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  248



>ref|XP_004503565.1| PREDICTED: probable methyltransferase PMT18-like [Cicer arietinum]
Length=624

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            +EFPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEELL C +PAP  Y+ P +W
Sbjct  91   QEFPPCDMTYSEYTPCQDPARGRKFDRNMLKYRERHCPTKEELLFCLVPAPPKYKTPFKW  150

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L
Sbjct  151  PQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPL  210

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  211  TSGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  261



>ref|XP_009384529.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=635

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  390  AQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGY  569
            A  P A+EF  C A+ SEYTPC+D +RSL+FDR  L YRERHCP K ELLKC +PAP GY
Sbjct  89   AAIPAAREFTACDAKYSEYTPCEDRDRSLRFDRDRLIYRERHCPEKGELLKCLVPAPAGY  148

Query  570  RIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDI  749
            R P  WP SRD+ W+ANVPH  LTVEKA QNW+R   ++F FPGGGTMFP GADAYIDDI
Sbjct  149  RNPFPWPASRDAAWFANVPHNELTVEKAVQNWIRVDRDKFLFPGGGTMFPDGADAYIDDI  208

Query  750  GRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             RLI L+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  209  DRLIPLRDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDSHEAQVQFALERGVP  265



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIP  578
            P  +EFP C  + SEYTPC+D  RSL+FDR+ L YRERHCP K ELLKC IPAP GY+ P
Sbjct  94   PVVREFPACDVKYSEYTPCEDRTRSLRFDRKRLIYRERHCPEKGELLKCLIPAPPGYKSP  153

Query  579  VRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRL  758
              WP SRD+ W+ANVPHK L V KAGQNW+R  G++F FPGGGTMFP GAD YIDDI +L
Sbjct  154  FPWPASRDTAWFANVPHKELAVGKAGQNWIRVDGDKFRFPGGGTMFPNGADTYIDDIDQL  213

Query  759  INLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            I+L DGSIRTA+DTGCGVASWGAYLLSR++  +SFAPKD+HEAQVQFALER +P
Sbjct  214  ISLSDGSIRTAVDTGCGVASWGAYLLSRNVLTMSFAPKDSHEAQVQFALERGVP  267



>emb|CDX99540.1| BnaC09g24520D [Brassica napus]
Length=537

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  KFDR MLKYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  88   KYFEPCDLSLSEYTPCEDRQRGRKFDRNMLKYRERHCPSKDELLYCLIPPPPNYKIPFKW  147

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  148  PQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  207

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  208  TNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  258



>ref|XP_010919241.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=637

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  384  AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPF  563
            AV   P A+ FP C A+ SEYTPC+D +RS KF +  L +RERHCP K E L+C IPAP 
Sbjct  90   AVDALPAARGFPACDAKYSEYTPCEDVKRSFKFPQDRLIFRERHCPQKGEELRCMIPAPA  149

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GYR P  WP SR+  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYID
Sbjct  150  GYRNPFPWPASREVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPNGADAYID  209

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIGRLINL+DGSIRTAIDTGCGVASWG YLLSRDI  +S AP+D+HEAQVQFALER +P
Sbjct  210  DIGRLINLRDGSIRTAIDTGCGVASWGGYLLSRDILTMSIAPRDSHEAQVQFALERGVP  268



>ref|XP_002317647.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE98259.1| dehydration-responsive family protein [Populus trichocarpa]
Length=625

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +       E PPC    SEYTPCQD +R  KFDR MLKYRERHCP K+ELL C IPAP
Sbjct  82   IQINNTDSVNEIPPCDMSYSEYTPCQDPQRGRKFDRNMLKYRERHCPTKDELLLCLIPAP  141

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH  L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  142  PKYKTPFKWPQSRDYAWYDNIPHNELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  201

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  202  DDISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVWFALERGVP  261



>ref|XP_010933874.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=640

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +3

Query  393  QAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYR  572
              P  ++FP C A+ SEYTPC+D  RSLKF R  L YRERHCPAK E L+C IPAP GY+
Sbjct  96   DGPARRDFPACDAKYSEYTPCEDVARSLKFPRDRLIYRERHCPAKGEELRCLIPAPAGYQ  155

Query  573  IPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIG  752
             P  WPESR   W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYID+I 
Sbjct  156  KPFPWPESRGVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPNGADAYIDEID  215

Query  753  RLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            RLINL+DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER  P
Sbjct  216  RLINLRDGSVRTAIDTGCGVASWGAYLLSRDILTMSFAPRDSHEAQVQFALERGAP  271



>ref|XP_004309496.1| PREDICTED: probable methyltransferase PMT18 [Fragaria vesca subsp. 
vesca]
 ref|XP_011470852.1| PREDICTED: probable methyltransferase PMT18 [Fragaria vesca subsp. 
vesca]
Length=629

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + ++   + FPPC    SEYTPCQDT R  KFDR+MLKYRERHCP KEE L C IPAP
Sbjct  88   VEINKSEAVQTFPPCSMVYSEYTPCQDTNRGRKFDRQMLKYRERHCPTKEEQLLCLIPAP  147

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  148  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  207

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI +LI L +G IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTH AQVQFALER +P
Sbjct  208  DDINKLIPLTNGHIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVP  267



>ref|XP_002518966.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43499.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +       EFPPC    SEYTPCQ  ER  KFDR MLKYRERHCP KEELL C IPAP
Sbjct  87   IEINTTDAVAEFPPCDMSYSEYTPCQHPERGRKFDRNMLKYRERHCPTKEELLLCLIPAP  146

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  147  PKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYI  206

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  207  DDINELVPLTGGAIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_010250929.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250938.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250946.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250956.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250965.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250972.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250980.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
Length=633

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEELL+C IPAP
Sbjct  88   VGINETDGIEKFPPCDMTYSEYTPCQDPVRGRKFDRNMLKYRERHCPTKEELLRCLIPAP  147

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G RF FPGGGTMFPRGADAYI
Sbjct  148  PKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGNRFRFPGGGTMFPRGADAYI  207

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI +LI L  G+IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  208  DDINKLIPLTSGTIRTALDTGCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVP  267



>ref|XP_006306983.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
 gb|EOA39881.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
Length=640

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  109  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  168

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  169  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFKFPGGGTMFPRGADAYIDDIARLIP  228

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  280



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V  +  ++ FPPC    +EYTPCQD  R  KFDR+ LKYRERHCP KEELL+C IPAP
Sbjct  103  LEVNSSEESQAFPPCDKSYTEYTPCQDPSRGRKFDRKFLKYRERHCPDKEELLRCLIPAP  162

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WYAN+PHKHL+VEKA QNW++ +G+RF FPGGGTMFP GADAYI
Sbjct  163  PNYKTPFKWPQSRDYAWYANIPHKHLSVEKANQNWIQLEGDRFKFPGGGTMFPNGADAYI  222

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L +G IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEAQV FALER +P
Sbjct  223  DDINELIPLSNGDIRTALDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVWFALERGVP  282



>ref|XP_010461135.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=641

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  109  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  168

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  169  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  228

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  280



>ref|NP_564419.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
 sp|Q9C884.1|PMTI_ARATH RecName: Full=Probable methyltransferase PMT18 [Arabidopsis thaliana]
 gb|AAG51278.1|AC027035_1 hypothetical protein [Arabidopsis thaliana]
 gb|AAM98224.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78933.1| At1g33170 [Arabidopsis thaliana]
 gb|AEE31570.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
Length=639

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  107  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  166

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  167  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  226

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  227  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  278



>ref|XP_002891032.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67291.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  107  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  166

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  167  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  226

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  227  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  278



>ref|XP_011004387.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
 ref|XP_011004388.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
Length=625

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
              E PPC    SEYTPCQD  R  KFDR MLKYRERHCP K+ELL C IPAP  Y+ P +
Sbjct  90   VNEIPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFK  149

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI 
Sbjct  150  WPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDISELIP  209

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  210  LTDGSIRTAIDTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVP  261



>ref|XP_010478718.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=638

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  106  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  165

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  166  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  225

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  226  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  277



>gb|AAF97349.1|AC021045_6 Unknown Protein [Arabidopsis thaliana]
Length=656

 Score =   270 bits (689),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  107  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  166

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGTMFPRGADAYIDDI RLI 
Sbjct  167  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIP  226

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  227  LTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  278



>ref|XP_002270920.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660487.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660490.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
Length=632

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYRERHCP K+ELL C IPAP
Sbjct  89   VEINNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTKDELLLCLIPAP  148

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  149  PKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  208

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  209  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  268



>ref|XP_007143370.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
 gb|ESW15364.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
Length=598

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            ++ FP C A  SEYTPCQD +RSL + R  + YRERHCP  EE LKCR+PAP GYR P  
Sbjct  67   SRTFPRCSANFSEYTPCQDPQRSLGYKRHRMIYRERHCP--EEPLKCRVPAPHGYRNPFP  124

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  W+ANVPH+ LTVEKA QNW+RF+GERF FPGGGT FP GADAYI+DIG+LIN
Sbjct  125  WPASRDRAWFANVPHRELTVEKAVQNWIRFEGERFVFPGGGTTFPNGADAYIEDIGKLIN  184

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L+DGSIRTA+DTGCGVASWGAYLLSR+I  LS AP+DTHEAQVQFALER +P
Sbjct  185  LRDGSIRTALDTGCGVASWGAYLLSRNILTLSIAPRDTHEAQVQFALERGVP  236



>gb|AFW63361.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
 gb|AFW63362.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=352

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRI  575
            P    +P C A  SEYTPC+D ERSL+F R  L YRERHCPA E E L+C +PAP GYR 
Sbjct  111  PRRSSYPACPARYSEYTPCEDVERSLRFPRDRLVYRERHCPASERERLRCLVPAPPGYRT  170

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WP SRD  W+AN PHK LTVEKA QNW+R  G+R  FPGGGTMFP GADAYIDDI +
Sbjct  171  PFPWPASRDVAWFANAPHKELTVEKAVQNWIRVDGDRLRFPGGGTMFPNGADAYIDDIAK  230

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L+ L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  231  LVPLHDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  285



>emb|CDX99539.1| BnaC09g24530D [Brassica napus]
Length=625

 Score =   269 bits (687),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  KFDR MLKYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  88   KYFEPCDLSLSEYTPCEDRQRGRKFDRNMLKYRERHCPSKDELLYCLIPPPPNYKIPFKW  147

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  148  PQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  207

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  208  TNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  258



>ref|XP_010660482.1| PREDICTED: probable methyltransferase PMT18 isoform X1 [Vitis 
vinifera]
Length=652

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYRERHCP K+ELL C IPAP
Sbjct  109  VEINNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTKDELLLCLIPAP  168

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  169  PKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  228

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  229  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  288



>gb|KJB24074.1| hypothetical protein B456_004G127200 [Gossypium raimondii]
Length=620

 Score =   268 bits (686),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            VA+  +    +FPPC    SEYTPCQD  R  KFDR M+KYRERHCP K+E+L C IPAP
Sbjct  83   VALDSSKTISQFPPCDMAYSEYTPCQDKVRGRKFDRDMMKYRERHCPTKQEMLLCLIPAP  142

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  143  PKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  202

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG LI L DG+IRTA+DTGCGVAS+GAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  203  DDIGELIPLTDGNIRTAVDTGCGVASFGAYLLKRNILTMSFAPRDTHEAQVQFALERGVP  262



>gb|EYU33422.1| hypothetical protein MIMGU_mgv1a002913mg [Erythranthe guttata]
Length=626

 Score =   268 bits (686),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            ++V  +   ++FPPC    SEYTPCQD  R  KF R MLKYRERHCP+KEELL+C +PAP
Sbjct  84   LSVNSSEEIEKFPPCDMAYSEYTPCQDNLRGRKFPRDMLKYRERHCPSKEELLRCLVPAP  143

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WYAN+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  144  PNYKSPFKWPQSRDYAWYANIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  203

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI + DG++RTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  204  DDINALIPITDGTVRTAVDTGCGVASWGAYLLKRDIMAMSFAPRDTHEAQVWFALERGVP  263



>ref|XP_007039271.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23772.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=630

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V V  +    +FPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEELL C IPAP
Sbjct  87   VEVDSSKTVSQFPPCDMSFSEYTPCQDKVRGRKFDRDMLKYRERHCPTKEELLLCLIPAP  146

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  147  PKYKTPFKWPQSRDYAWYDNIPHRELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  206

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG+LI L DG+IRTA+DTGCGVAS+GAYLL R++  +S AP+DTHEAQVQFALER +P
Sbjct  207  DDIGQLIPLTDGTIRTAVDTGCGVASFGAYLLKRNVLTMSIAPRDTHEAQVQFALERGVP  266



>ref|XP_002874627.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50886.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC+  LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  94   KYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  153

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  154  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  213

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  214  TDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  264



>ref|XP_009113612.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 ref|XP_009113613.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
Length=625

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  KFDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  88   KYFEPCDLSLSEYTPCEDRQRGRKFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  147

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  148  PQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  207

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  208  TNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  258



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   275 bits (702),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 4/178 (2%)
 Frame = +3

Query  399  PPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            PP K     FP C A+LSE+TPC+D +RSLKF R  L+YR+RHCP +EE LKCRIPAP+G
Sbjct  78   PPVKAATVSFPSCGAKLSEHTPCEDAKRSLKFPRGRLEYRQRHCPEREEALKCRIPAPYG  137

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            Y+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGAD+YIDD
Sbjct  138  YKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADSYIDD  197

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LI+L  GSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  198  IGQLIDLSHGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_011624208.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Amborella 
trichopoda]
 gb|ERN08212.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
Length=634

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            ++FP C+ + SEYTPCQD +R+ KF+++ML YRERHCPAK+ELL+C IPAP GY+ P  W
Sbjct  101  QKFPACEMKFSEYTPCQDPKRARKFEKKMLIYRERHCPAKDELLRCLIPAPPGYKNPFPW  160

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LT+EKA QNW++ +GE+F FPGGGTMFPRGADAYIDDI  LI L
Sbjct  161  PRSRDWAWYANVPHKELTIEKAVQNWIQVEGEKFRFPGGGTMFPRGADAYIDDINELIPL  220

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G IRTA+DTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  221  TSGKIRTALDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  271



>ref|XP_006846537.2| PREDICTED: probable methyltransferase PMT17 isoform X1 [Amborella 
trichopoda]
Length=638

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            ++FP C+ + SEYTPCQD +R+ KF+++ML YRERHCPAK+ELL+C IPAP GY+ P  W
Sbjct  105  QKFPACEMKFSEYTPCQDPKRARKFEKKMLIYRERHCPAKDELLRCLIPAPPGYKNPFPW  164

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  WYANVPHK LT+EKA QNW++ +GE+F FPGGGTMFPRGADAYIDDI  LI L
Sbjct  165  PRSRDWAWYANVPHKELTIEKAVQNWIQVEGEKFRFPGGGTMFPRGADAYIDDINELIPL  224

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G IRTA+DTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  225  TSGKIRTALDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVP  275



>ref|XP_009768341.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768342.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768343.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768344.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768345.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
Length=636

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V  +  ++ FPPC    SEYTPCQ+ +R  KFDR MLKYRERHCP+KEEL++C IPAP
Sbjct  95   LVVNNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHCPSKEELIRCLIPAP  154

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+IP +WP+SRD  W+AN+PHK L++EKA QNWV+ +G+R  FPGGGTMFP GADAYI
Sbjct  155  PNYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYI  214

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  215  DDISELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVWFALERGVP  274



>ref|XP_010421961.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=637

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  96   KYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  155

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  156  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  215

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  216  NDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  266



>ref|XP_009596889.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596890.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596891.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596893.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596894.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596895.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
Length=634

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + V  +  ++ FPPC    SEYTPCQ+ +R  KFDR MLKYRERHCP+K+ELL+C IPAP
Sbjct  93   LVVNNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHCPSKDELLRCLIPAP  152

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+IP +WP+SRD  W+AN+PHK L++EKA QNWV+ +G+R  FPGGGTMFP GADAYI
Sbjct  153  PNYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYI  212

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  213  DDISELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVWFALERGVP  272



>ref|NP_192782.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
 sp|Q9SZX8.1|PMTH_ARATH RecName: Full=Probable methyltransferase PMT17 [Arabidopsis thaliana]
 emb|CAB40037.1| putative protein [Arabidopsis thaliana]
 emb|CAB78167.1| putative protein [Arabidopsis thaliana]
 gb|AEE82883.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
Length=633

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC+  LSEYTPC+D +R  +FDR M+KYRERHCP K+ELL C IP P  Y+IP +W
Sbjct  91   KYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPVKDELLYCLIPPPPNYKIPFKW  150

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  151  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  210

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  211  TDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  261



>ref|XP_010056104.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056105.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056106.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 gb|KCW72678.1| hypothetical protein EUGRSUZ_E01134 [Eucalyptus grandis]
Length=633

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            VA+  +   +  P C    SEYTPCQD +R  KFDR MLKYRERHCP K+ELLKC IPAP
Sbjct  90   VAINDSDTVETIPACDMAHSEYTPCQDPQRGRKFDRNMLKYRERHCPKKDELLKCLIPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  150  PRYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  210  DDINELIPLTSGKIRTAIDTGCGVASWGAYLLKRDIVTMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_010455441.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=633

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  96   KYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  155

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  156  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  215

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  216  TDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  266



>ref|XP_004496597.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=623

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK-EELLKCRIPAPFGYRIPVRWP  590
            FP C    +EYTPC+D  RSL++ R  + +RERHCP K EE LKCR+P P+GYR P  WP
Sbjct  94   FPRCSVNFTEYTPCEDPTRSLRYKRSRMIFRERHCPIKGEEDLKCRVPPPYGYRNPFPWP  153

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
             SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FPGGGTMFP GADAYIDDIG+LINLK
Sbjct  154  ASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFFFPGGGTMFPNGADAYIDDIGKLINLK  213

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTA+DTGCGVASWGAYL+SR+I  LS AP+DTHEAQVQFALER +P
Sbjct  214  DGSIRTALDTGCGVASWGAYLMSRNIITLSIAPRDTHEAQVQFALERGVP  263



>ref|XP_006397065.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
 gb|ESQ38518.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
Length=665

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  128  KYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  187

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  188  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  247

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  248  TDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  298



>ref|XP_004145886.1| PREDICTED: probable methyltransferase PMT18 [Cucumis sativus]
 gb|KGN49950.1| hypothetical protein Csa_5G146240 [Cucumis sativus]
Length=636

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  420  PCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESR  599
            PC    SEYTPCQD  R+ KFDR MLKYRERHCPAKEELL C IPAP  Y+ P +WP+SR
Sbjct  104  PCDMSFSEYTPCQDPTRARKFDRTMLKYRERHCPAKEELLHCMIPAPPKYKTPFKWPQSR  163

Query  600  DSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGS  779
            D  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G 
Sbjct  164  DYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTTGK  223

Query  780  IRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  224  IRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  270



>gb|KJB18849.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18850.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18851.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18852.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18853.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18857.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=528

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  435  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  614
             SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWY  62

Query  615  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  794
            +N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAI
Sbjct  63   SNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAI  122

Query  795  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  123  DTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  164



>ref|XP_009124372.1| PREDICTED: probable methyltransferase PMT18 [Brassica rapa]
Length=638

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  107  KYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  166

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGT FPRGADAYIDDI RLI L
Sbjct  167  PQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTGFPRGADAYIDDISRLIPL  226

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  227  TDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVP  277



>emb|CDX84046.1| BnaC08g07230D [Brassica napus]
Length=612

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  82   KYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  141

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGT FPRGADAYIDDI RLI L
Sbjct  142  PQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTGFPRGADAYIDDISRLIPL  201

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  202  TDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  252



>ref|XP_002452759.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
 gb|EES05735.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
Length=666

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRIPVR  584
            + +P C A+ SEYTPC+D ERSL+F R  L YRERHCPA E E+L+C +PAP GYR P  
Sbjct  128  RRYPACAAKYSEYTPCEDVERSLRFPRDRLVYRERHCPASEREVLRCLVPAPAGYRTPFP  187

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI 
Sbjct  188  WPASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPNGADAYIDDIGKLIP  247

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  248  LHDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  299



>ref|XP_008437487.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
 ref|XP_008437488.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
Length=636

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K   PC    SEYTPCQD  R+ KFDR MLKYRERHCPAKEE L C IPAP  Y+ P +
Sbjct  99   TKTISPCDMSFSEYTPCQDPTRARKFDRTMLKYRERHCPAKEEQLLCMIPAPPKYKTPFK  158

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI 
Sbjct  159  WPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIP  218

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L  G IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  219  LTTGKIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  270



>ref|XP_006415121.1| hypothetical protein EUTSA_v10007044mg [Eutrema salsugineum]
 gb|ESQ33474.1| hypothetical protein EUTSA_v10007044mg [Eutrema salsugineum]
Length=638

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K F PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +
Sbjct  107  VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFK  166

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  WY N+PHK L++EKA QNW++ +GE+F FPGGGT FPRGADAYIDDI RLI 
Sbjct  167  WPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGEKFRFPGGGTGFPRGADAYIDDISRLIP  226

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  227  LTDGAIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  278



>gb|KFK31838.1| hypothetical protein AALP_AA6G165000 [Arabis alpina]
Length=625

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP K+ELL C IP P  Y+IP +W
Sbjct  88   KYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPTKDELLYCLIPPPPNYKIPFKW  147

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  148  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  207

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  208  TNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  258



>ref|XP_006286418.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
 gb|EOA19316.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
Length=637

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K   PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  97   KYLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  156

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  157  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  216

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  217  TDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  267



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFG  566
            V  AP  + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP++ E L+C +PAP G
Sbjct  102  VESAPAKRTYEACPAQYSEYTPCEDVERSLRFPRDRLMYRERHCPSEGERLRCLVPAPQG  161

Query  567  YRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDD  746
            YR P  WP SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GA AYIDD
Sbjct  162  YRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGAGAYIDD  221

Query  747  IGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            IG+LI L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  222  IGKLIPLHDGSIRTALDTGCGVASWGAYLLSRDILVMSFAPRDSHEAQVQFALERGVP  279


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 41/85 (48%), Gaps = 8/85 (9%)
 Frame = +2

Query  131  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSG-------QQISTAALLPSVPCEPl  289
            LS+  +R  L+ +AA  VLCSV YLIG+  HGGFS          +S A   PSVPC   
Sbjct  12   LSSVARRPTLHQLAAVAVLCSVSYLIGVWHHGGFSASPPGGTTSPVSVAITTPSVPCV-S  70

Query  290  nkdstdttnltssssAVSLDFAAHH  364
               +           A  LDF AHH
Sbjct  71   PNVTVLGGGGGGGRLAPPLDFRAHH  95



>emb|CDX94256.1| BnaC02g29160D [Brassica napus]
Length=619

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  83   KNFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  142

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PH+ L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  143  PQSRDYAWYDNIPHRELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  202

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  203  TAGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  253



>emb|CDY44966.1| BnaA08g06660D [Brassica napus]
Length=620

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K   PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  82   KYLEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  141

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGT FPRGADAYIDDI RLI L
Sbjct  142  PQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTGFPRGADAYIDDISRLIPL  201

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  202  TDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  252



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            EFPPC    S+YTPCQD  RS KFDR M KYRERHCP  EELL+C IPAP  Y+ P +WP
Sbjct  100  EFPPCDMSYSDYTPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPFKWP  159

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGGT FP GADAYID+I  LI L 
Sbjct  160  QSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELIPLT  219

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             G+IRTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  220  GGNIRTAVDTGCGVASWGAYLLKRDILTMSFAPRDTHEAQVQFALERGVP  269



>gb|KHM99867.1| Putative methyltransferase PMT18 [Glycine soja]
Length=527

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  435  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  614
             SEYTPCQD  R  KFDR MLKYRERHCPAKEELL C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYTPCQDPVRGRKFDRNMLKYRERHCPAKEELLNCLIPAPPKYKTPFKWPQSRDYAWY  62

Query  615  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  794
             N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAI
Sbjct  63   DNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGTIRTAI  122

Query  795  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  123  DTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  164



>ref|XP_009107959.1| PREDICTED: probable methyltransferase PMT18 [Brassica rapa]
Length=641

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K   PC   LSEYTPC+D ER  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  110  KYLEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  169

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L++EKA QNW++ +GERF FPGGGT FPRGADAYIDDI RLI L
Sbjct  170  PQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTGFPRGADAYIDDISRLIPL  229

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  230  TDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDTHEAQVQFALERGVP  280



>ref|XP_009128712.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 emb|CDY25257.1| BnaA02g21990D [Brassica napus]
Length=620

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            K   PC   LSEYTPC+D +R  +FDR M+KYRERHCP+K+ELL C IP P  Y+IP +W
Sbjct  83   KNLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKW  142

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI RLI L
Sbjct  143  PQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLIPL  202

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
              G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  203  TAGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVP  253



>gb|EEE61530.1| hypothetical protein OsJ_15834 [Oryza sativa Japonica Group]
Length=529

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + VA     + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP++ E L+C +PAP
Sbjct  1    MEVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPSEGERLRCLVPAP  60

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
             GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R +GE+F FPGGGTMFP GA AYI
Sbjct  61   QGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVEGEKFRFPGGGTMFPHGAGAYI  120

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  121  DDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  180



>emb|CDM86771.1| unnamed protein product [Triticum aestivum]
Length=641

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            +P C AE SEYTPC+D +RSL++ R  L YRERHCP+  E L+C +PAP GYR P  WP 
Sbjct  112  YPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPWPA  171

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI L D
Sbjct  172  SRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPLHD  231

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            GSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  232  GSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  280



>gb|KDO43765.1| hypothetical protein CISIN_1g038698mg, partial [Citrus sinensis]
Length=283

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIP  578
            P AK F PC  + S+YTPCQ+ +R++KF R  + YRERHCP ++E L C IPAP GY  P
Sbjct  77   PKAKVFKPCDVKYSDYTPCQEQDRAMKFPRENMTYRERHCPPEDEKLHCLIPAPKGYMTP  136

Query  579  VRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRL  758
              WP+ RD V YANVPHK LTVEKA QNWV+F+G  F FPGGGTMFP+GADAYID++  +
Sbjct  137  FPWPKGRDYVHYANVPHKSLTVEKAVQNWVQFQGNVFKFPGGGTMFPQGADAYIDELASV  196

Query  759  INLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            I +KDGS+RTA+DTGCGVASWGAYLL R++  +SFAP+D HEAQVQFALER +P
Sbjct  197  IPIKDGSVRTALDTGCGVASWGAYLLKRNVLTMSFAPRDNHEAQVQFALERGVP  250



>ref|XP_003555372.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=600

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = +3

Query  393  QAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYR  572
             A  +K FP C A  SEYTPC D +RSL++ R    Y+ERHCP  EE LKCR+PAP GYR
Sbjct  61   SAESSKTFPRCSANFSEYTPCHDPQRSLRYKRSRKIYKERHCP--EEPLKCRVPAPHGYR  118

Query  573  IPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIG  752
             P  WP SRD  W+ANVPH+ LTVEKA QNW+R  G+RF FPGGGT FP GADAYI+DIG
Sbjct  119  NPFPWPASRDRAWFANVPHRELTVEKAVQNWIRSDGDRFVFPGGGTTFPNGADAYIEDIG  178

Query  753  RLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             LINLKDGSIRTA+DTGCGVASWGAYLLSR+I  LS AP+DTHEAQVQFALER +P
Sbjct  179  MLINLKDGSIRTALDTGCGVASWGAYLLSRNILTLSIAPRDTHEAQVQFALERGVP  234



>ref|XP_012086579.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Jatropha 
curcas]
Length=638

 Score =   264 bits (674),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +        FP C    SEYTPCQ  +R  KFDR MLKYRERHCP KEELL C IPAP
Sbjct  95   IEINNTDTVANFPSCDMSFSEYTPCQHPQRGRKFDRNMLKYRERHCPTKEELLFCLIPAP  154

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  155  PKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYI  214

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  215  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKREILAMSFAPRDTHEAQVQFALERGVP  274



>ref|XP_012086580.1| PREDICTED: probable methyltransferase PMT18 isoform X3 [Jatropha 
curcas]
 ref|XP_012086581.1| PREDICTED: probable methyltransferase PMT18 isoform X3 [Jatropha 
curcas]
 gb|KDP25187.1| hypothetical protein JCGZ_20343 [Jatropha curcas]
Length=626

 Score =   263 bits (673),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +        FP C    SEYTPCQ  +R  KFDR MLKYRERHCP KEELL C IPAP
Sbjct  83   IEINNTDTVANFPSCDMSFSEYTPCQHPQRGRKFDRNMLKYRERHCPTKEELLFCLIPAP  142

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  143  PKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYI  202

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  203  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKREILAMSFAPRDTHEAQVQFALERGVP  262



>ref|XP_012086578.1| PREDICTED: probable methyltransferase PMT18 isoform X1 [Jatropha 
curcas]
Length=640

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +        FP C    SEYTPCQ  +R  KFDR MLKYRERHCP KEELL C IPAP
Sbjct  97   IEINNTDTVANFPSCDMSFSEYTPCQHPQRGRKFDRNMLKYRERHCPTKEELLFCLIPAP  156

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  157  PKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYI  216

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  217  DDINELIPLTGGTIRTAIDTGCGVASWGAYLLKREILAMSFAPRDTHEAQVQFALERGVP  276



>ref|XP_009389104.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389112.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389120.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            +FPPC    SEYTPC D  R  +F+R ML YRERHCP  +EL++C IPAP  Y+ P +WP
Sbjct  96   KFPPCDLNFSEYTPCHDRTRGRRFERAMLVYRERHCPGNDELIRCLIPAPPKYKTPFKWP  155

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WY N+PHK L++EKA QNW++  G+RF FPGGGTMFPRGADAYIDDI  LI+L 
Sbjct  156  QSRDYAWYDNIPHKELSIEKAVQNWIQVDGDRFRFPGGGTMFPRGADAYIDDINALISLT  215

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  216  DGSIRTAIDTGCGVASWGAYLLRRDIVTMSFAPRDTHEAQVQFALERGVP  265



>ref|XP_002298987.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE83792.1| dehydration-responsive family protein [Populus trichocarpa]
Length=529

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  435  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  614
             SEY PCQDT+R  KFDR MLKYRERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYAPCQDTQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWY  62

Query  615  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  794
             N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L DGSIRTAI
Sbjct  63   DNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTDGSIRTAI  122

Query  795  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  123  DTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVP  164



>ref|XP_003592303.1| hypothetical protein MTR_1g101370 [Medicago truncatula]
 gb|AES62554.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=634

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +3

Query  387  VAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK-EELLKCRIPAPF  563
            +A +     FP C    +EYTPC+D  RSL++ R  + YRERHCP K EE LKCR+P P 
Sbjct  83   IALSSETFNFPRCGVNFTEYTPCEDPTRSLRYKRSRMIYRERHCPVKGEEDLKCRVPPPH  142

Query  564  GYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYID  743
            GY+ P  WP SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FPGGGTMFP GA AYID
Sbjct  143  GYKTPFTWPASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFFFPGGGTMFPNGAGAYID  202

Query  744  DIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DIG+LINLKDGSIRTA+DTGCGVASWGAYL SR+I  LS AP+DTHEAQVQFALER +P
Sbjct  203  DIGKLINLKDGSIRTALDTGCGVASWGAYLQSRNIITLSLAPRDTHEAQVQFALERGVP  261



>dbj|BAJ98046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +P C AE SEYTPC+D +RSL++ R  L YRERHCP+  E L+C +PAP GYR P  W
Sbjct  112  RRYPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPW  171

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI L
Sbjct  172  PASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPL  231

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  232  HDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  282



>ref|XP_009398109.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398110.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398111.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
Length=634

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             ++FPPC    SEYTPCQD  R  KF R ML YRERHCPA+ EL++C IPAP  Y+ P +
Sbjct  99   TEKFPPCALNFSEYTPCQDLTRCKKFARAMLAYRERHCPAQHELIRCLIPAPPKYKTPFK  158

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGAD YIDDI  L++
Sbjct  159  WPRSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADVYIDDINALVS  218

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  219  LTDGDIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHEAQVQFALERGVP  270



>ref|XP_008791705.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=566

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A++FPPC +  +EYTPCQD  R  +F+R+ML YRERHCP  +EL++C IPAP  Y++P +
Sbjct  99   AEKFPPCPSNFTEYTPCQDRTRGRRFERKMLIYRERHCPGNDELIRCLIPAPPNYKMPFK  158

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  W+ N+PHK L++EKA QNWV  +G++F FPGGGTMFPRGADAYIDDI  LI 
Sbjct  159  WPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDKFRFPGGGTMFPRGADAYIDDISALIP  218

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVAS GAYLL RD+  +SFAP+DTHEAQVQFALER +P
Sbjct  219  LTDGSIRTAIDTGCGVASLGAYLLKRDVITMSFAPRDTHEAQVQFALERGVP  270



>ref|XP_010110846.1| putative methyltransferase PMT18 [Morus notabilis]
 gb|EXC28325.1| putative methyltransferase PMT18 [Morus notabilis]
Length=448

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 143/199 (72%), Gaps = 19/199 (10%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V ++Q+   ++ PPC   LSEYTPCQ   R  KFDR ML YRERHCPAKEELL C IPAP
Sbjct  85   VNISQSEGIRKLPPCDMSLSEYTPCQHPPRGRKFDRNMLMYRERHCPAKEELLLCLIPAP  144

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  145  PKYKTPFKWPQSRDFAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  204

Query  741  DDIGRLINLKDGSIRTAIDTGCG-------------------VASWGAYLLSRDIFPLSF  863
            DDI  LI L  G+IRTAIDTGCG                   VASWGAYLL R+I  +SF
Sbjct  205  DDINELIPLTTGAIRTAIDTGCGNRIANVFALVDHVLAVVGKVASWGAYLLKRNILTMSF  264

Query  864  APKDTHEAQVQFALERXIP  920
            AP+DTHEAQVQFALER +P
Sbjct  265  APRDTHEAQVQFALERGVP  283



>ref|XP_008378063.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378064.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378065.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V V +    ++FPPC    SEYTPCQD  R  KFDR+MLK+RERHCP KEE L C IPAP
Sbjct  89   VDVNKTEAVQKFPPCDMSYSEYTPCQDPRRGRKFDRKMLKHRERHCPTKEEQLLCLIPAP  148

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  208

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +SFAP+D+H AQVQFALER +P
Sbjct  209  DDINXLIPLTKGNIRTAIDTGCGVASWGAYLLKRNIVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_011070323.1| PREDICTED: probable methyltransferase PMT18 [Sesamum indicum]
Length=626

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            ++V  +   ++FPPC    SEYTPC+D +RS KFDR   KYRERHCP K+ELL+C +PAP
Sbjct  90   LSVNSSQDIEKFPPCDISYSEYTPCEDQQRSKKFDRDRFKYRERHCPTKQELLRCLVPAP  149

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WYAN+PHK L++EKA QNW++ +GERF FPGGGTMF  GAD YI
Sbjct  150  PNYKRPFKWPQSRDYAWYANIPHKELSIEKAVQNWIQVEGERFRFPGGGTMFANGADVYI  209

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI + DGSIRTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  210  DDINALIPITDGSIRTALDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVWFALERGVP  269



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V V +    + F PC    SEYTPCQD  R  KFDR+MLKYRERHCP KEE L C IPAP
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  208

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+D+H AQVQFALER +P
Sbjct  209  DDINALIPLTKGNIRTAIDTGCGVASWGAYLLKRDIVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V V +    + F PC    SEYTPCQD  R  KFDR+MLKYRERHCP KEE L C IPAP
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  208

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+D+H AQVQFALER +P
Sbjct  209  DDINALIPLTKGNIRTAIDTGCGVASWGAYLLKRDIVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_007210288.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
 gb|EMJ11487.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
Length=636

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + ++   ++FP C    SEYTPCQDT+R  KFDR+MLKYRERHCP KEE L C IPAP
Sbjct  95   VEINKSDAVQKFPACDMAYSEYTPCQDTQRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  154

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGA AYI
Sbjct  155  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGAGAYI  214

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL  DI  +SFAP+DTH AQVQFALER +P
Sbjct  215  DDIDALIPLSKGNIRTAIDTGCGVASWGAYLLRNDILAMSFAPRDTHAAQVQFALERGVP  274



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + VA     + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP++ E L+C +PAP
Sbjct  102  MEVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPSEGERLRCLVPAP  161

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
             GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R +GE+F FPGGGTMFP GA AYI
Sbjct  162  QGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVEGEKFRFPGGGTMFPHGAGAYI  221

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  222  DDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  281



>ref|XP_008663475.1| PREDICTED: probable methyltransferase PMT15 [Zea mays]
 gb|AFW59147.1| hypothetical protein ZEAMMB73_843401 [Zea mays]
Length=641

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C A+ SEYTPC+D ERSL+F R  L YRERHCPA  E L+C +PAP GYR P  W
Sbjct  108  RSYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPADGERLRCLVPAPRGYRNPFPW  167

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK L+VEKA QNW+R  G+RF FPGGGTMFPRGA AYIDDI +LI L
Sbjct  168  PASRDVAWFANVPHKELSVEKAVQNWIRVDGDRFRFPGGGTMFPRGAGAYIDDIAKLIPL  227

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  228  HDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  278



>ref|XP_006661944.1| PREDICTED: probable methyltransferase PMT18-like [Oryza brachyantha]
Length=633

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C    SEYTPC+D  R  +F+R ML YRERHCP K+E ++C +PAP  YR P +WP+
Sbjct  103  FPACPMNFSEYTPCEDRTRGRRFERAMLVYRERHCPGKDEEIRCLVPAPPKYRTPFKWPQ  162

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ N+PHK L++EKA QNW++  GERF FPGGGTMFPRGADAYIDDIG+LI+L D
Sbjct  163  SRDYAWFNNIPHKELSIEKAVQNWIQVDGERFRFPGGGTMFPRGADAYIDDIGKLISLSD  222

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            G IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  223  GRIRTAIDTGCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVP  271



>ref|XP_009360254.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009360255.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=632

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEE L C IPAP
Sbjct  91   VDINKTEAVQKFPPCDMSYSEYTPCQDATRGRKFDRSMLKYRERHCPTKEEQLLCLIPAP  150

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +GERF FPGGGT FPRGADAYI
Sbjct  151  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGERFRFPGGGTGFPRGADAYI  210

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            D++  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTH AQVQFALER +P
Sbjct  211  DEMNALIPLTKGNIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVP  270



>gb|EEC67295.1| hypothetical protein OsI_34283 [Oryza sativa Indica Group]
Length=634

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C    SEYTPC+D +R  +F+R ML YRERHCP K+E ++C IPAP  YR P +WP+
Sbjct  104  FPACPLNFSEYTPCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAPPKYRTPFKWPQ  163

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ N+PHK L++EKA QNW++  G+RF FPGGGTMFPRGADAYIDDIG+LI+L D
Sbjct  164  SRDFAWFNNIPHKELSIEKAVQNWIQVDGQRFRFPGGGTMFPRGADAYIDDIGKLISLTD  223

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            G IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  224  GKIRTAIDTGCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVP  272



>ref|NP_001065036.1| Os10g0510400 [Oryza sativa Japonica Group]
 gb|AAK84446.1|AC087192_7 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54570.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47874.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26950.1| Os10g0510400 [Oryza sativa Japonica Group]
 dbj|BAG93354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51256.1| hypothetical protein OsJ_32126 [Oryza sativa Japonica Group]
Length=634

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  593
            FP C    SEYTPC+D +R  +F+R ML YRERHCP K+E ++C IPAP  YR P +WP+
Sbjct  104  FPACPLNFSEYTPCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAPPKYRTPFKWPQ  163

Query  594  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  773
            SRD  W+ N+PHK L++EKA QNW++  G+RF FPGGGTMFPRGADAYIDDIG+LI+L D
Sbjct  164  SRDFAWFNNIPHKELSIEKAVQNWIQVDGQRFRFPGGGTMFPRGADAYIDDIGKLISLTD  223

Query  774  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            G IRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  224  GKIRTAIDTGCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVP  272



>ref|XP_008668482.1| PREDICTED: uncharacterized protein LOC100384329 isoform X1 [Zea 
mays]
Length=638

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C A+ SEYTPC+D ERSL+F R  L YRERHCPA  E L+C +PAP GYR P  W
Sbjct  105  RNYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAAGERLRCLVPAPKGYRNPFPW  164

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK L+VEKA QNW+R  G++F FPGGGTMFPRGA AYIDDIG+LI L
Sbjct  165  PASRDVAWFANVPHKELSVEKAVQNWIRVDGDKFRFPGGGTMFPRGAGAYIDDIGKLIPL  224

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  225  HDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  275



>ref|XP_008348991.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348992.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348993.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V V +    ++FPPC    SEYTPCQD  R  KFDR+MLK RERHCP KEE L C IPAP
Sbjct  89   VDVNKTEAVQKFPPCDMSYSEYTPCQDPRRGRKFDRKMLKXRERHCPTKEEQLLCLIPAP  148

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  208

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +SFAP+D+H AQVQFALER +P
Sbjct  209  DDINXLIPLTKGNIRTAIDTGCGVASWGAYLLKRNIVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_004953430.1| PREDICTED: probable methyltransferase PMT16-like [Setaria italica]
Length=648

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRIPVR  584
            + +P C  + SEYTPC+D ERSL++ R  L YRERHCPA E E L+C +PAP GYR P  
Sbjct  119  RRYPACPVKYSEYTPCEDVERSLRYPRDRLVYRERHCPASERERLRCLVPAPRGYRTPFP  178

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI 
Sbjct  179  WPASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPNGADAYIDDIGKLIP  238

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  239  LHDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  290



>dbj|BAJ84848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            AP  + +  C A+ SEYTPC+D ERSL+F R  L YRERHCPA+ E L+C +PAP GYR 
Sbjct  94   APARRAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRN  153

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WP SRD  W+ANVPHK LTVEKA QNW+  +G++F FPGGGTMFP GA AYIDDIG 
Sbjct  154  PFPWPASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGN  213

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LI L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  214  LIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  268



>dbj|BAJ87212.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            AP  + +  C A+ SEYTPC+D ERSL+F R  L YRERHCPA+ E L+C +PAP GYR 
Sbjct  94   APARRAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRN  153

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WP SRD  W+ANVPHK LTVEKA QNW+  +G++F FPGGGTMFP GA AYIDDIG 
Sbjct  154  PFPWPASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGN  213

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LI L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  214  LIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  268



>ref|XP_002975160.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
 gb|EFJ23945.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
Length=632

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRIPVRWP  590
            F  C  + SEYTPC+D ERSL+FDR  L YRERHCPA++ E L+C IPAP GYR P  WP
Sbjct  97   FDSCALKFSEYTPCEDIERSLRFDRDRLIYRERHCPAQDSERLRCLIPAPPGYRNPFPWP  156

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WYANVPHK LTVEKA QNW++++G+RF FPGGGTMFP+GADAYIDDIG+L+ LK
Sbjct  157  KSRDFAWYANVPHKELTVEKAVQNWIQYEGDRFKFPGGGTMFPKGADAYIDDIGKLVPLK  216

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTA+DTGCGVAS+GA+LLSR++  +SFAP+DTHE QVQFALER +P
Sbjct  217  DGSIRTALDTGCGVASFGAFLLSRNVLTMSFAPRDTHEGQVQFALERGVP  266



>dbj|BAJ95401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            AP  + +  C A+ SEYTPC+D ERSL+F R  L YRERHCPA+ E L+C +PAP GYR 
Sbjct  94   APARRAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRN  153

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WP SRD  W+ANVPHK LTVEKA QNW+  +G++F FPGGGTMFP GA AYIDDIG 
Sbjct  154  PFPWPASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGN  213

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            LI L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  214  LIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  268



>ref|XP_002966153.1| hypothetical protein SELMODRAFT_143797 [Selaginella moellendorffii]
 gb|EFJ32180.1| hypothetical protein SELMODRAFT_143797 [Selaginella moellendorffii]
Length=613

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIP  578
            P     P C    SE+TPCQD +RSL+FDR  L YRERHCP+  E L+C +PAP GY+ P
Sbjct  87   PSTAPVPACDMGFSEHTPCQDAKRSLQFDRARLVYRERHCPSDSEKLQCLVPAPVGYKNP  146

Query  579  VRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRL  758
              WP+SRD  W+ANVPHK LTVEKA QNW++++G+RF FPGGGTMFPRGADAYIDDI  +
Sbjct  147  FSWPKSRDYAWFANVPHKELTVEKAIQNWIQYEGDRFFFPGGGTMFPRGADAYIDDINSI  206

Query  759  INLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            + L DG+IRTA+DTGCGVASWGAYLL R I  +SFAP+DTHE QVQFALER IP
Sbjct  207  LPLTDGTIRTALDTGCGVASWGAYLLKRGILTMSFAPRDTHEGQVQFALERGIP  260



>ref|XP_008796868.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
 ref|XP_008796869.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=632

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRI  575
            A   ++F PC    SEYTPCQD  R  +F+R ML YRERHCP KEEL++C IPAP  Y+ 
Sbjct  95   AATVEKFHPCPLNFSEYTPCQDRTRGRRFEREMLIYRERHCPGKEELIRCLIPAPPNYKT  154

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P +WP+SRD  W+ N+PHK L++EKA QNWV  +G+RF FPGGGTMFPRGADAYIDDI  
Sbjct  155  PFKWPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDRFRFPGGGTMFPRGADAYIDDINA  214

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L++L DGSIRTAIDTGCGVAS+GAYLL RD+  +SFAP+DTHEAQVQFALER +P
Sbjct  215  LLSLTDGSIRTAIDTGCGVASFGAYLLKRDVITMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_008375441.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008375442.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=632

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHCP KEE L C IPAP
Sbjct  91   VDINKTEAVQKFPPCDMSYSEYTPCQDATRGRKFDRSMLKYRERHCPTKEEQLLCLIPAP  150

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGT FPRGADAYI
Sbjct  151  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTGFPRGADAYI  210

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            D++  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTH AQVQFALER +P
Sbjct  211  DEMNALIPLTKGNIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVP  270



>ref|XP_008677769.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW63363.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=647

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRI  575
            P    +P C A  SEYTPC+D ERSL+F R  L YRERHCPA E E L+C +PAP GYR 
Sbjct  111  PRRSSYPACPARYSEYTPCEDVERSLRFPRDRLVYRERHCPASERERLRCLVPAPPGYRT  170

Query  576  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  755
            P  WP SRD  W+AN PHK LTVEKA QNW+R  G+R  FPGGGTMFP GADAYIDDI +
Sbjct  171  PFPWPASRDVAWFANAPHKELTVEKAVQNWIRVDGDRLRFPGGGTMFPNGADAYIDDIAK  230

Query  756  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L+ L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  231  LVPLHDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  285



>ref|XP_002977565.1| hypothetical protein SELMODRAFT_443549 [Selaginella moellendorffii]
 gb|EFJ21569.1| hypothetical protein SELMODRAFT_443549 [Selaginella moellendorffii]
Length=634

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  414  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK-EELLKCRIPAPFGYRIPVRWP  590
            F  C  + SEYTPC+D ERSL+FDR  L YRERHCPA+  E L+C IPAP GYR P  WP
Sbjct  97   FDSCALKFSEYTPCEDIERSLRFDRDRLIYRERHCPAQASERLRCLIPAPPGYRNPFPWP  156

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WYANVPHK LTVEKA QNW++++G+RF FPGGGTMFP+GADAYIDDIG+L+ LK
Sbjct  157  KSRDFAWYANVPHKELTVEKAVQNWIQYEGDRFKFPGGGTMFPKGADAYIDDIGKLVPLK  216

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTA+DTGCGVAS+GA+LLSR++  +SFAP+DTHE QVQFALER +P
Sbjct  217  DGSIRTALDTGCGVASFGAFLLSRNVLTMSFAPRDTHEGQVQFALERGVP  266



>ref|XP_010933740.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=632

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             ++F PC    SEYTPCQD  R  +F+R ML YRERHCP K+EL++C IPAP  Y+ P +
Sbjct  98   VEKFQPCALNFSEYTPCQDRTRGRRFEREMLIYRERHCPEKDELIRCLIPAPPNYKTPFK  157

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+SRD  W+ N+PHK L++EKA QNWV  +G+RF FPGGGTMFPRGADAYIDDI  LI+
Sbjct  158  WPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDRFRFPGGGTMFPRGADAYIDDINALIS  217

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVAS+GAYLL RD+  +SFAP+DTHEAQVQFALER +P
Sbjct  218  LTDGSIRTAIDTGCGVASFGAYLLKRDVITMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_002466953.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
 gb|EER93951.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
Length=637

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            ++FP C    SEYTPC+D +R  +FDR ML YRERHCP K+E ++C IPAP GYR P +W
Sbjct  105  QQFPACPLNFSEYTPCEDRKRGRRFDRAMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKW  164

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  ++ N+PHK L++EKA QNW++ +G++F FPGGGTMFPRGADAYIDDI +LI+L
Sbjct  165  PHSRDYAYFNNIPHKELSIEKAVQNWIQVEGDKFKFPGGGTMFPRGADAYIDDIDKLISL  224

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  225  SDGKIRTAVDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVP  275



>gb|EEC73773.1| hypothetical protein OsI_08448 [Oryza sativa Indica Group]
Length=646

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C A  SEYTPC+D +RSL++ R  L YRERHCP   E L+C +PAP GYR P  W
Sbjct  116  RRYQACPARYSEYTPCEDVKRSLRYPRERLVYRERHCPTGRERLRCLVPAPSGYRNPFPW  175

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYIDDIG+LI L
Sbjct  176  PASRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPL  235

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGS+RTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  236  HDGSVRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  286



>ref|XP_010693482.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
             K +P C A  S+YTPC+D  R+LK  +  + + ERHCP K E+LKCR+PAP+GY+ P +
Sbjct  95   TKSYPGCNASYSDYTPCEDPNRALKLKQTRMMHLERHCPTKTEVLKCRVPAPYGYKSPFK  154

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP SRD  WY NVP K LT  KA QNW+RF+G+RF FPGGGTMF  GADAYID+I +LIN
Sbjct  155  WPVSRDYAWYNNVPSKMLTEHKAVQNWIRFEGDRFKFPGGGTMFRFGADAYIDNIAKLIN  214

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DGSIRTAIDTGCGVASWGAYL+SR+I P+SFAP+DTHEAQVQFALER +P
Sbjct  215  LHDGSIRTAIDTGCGVASWGAYLMSRNILPMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_002982140.1| hypothetical protein SELMODRAFT_115825 [Selaginella moellendorffii]
 gb|EFJ16808.1| hypothetical protein SELMODRAFT_115825 [Selaginella moellendorffii]
Length=612

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  399  PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIP  578
            P     P C    SE+TPCQD +RSL+FDR  L YRERHCP   E L+C IPAP GY+ P
Sbjct  87   PSTAPVPACDMGFSEHTPCQDAKRSLQFDRARLVYRERHCPPDSEKLQCLIPAPVGYKNP  146

Query  579  VRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRL  758
              WP+SRD  W+ANVPHK LTVEKA QNW++++G+RF FPGGGTMFPRGADAYIDDI  +
Sbjct  147  FSWPKSRDYAWFANVPHKELTVEKAIQNWIQYEGDRFFFPGGGTMFPRGADAYIDDINSI  206

Query  759  INLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            + L DG+IRTA+DTGCGVASWGAYLL R I  +SFAP+DTHE QVQFALER IP
Sbjct  207  LPLTDGTIRTALDTGCGVASWGAYLLKRGILTMSFAPRDTHEGQVQFALERGIP  260



>ref|NP_001047721.1| Os02g0675700 [Oryza sativa Japonica Group]
 dbj|BAD29526.1| dehydration-responsive family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09635.1| Os02g0675700 [Oryza sativa Japonica Group]
 gb|EEE57564.1| hypothetical protein OsJ_07909 [Oryza sativa Japonica Group]
Length=646

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C A  SEYTPC+D +RSL++ R  L YRERHCP   E L+C +PAP GYR P  W
Sbjct  116  RRYQACPARYSEYTPCEDVKRSLRYPRERLVYRERHCPTGRERLRCLVPAPSGYRNPFPW  175

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYIDDIG+LI L
Sbjct  176  PASRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPL  235

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGS+RTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  236  HDGSVRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  286



>ref|XP_004982638.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Setaria 
italica]
Length=638

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            ++FP C    SEYTPC+D  R  +FDR ML YRERHCP K+E ++C IPAP GYR P +W
Sbjct  105  QQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKW  164

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  ++ N+PHK L++EKA QNW++ +G++F FPGGGTMFPRGADAYIDDI +LI+L
Sbjct  165  PKSRDYAYFNNIPHKELSIEKAVQNWIQVEGDKFRFPGGGTMFPRGADAYIDDINKLISL  224

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  225  SDGQIRTAVDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVP  275



>ref|XP_007160205.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 ref|XP_007160206.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 gb|ESW32199.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 gb|ESW32200.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
Length=627

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + +  +   +EFPPC   LSEYTPCQD +R  ++DR MLKYRERHCP+KEE L C IPAP
Sbjct  85   IDINNSGGTQEFPPCNISLSEYTPCQDRDRGRRYDRNMLKYRERHCPSKEEQLYCLIPAP  144

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYI
Sbjct  145  PKYKPPFKWPQSRDYAWYNNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  204

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  205  DDINELIPLTTGTIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  264



>ref|XP_004982637.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Setaria 
italica]
Length=642

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            ++FP C    SEYTPC+D  R  +FDR ML YRERHCP K+E ++C IPAP GYR P +W
Sbjct  109  QQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKW  168

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P+SRD  ++ N+PHK L++EKA QNW++ +G++F FPGGGTMFPRGADAYIDDI +LI+L
Sbjct  169  PKSRDYAYFNNIPHKELSIEKAVQNWIQVEGDKFRFPGGGTMFPRGADAYIDDINKLISL  228

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DG IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  229  SDGQIRTAVDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVP  279



>ref|XP_008239284.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
 ref|XP_008239285.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
Length=637

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            V + ++   ++FP C    SEYTPCQD +R  KFDR+MLKYRERHCP KEE L C IPAP
Sbjct  96   VDINKSDAVQKFPACDMAYSEYTPCQDPQRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  155

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
              Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFPRGA AYI
Sbjct  156  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGAGAYI  215

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDI  LI L  G+IRTAIDTGCGVASWGAYLL  DI  +SFAP+DTH AQVQFALER +P
Sbjct  216  DDIDALIPLSKGNIRTAIDTGCGVASWGAYLLRNDILAMSFAPRDTHAAQVQFALERGVP  275



>ref|XP_006648932.1| PREDICTED: probable methyltransferase PMT15-like [Oryza brachyantha]
Length=603

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  408  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  587
            + +  C A+ SEYTPC+D +RSL++ R  L YRERHCP + E L+C +PAP GY  P  W
Sbjct  73   RRYQACPAKYSEYTPCEDVKRSLRYPRDRLVYRERHCPTERERLRCLVPAPAGYHNPFPW  132

Query  588  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  767
            P SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFP GADAYIDDIG+LI L
Sbjct  133  PASRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPL  192

Query  768  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  193  HDGSIRTALDTGCGVASWGAYLLSRDIVAMSFAPRDSHEAQVQFALERGVP  243



>ref|XP_006653692.1| PREDICTED: probable methyltransferase PMT15-like, partial [Oryza 
brachyantha]
Length=592

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  381  VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  560
            + VA     + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP++ E L+C +PAP
Sbjct  50   MEVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRERLVYRERHCPSEGERLRCLVPAP  109

Query  561  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  740
             GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R  G+RF FPGGGTMFP GA AYI
Sbjct  110  KGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVDGDRFRFPGGGTMFPHGAGAYI  169

Query  741  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DDIG++I L DGSIRTAIDTG GVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  170  DDIGKIIPLHDGSIRTAIDTGWGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  229



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            EFPPC    S+ TPCQD  RS KFDR M KYRERHCP  EELL+C IPAP  Y+ P +WP
Sbjct  100  EFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPFKWP  159

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGGT FP GADAYID+I  LI L 
Sbjct  160  QSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELIPLT  219

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             G+IRTA+DTGCGVASWGAYLL RDI  +SFA +DTHEAQVQFALER +P
Sbjct  220  GGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEAQVQFALERGVP  269



>ref|XP_006476235.1| PREDICTED: probable methyltransferase PMT18-like [Citrus sinensis]
Length=629

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
            EFPPC    S+ TPCQD  RS KFDR M KYRERHCP  EELL+C IPAP  Y+ P +WP
Sbjct  100  EFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPFKWP  159

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGGT FP GADAYID+I  LI L 
Sbjct  160  QSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELIPLT  219

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
             G+IRTA+DTGCGVASWGAYLL RDI  +SFA +DTHEAQVQFALER +P
Sbjct  220  GGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEAQVQFALERGVP  269



>ref|NP_001056546.2| Os06g0103900 [Oryza sativa Japonica Group]
 dbj|BAD67956.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 gb|EEE64943.1| hypothetical protein OsJ_19817 [Oryza sativa Japonica Group]
 dbj|BAF18460.2| Os06g0103900 [Oryza sativa Japonica Group]
Length=631

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A++FPPC+ + SEYTPCQD  R+ KF + M++YRERHCP KEEL +C IPAP  Y+ P +
Sbjct  97   AEKFPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPKYKNPFK  156

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+ RD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFP GADAYIDDI  LI+
Sbjct  157  WPQCRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDDINALIS  216

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTA+DTGCGVASWGAYL+ R+I  +SFAP+D+HEAQVQFALER +P
Sbjct  217  LTDGNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHEAQVQFALERGVP  268



>gb|EEC79826.1| hypothetical protein OsI_21282 [Oryza sativa Indica Group]
Length=631

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  405  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  584
            A++FPPC+ + SEYTPCQD  R+ KF + M++YRERHCP KEEL +C IPAP  Y+ P +
Sbjct  97   AEKFPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPKYKNPFK  156

Query  585  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  764
            WP+ RD  WY N+PH+ L++EKA QNW++ +G+RF FPGGGTMFP GADAYIDDI  LI+
Sbjct  157  WPQCRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDDINALIS  216

Query  765  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            L DG+IRTA+DTGCGVASWGAYL+ R+I  +SFAP+D+HEAQVQFALER +P
Sbjct  217  LTDGNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHEAQVQFALERGVP  268



>gb|ABR16934.1| unknown [Picea sitchensis]
Length=626

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +3

Query  411  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  590
             F  C  + SEYTPCQD +R+ KFDR  L YRERHCP K+E LKC IPAP GY+ P RWP
Sbjct  93   NFESCDIKYSEYTPCQDPDRARKFDRTKLIYRERHCPDKKEALKCLIPAPPGYKNPFRWP  152

Query  591  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  770
            +SRD  W+ANVPH+ LT+EKA QNW++ + ++F FPGGGTMF RGADAYIDDI +LI L 
Sbjct  153  KSRDYAWFANVPHRELTIEKAVQNWIQVEDDKFRFPGGGTMFTRGADAYIDDIDKLIPLT  212

Query  771  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            DGSIRTAIDTGCGVASWGAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  213  DGSIRTAIDTGCGVASWGAYLLKRNILTMSFAPRDTHEAQVQFALERGVP  262



>ref|XP_004976536.1| PREDICTED: probable methyltransferase PMT15-like [Setaria italica]
Length=640

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +3

Query  396  APPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYR  572
            AP  + +  C  + SEYTPC+D ERSL+F R  L YRERHCP+ + E L+C +PAP GYR
Sbjct  102  APRQRAYDACPVKYSEYTPCEDVERSLRFSRDRLVYRERHCPSSDAERLRCLVPAPRGYR  161

Query  573  IPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIG  752
             P  WP SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGGGTMFPRGA AYIDDIG
Sbjct  162  NPFPWPASRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPRGAGAYIDDIG  221

Query  753  RLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  920
            ++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  222  KIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2172931915458