BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4619

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626852.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  72.8    1e-11   Nicotiana tomentosiformis
ref|XP_009778034.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  71.6    3e-11   Nicotiana sylvestris
ref|XP_009775831.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  63.2    2e-08   Nicotiana sylvestris
ref|XP_009616656.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  63.2    2e-08   Nicotiana tomentosiformis
ref|XP_006344271.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  62.0    4e-08   Solanum tuberosum [potatoes]
ref|XP_004237034.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  61.6    6e-08   Solanum lycopersicum
emb|CDP00309.1|  unnamed protein product                              60.8    9e-08   Coffea canephora [robusta coffee]
gb|AAT40540.1|  kelch repeat-containing F-box family protein, put...  58.5    6e-07   Solanum demissum
ref|XP_006363237.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  56.2    4e-06   Solanum tuberosum [potatoes]
ref|XP_010320676.1|  PREDICTED: F-box/kelch-repeat protein At1g26930  52.4    9e-05   Solanum lycopersicum
ref|XP_011071013.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  51.6    1e-04   Sesamum indicum [beniseed]
ref|XP_011071012.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  51.6    1e-04   Sesamum indicum [beniseed]
ref|XP_011071010.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  51.2    1e-04   Sesamum indicum [beniseed]
ref|XP_009761228.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  49.3    8e-04   Nicotiana sylvestris



>ref|XP_009626852.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
tomentosiformis]
 ref|XP_009626853.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
tomentosiformis]
Length=440

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSWA-CMSFRLDGT----GKRPMEDDEEDELVLRKCPKQSDDSG  570
            ML+DRSCLVSRDY  E +WA CMS+RLD      GKRP+E+DEE E V  K PKQSD   
Sbjct  1    MLKDRSCLVSRDYRTESNWAACMSYRLDRIEVQRGKRPLENDEESEHVQCKLPKQSDAFN  60

Query  571  RVDTAL  588
            RV  AL
Sbjct  61   RVGVAL  66



>ref|XP_009778034.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
sylvestris]
 ref|XP_009778035.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
sylvestris]
Length=441

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW-ACMSFRLDGT----GKRPMEDDEEDELVLRKCPKQSDDSG  570
            MLEDRSCLVSRDY  E +W ACMS+RLD      GKRP+E+DEE E V  K PKQSD   
Sbjct  1    MLEDRSCLVSRDYRTESNWAACMSYRLDRIEVQHGKRPLENDEESEHVQCKLPKQSDAFN  60

Query  571  RVD  579
            RV+
Sbjct  61   RVE  63



>ref|XP_009775831.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
sylvestris]
Length=442

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW-ACMSFRLDGT----GKRPMEDDEEDELVLRKCPKQS  558
            MLEDRSCLV RD+ RE +W ACM++ LD      GKRP+E++ E+E+V RK PK+S
Sbjct  1    MLEDRSCLVPRDFPRESNWAACMNYSLDRIEIQHGKRPLENNHENEVVQRKLPKRS  56



>ref|XP_009616656.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
tomentosiformis]
 ref|XP_009616657.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
tomentosiformis]
Length=442

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW-ACMSFRLDGT----GKRPMEDDEEDELVLRKCPKQS  558
            MLEDRSCLV RD+ RE +W ACM++ LD      GKRP+E++ E+E+V RK PK+S
Sbjct  1    MLEDRSCLVPRDFPRESNWAACMNYSLDRIEVQHGKRPLENNHENEVVQRKLPKRS  56



>ref|XP_006344271.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Solanum tuberosum]
Length=433

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 6/58 (10%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRE-RSW-ACMSFRLDGT----GKRPMEDDEEDELVLRKCPKQSD  561
            MLEDRSCLV RD+ RE  +W ACM++ LD      GKRP+E+++EDE+V RK PK SD
Sbjct  1    MLEDRSCLVPRDFTRESNNWSACMNYSLDMIEVQHGKRPLENNQEDEVVQRKLPKLSD  58



>ref|XP_004237034.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Solanum lycopersicum]
Length=433

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 6/58 (10%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERS-W-ACMSFRLD----GTGKRPMEDDEEDELVLRKCPKQSD  561
            MLEDRSCLV RD+ RE + W AC+++ LD      GKRP+E+++EDE+V RK PK SD
Sbjct  1    MLEDRSCLVPRDFSRENNNWSACINYSLDMIEVQNGKRPLENNQEDEVVQRKLPKLSD  58



>emb|CDP00309.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHR----ERSWACMSFR--LDGT-GKRPMEDDEEDELVLRKCPKQSDD  564
            MLEDRSCLVSRDY R    E SWA M  R  +D   GKRP+E+D ++ELV  K PKQSD 
Sbjct  1    MLEDRSCLVSRDYPRTCDQEGSWARMYRREKIDILRGKRPLENDGQEELVATKVPKQSDA  60

Query  565  SGRVDTAL  588
               ++TAL
Sbjct  61   DKSLETAL  68



>gb|AAT40540.1| kelch repeat-containing F-box family protein, putative [Solanum 
demissum]
Length=513

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = +1

Query  382  FLVVDPDDMLEDRSCLVSRDYHRERSW-ACMSFRLD----GTGKRPMEDDEEDELVLRKC  546
             L  + +DMLEDR+CLV RD   E +W  CMS+ +D      GKRP+E+DEE E V  K 
Sbjct  26   ILGFNLEDMLEDRTCLVQRDCRTESNWTGCMSYHIDRIDAQNGKRPLENDEEGENVQCKL  85

Query  547  PKQSDDS  567
             KQSD S
Sbjct  86   QKQSDGS  92



>ref|XP_006363237.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Solanum tuberosum]
Length=480

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW-ACMSFRLD----GTGKRPMEDDEEDELVLRKCPKQSDDS  567
            MLEDR+CLV RD   E +W  CMS+ +D      GKRP+E+DEE E V  K  KQSD S
Sbjct  1    MLEDRTCLVQRDCRTESNWTGCMSYHIDRIDAQNGKRPLENDEEGENVQCKLQKQSDGS  59



>ref|XP_010320676.1| PREDICTED: F-box/kelch-repeat protein At1g26930 [Solanum lycopersicum]
Length=673

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW--ACMSFRLD----GTGKRPMEDDEEDELVLRKCPKQSDDS  567
            MLEDR+C+V RD   E +W   CMS+ +D      GKRP+E+DEE   V  K  KQSD S
Sbjct  1    MLEDRTCMVQRDCLTENNWTTGCMSYHIDRIDAQNGKRPLENDEEGVNVQCKLQKQSDGS  60



>ref|XP_011071013.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform X3 
[Sesamum indicum]
Length=351

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 11/70 (16%)
 Frame = +1

Query  406  MLEDRSCLVSRDYH----RERSWACMSFRLDGT----GKRPMED-DEEDELVLRKCPKQS  558
            MLEDR+CLVSRDY     RE +W CM++RL+ +     KR +E+ +  +E+++RK  K+S
Sbjct  1    MLEDRACLVSRDYSRTCDREGNWPCMNYRLEKSEVQQSKRRLEETNGGEEVIVRKVSKRS  60

Query  559  DDSGRVDTAL  588
             +  ++DTAL
Sbjct  61   GN--QIDTAL  68



>ref|XP_011071012.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform X2 
[Sesamum indicum]
Length=397

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 11/70 (16%)
 Frame = +1

Query  406  MLEDRSCLVSRDYH----RERSWACMSFRLDGT----GKRPMED-DEEDELVLRKCPKQS  558
            MLEDR+CLVSRDY     RE +W CM++RL+ +     KR +E+ +  +E+++RK  K+S
Sbjct  1    MLEDRACLVSRDYSRTCDREGNWPCMNYRLEKSEVQQSKRRLEETNGGEEVIVRKVSKRS  60

Query  559  DDSGRVDTAL  588
             +  ++DTAL
Sbjct  61   GN--QIDTAL  68



>ref|XP_011071010.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform X1 
[Sesamum indicum]
 ref|XP_011071011.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like isoform X1 
[Sesamum indicum]
Length=448

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 11/70 (16%)
 Frame = +1

Query  406  MLEDRSCLVSRDYH----RERSWACMSFRLDGT----GKRPMED-DEEDELVLRKCPKQS  558
            MLEDR+CLVSRDY     RE +W CM++RL+ +     KR +E+ +  +E+++RK  K+S
Sbjct  1    MLEDRACLVSRDYSRTCDREGNWPCMNYRLEKSEVQQSKRRLEETNGGEEVIVRKVSKRS  60

Query  559  DDSGRVDTAL  588
             +  ++DTAL
Sbjct  61   GN--QIDTAL  68



>ref|XP_009761228.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Nicotiana 
sylvestris]
Length=425

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 7/62 (11%)
 Frame = +1

Query  406  MLEDRSCLVSRDYHRERSW-ACMSFRLDGTGKRPMEDDEEDELVLRKCPKQSDDSGRVDT  582
            MLED+SCLVS+D  RE +  ACM+      GK P+ + +E ELV RK P +SD   +V+ 
Sbjct  1    MLEDQSCLVSKDCQRESNLVACMN------GKEPLVNYQERELVKRKLPNKSDAFNKVEV  54

Query  583  AL  588
             L
Sbjct  55   TL  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 780375366650