BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4612

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774096.1|  PREDICTED: upstream activation factor subuni...    109   3e-25   Nicotiana sylvestris
ref|XP_009774097.1|  PREDICTED: upstream activation factor subuni...    108   5e-25   Nicotiana sylvestris
ref|XP_009774095.1|  PREDICTED: upstream activation factor subuni...    108   6e-25   Nicotiana sylvestris
ref|XP_009629952.1|  PREDICTED: upstream activation factor subuni...    104   2e-23   Nicotiana tomentosiformis
ref|XP_009629953.1|  PREDICTED: upstream activation factor subuni...    103   3e-23   Nicotiana tomentosiformis
ref|XP_009629951.1|  PREDICTED: upstream activation factor subuni...    103   4e-23   Nicotiana tomentosiformis
ref|XP_006346439.1|  PREDICTED: upstream activation factor subuni...    103   5e-23   Solanum tuberosum [potatoes]
ref|XP_006346438.1|  PREDICTED: upstream activation factor subuni...    102   1e-22   Solanum tuberosum [potatoes]
gb|EYU37715.1|  hypothetical protein MIMGU_mgv1a011940mg              99.4    8e-22   Erythranthe guttata [common monkey flower]
ref|XP_008457882.1|  PREDICTED: upstream activation factor subuni...  94.7    6e-20   Cucumis melo [Oriental melon]
ref|XP_010315240.1|  PREDICTED: upstream activation factor subuni...  94.4    7e-20   Solanum lycopersicum
ref|XP_004148436.1|  PREDICTED: upstream activation factor subuni...  94.4    7e-20   Cucumis sativus [cucumbers]
ref|XP_004230795.1|  PREDICTED: upstream activation factor subuni...  94.4    7e-20   
ref|XP_007042350.1|  SWIB complex BAF60b domain-containing protei...  94.0    3e-19   Theobroma cacao [chocolate]
ref|XP_012079173.1|  PREDICTED: upstream activation factor subuni...  91.7    6e-19   Jatropha curcas
ref|XP_003517282.1|  PREDICTED: upstream activation factor subuni...  90.1    2e-18   Glycine max [soybeans]
ref|XP_006425831.1|  hypothetical protein CICLE_v10026010mg           90.1    3e-18   Citrus clementina [clementine]
ref|XP_002313088.2|  hypothetical protein POPTR_0009s10990g           87.0    2e-17   
gb|KHG25549.1|  Upstream activation factor subunit spp27              89.4    2e-17   Gossypium arboreum [tree cotton]
gb|EPS57960.1|  hypothetical protein M569_16857                       84.0    1e-16   Genlisea aurea
gb|KJB32414.1|  hypothetical protein B456_005G239900                  87.0    1e-16   Gossypium raimondii
gb|KJB32416.1|  hypothetical protein B456_005G239900                  87.0    1e-16   Gossypium raimondii
ref|XP_011009270.1|  PREDICTED: protein TRI1-like                     84.7    1e-16   Populus euphratica
ref|XP_002891515.1|  SWIB complex BAF60b domain-containing protein    84.7    3e-16   
ref|XP_002522329.1|  Upstream activation factor subunit UAF30, pu...  84.0    3e-16   Ricinus communis
gb|KJB43614.1|  hypothetical protein B456_007G210300                  82.0    8e-16   Gossypium raimondii
ref|NP_175375.2|  SWIB complex BAF60b domain-containing protein       83.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAD43149.1|AC007504_4  Hypothetical Protein                        83.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KJB43608.1|  hypothetical protein B456_007G210300                  82.0    2e-15   Gossypium raimondii
gb|KJB43609.1|  hypothetical protein B456_007G210300                  82.0    2e-15   Gossypium raimondii
gb|KJB43610.1|  hypothetical protein B456_007G210300                  81.6    2e-15   Gossypium raimondii
ref|XP_010941848.1|  PREDICTED: upstream activation factor subuni...  81.6    2e-15   
ref|XP_010941845.1|  PREDICTED: upstream activation factor subuni...  81.6    2e-15   Elaeis guineensis
ref|XP_010941846.1|  PREDICTED: upstream activation factor subuni...  81.6    2e-15   Elaeis guineensis
ref|XP_006303686.1|  hypothetical protein CARUB_v10011771mg           82.0    2e-15   Capsella rubella
ref|XP_010028508.1|  PREDICTED: DNA ligase 1                          83.2    3e-15   Eucalyptus grandis [rose gum]
gb|KHG26278.1|  Upstream activation factor subunit spp27              81.3    3e-15   Gossypium arboreum [tree cotton]
ref|XP_006384456.1|  SWIB complex BAF60b domain-containing family...  81.6    4e-15   
ref|XP_010905630.1|  PREDICTED: upstream activation factor subuni...  80.5    5e-15   Elaeis guineensis
ref|XP_010905631.1|  PREDICTED: upstream activation factor subuni...  80.5    5e-15   Elaeis guineensis
ref|XP_003537360.1|  PREDICTED: upstream activation factor subuni...  80.9    6e-15   Glycine max [soybeans]
ref|XP_010096161.1|  Upstream activation factor subunit spp27         81.6    7e-15   Morus notabilis
emb|CDO97141.1|  unnamed protein product                              82.0    8e-15   Coffea canephora [robusta coffee]
ref|XP_009375740.1|  PREDICTED: upstream activation factor subuni...  80.5    8e-15   Pyrus x bretschneideri [bai li]
ref|XP_009375738.1|  PREDICTED: upstream activation factor subuni...  80.5    8e-15   Pyrus x bretschneideri [bai li]
ref|XP_009375739.1|  PREDICTED: upstream activation factor subuni...  80.5    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_009375737.1|  PREDICTED: upstream activation factor subuni...  80.5    9e-15   Pyrus x bretschneideri [bai li]
gb|KFK39235.1|  hypothetical protein AALP_AA3G218000                  81.3    9e-15   Arabis alpina [alpine rockcress]
ref|XP_007156836.1|  hypothetical protein PHAVU_002G021500g           79.7    1e-14   Phaseolus vulgaris [French bean]
ref|XP_007156837.1|  hypothetical protein PHAVU_002G021500g           79.7    1e-14   Phaseolus vulgaris [French bean]
gb|KDO49158.1|  hypothetical protein CISIN_1g0161771mg                79.0    1e-14   Citrus sinensis [apfelsine]
ref|XP_008236632.1|  PREDICTED: upstream activation factor subuni...  79.7    2e-14   Prunus mume [ume]
ref|XP_012072456.1|  PREDICTED: DNA ligase 1 isoform X4               80.9    2e-14   
ref|XP_008236631.1|  PREDICTED: upstream activation factor subuni...  79.7    2e-14   Prunus mume [ume]
ref|XP_012072453.1|  PREDICTED: DNA ligase 1 isoform X1               80.9    2e-14   
ref|XP_012072454.1|  PREDICTED: DNA ligase 1 isoform X2               80.9    2e-14   Jatropha curcas
emb|CDP02467.1|  unnamed protein product                              79.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_012072455.1|  PREDICTED: DNA ligase 1 isoform X3               80.5    2e-14   Jatropha curcas
ref|XP_007199917.1|  hypothetical protein PRUPE_ppa007326mg           79.3    2e-14   
ref|XP_006406538.1|  hypothetical protein EUTSA_v10020944mg           79.3    3e-14   
ref|XP_010500494.1|  PREDICTED: upstream activation factor subuni...  79.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002306454.2|  hypothetical protein POPTR_0005s14110g           77.8    5e-14   
ref|XP_010263744.1|  PREDICTED: upstream activation factor subuni...  77.8    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010263742.1|  PREDICTED: upstream activation factor subuni...  78.2    5e-14   
ref|XP_006480142.1|  PREDICTED: upstream activation factor subuni...  78.2    6e-14   Citrus sinensis [apfelsine]
emb|CBI23284.3|  unnamed protein product                              77.0    7e-14   Vitis vinifera
ref|XP_006480141.1|  PREDICTED: upstream activation factor subuni...  78.2    8e-14   
emb|CDX99270.1|  BnaC05g33850D                                        78.6    1e-13   
emb|CAN83123.1|  hypothetical protein VITISV_044372                   77.0    1e-13   Vitis vinifera
ref|XP_010652654.1|  PREDICTED: upstream activation factor subuni...  77.0    1e-13   Vitis vinifera
ref|XP_010263746.1|  PREDICTED: upstream activation factor subuni...  76.6    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009345973.1|  PREDICTED: upstream activation factor subuni...  77.0    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_010263743.1|  PREDICTED: upstream activation factor subuni...  77.0    1e-13   
ref|XP_008792695.1|  PREDICTED: upstream activation factor subuni...  76.3    2e-13   
ref|XP_009345971.1|  PREDICTED: upstream activation factor subuni...  77.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_010255131.1|  PREDICTED: upstream activation factor subuni...  76.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009345972.1|  PREDICTED: upstream activation factor subuni...  77.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008792693.1|  PREDICTED: upstream activation factor subuni...  76.3    2e-13   
ref|XP_006423075.1|  hypothetical protein CICLE_v10028659mg           76.6    2e-13   
ref|XP_002521839.1|  brg-1 associated factor, putative                77.4    3e-13   
gb|KDO79320.1|  hypothetical protein CISIN_1g0196441mg                72.8    4e-13   Citrus sinensis [apfelsine]
ref|NP_001148210.1|  SWIB/MDM2 domain containing protein              75.5    4e-13   
ref|XP_010999905.1|  PREDICTED: upstream activation factor subuni...  76.3    4e-13   Populus euphratica
ref|XP_009345974.1|  PREDICTED: ABC transporter F family member 4     76.6    4e-13   
ref|XP_010999870.1|  PREDICTED: upstream activation factor subuni...  76.3    5e-13   Populus euphratica
ref|XP_010999877.1|  PREDICTED: upstream activation factor subuni...  75.9    5e-13   Populus euphratica
ref|XP_010999856.1|  PREDICTED: uncharacterized protein PFB0145c-...  76.3    5e-13   Populus euphratica
ref|XP_010999862.1|  PREDICTED: upstream activation factor subuni...  76.3    5e-13   Populus euphratica
ref|XP_010999846.1|  PREDICTED: uncharacterized protein PFB0145c-...  76.3    5e-13   Populus euphratica
ref|XP_011001190.1|  PREDICTED: upstream activation factor subuni...  75.9    6e-13   Populus euphratica
ref|XP_011001192.1|  PREDICTED: protein TRI1-like isoform X2          75.5    6e-13   Populus euphratica
ref|XP_006393249.1|  hypothetical protein EUTSA_v10011568mg           75.5    6e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010461790.1|  PREDICTED: upstream activation factor subuni...  75.5    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011001193.1|  PREDICTED: upstream activation factor subuni...  75.1    6e-13   Populus euphratica
ref|XP_010461791.1|  PREDICTED: upstream activation factor subuni...  75.5    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011458333.1|  PREDICTED: upstream activation factor subuni...  75.5    7e-13   Fragaria vesca subsp. vesca
ref|XP_004290311.1|  PREDICTED: upstream activation factor subuni...  75.5    7e-13   Fragaria vesca subsp. vesca
gb|AFW67527.1|  hypothetical protein ZEAMMB73_352797                  74.3    8e-13   
ref|XP_011458331.1|  PREDICTED: upstream activation factor subuni...  75.1    8e-13   Fragaria vesca subsp. vesca
ref|XP_011458329.1|  PREDICTED: upstream activation factor subuni...  75.1    8e-13   Fragaria vesca subsp. vesca
ref|XP_007047161.1|  SWIB complex BAF60b domain-containing protei...  73.6    9e-13   
ref|NP_001147426.1|  LOC100281035                                     74.3    9e-13   Zea mays [maize]
ref|XP_010479386.1|  PREDICTED: protein TRI1-like isoform X2          74.7    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010479385.1|  PREDICTED: upstream activation factor subuni...  74.7    1e-12   Camelina sativa [gold-of-pleasure]
gb|ERN14421.1|  hypothetical protein AMTR_s00033p00241730             73.6    1e-12   Amborella trichopoda
ref|XP_008792594.1|  PREDICTED: upstream activation factor subuni...  72.8    1e-12   Phoenix dactylifera
ref|XP_008792593.1|  PREDICTED: upstream activation factor subuni...  72.8    2e-12   Phoenix dactylifera
ref|XP_007047160.1|  SWIB complex BAF60b domain-containing protei...  73.6    2e-12   
ref|XP_011458335.1|  PREDICTED: upstream activation factor subuni...  73.9    2e-12   Fragaria vesca subsp. vesca
ref|XP_011626436.1|  PREDICTED: upstream activation factor subuni...  72.8    2e-12   Amborella trichopoda
ref|XP_008792591.1|  PREDICTED: upstream activation factor subuni...  73.2    3e-12   Phoenix dactylifera
ref|XP_008792590.1|  PREDICTED: upstream activation factor subuni...  72.8    3e-12   Phoenix dactylifera
gb|AES94759.2|  upstream activation factor subunit UAF30, putative    72.4    5e-12   Medicago truncatula
ref|XP_002883161.1|  SWIB complex BAF60b domain-containing protein    73.2    6e-12   
ref|XP_010419877.1|  PREDICTED: uncharacterized protein LOC104705555  73.6    6e-12   
ref|XP_004511971.1|  PREDICTED: upstream activation factor subuni...  72.4    6e-12   Cicer arietinum [garbanzo]
ref|XP_003611801.1|  Upstream activation factor subunit spp27         72.0    8e-12   
ref|XP_010317157.1|  PREDICTED: LOW QUALITY PROTEIN: upstream act...  71.2    1e-11   
ref|XP_010536330.1|  PREDICTED: synaptonemal complex protein 1 is...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010536329.1|  PREDICTED: calponin homology domain-containi...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010536328.1|  PREDICTED: golgin subfamily A member 6-like ...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010536327.1|  PREDICTED: golgin subfamily A member 6-like ...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010536324.1|  PREDICTED: golgin subfamily A member 6-like ...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|NP_188538.1|  SWIB complex BAF60b domain-containing protein       71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA51565.1|  TPA: hypothetical protein ZEAMMB73_913346            69.7    2e-11   
ref|XP_010229398.1|  PREDICTED: upstream activation factor subuni...  70.1    2e-11   
ref|XP_004981658.1|  PREDICTED: upstream activation factor subuni...  70.5    2e-11   Setaria italica
gb|AGT16808.1|  SWIB/MDM2 domain containing protein                   70.1    3e-11   Saccharum hybrid cultivar R570
ref|XP_002466401.1|  hypothetical protein SORBIDRAFT_01g007140        70.1    3e-11   Sorghum bicolor [broomcorn]
gb|AGT16365.1|  SWIB/MDM2 domain containing protein                   70.1    3e-11   Saccharum hybrid cultivar R570
ref|XP_003558997.1|  PREDICTED: upstream activation factor subuni...  70.1    4e-11   Brachypodium distachyon [annual false brome]
ref|XP_010489932.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.5    5e-11   
ref|XP_009587440.1|  PREDICTED: upstream activation factor subuni...  69.7    5e-11   Nicotiana tomentosiformis
gb|EYU44365.1|  hypothetical protein MIMGU_mgv1a025674mg              68.6    1e-10   Erythranthe guttata [common monkey flower]
dbj|BAB01706.1|  unnamed protein product                              69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650641.1|  PREDICTED: upstream activation factor subuni...  68.6    1e-10   Oryza brachyantha
ref|XP_006297542.1|  hypothetical protein CARUB_v10013568mg           69.3    1e-10   
gb|AAL34119.1|AC090713_6  putative parathymosin                       68.2    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099216.1|  PREDICTED: upstream activation factor subuni...  68.2    1e-10   Sesamum indicum [beniseed]
ref|XP_011099215.1|  PREDICTED: upstream activation factor subuni...  68.2    1e-10   Sesamum indicum [beniseed]
gb|ABF99032.1|  SWIB complex BAF60b domain-containing protein, pu...  67.8    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ85465.1|  unknown                                               67.4    2e-10   Medicago truncatula
gb|ABK24867.1|  unknown                                               67.0    3e-10   Picea sitchensis
ref|XP_009803137.1|  PREDICTED: protein TRI1-like isoform X2          67.4    3e-10   Nicotiana sylvestris
ref|XP_009803136.1|  PREDICTED: upstream activation factor subuni...  67.0    4e-10   Nicotiana sylvestris
gb|EMS67367.1|  Upstream activation factor subunit spp27              67.4    5e-10   Triticum urartu
gb|KFK36005.1|  hypothetical protein AALP_AA4G065400                  67.0    5e-10   Arabis alpina [alpine rockcress]
gb|KFK36004.1|  hypothetical protein AALP_AA4G065400                  67.0    5e-10   Arabis alpina [alpine rockcress]
ref|XP_009397729.1|  PREDICTED: upstream activation factor subuni...  66.2    8e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92300.1|  BnaA05g21070D                                        66.6    8e-10   
ref|XP_010691015.1|  PREDICTED: upstream activation factor subuni...  61.6    3e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK26533.1|  unknown                                               61.6    3e-08   Picea sitchensis
ref|XP_010691016.1|  PREDICTED: upstream activation factor subuni...  61.6    3e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN36203.1|  Upstream activation factor subunit spp27              61.2    5e-08   Glycine soja [wild soybean]
ref|XP_001768652.1|  predicted protein                                60.5    6e-08   
ref|XP_002508564.1|  animal specific-mbd4, 5 and 6                    52.8    2e-05   Micromonas commoda
ref|XP_002979488.1|  hypothetical protein SELMODRAFT_419232           50.8    1e-04   Selaginella moellendorffii
ref|XP_002977839.1|  hypothetical protein SELMODRAFT_176439           50.4    2e-04   Selaginella moellendorffii
ref|XP_010680445.1|  PREDICTED: uncharacterized protein LOC104895589  50.1    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002985006.1|  hypothetical protein SELMODRAFT_121478           50.1    3e-04   



>ref|XP_009774096.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana sylvestris]
Length=327

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 18/145 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR+LEE+ GV L DRKAFIRDQIDLFL+THV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRKLEEEFGVDLNDRKAFIRDQIDLFLRTHVE  60

Query  272  VTPQNN-KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAK  448
             TP ++ +      ++ENVK+E+N++  SQ+E               E +TD  + +KA+
Sbjct  61   ETPNDDVQEVEQEQETENVKEEENDDSCSQEE---------------ENETDTGAKEKAR  105

Query  449  SNTKEKDDKKRGKGFNKPCALSPQL  523
            S     + KK+G GFNKPCALSPQL
Sbjct  106  SEKMNGEAKKKG-GFNKPCALSPQL  129



>ref|XP_009774097.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana sylvestris]
Length=320

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 97/145 (67%), Gaps = 17/145 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR+LEE+ GV L DRKAFIRDQIDLFL+THV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRKLEEEFGVDLNDRKAFIRDQIDLFLRTHVE  60

Query  272  VTPQNN-KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAK  448
             TP ++ +      ++ENVK+E+N++  SQ+E               E +TD  + +KA+
Sbjct  61   ETPNDDVQEVEQEQETENVKEEENDDSCSQEE---------------ENETDTGAKEKAR  105

Query  449  SNTKEKDDKKRGKGFNKPCALSPQL  523
             + K   + K+  GFNKPCALSPQL
Sbjct  106  RSEKMNGEAKKKGGFNKPCALSPQL  130



>ref|XP_009774095.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana sylvestris]
Length=328

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 97/145 (67%), Gaps = 17/145 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR+LEE+ GV L DRKAFIRDQIDLFL+THV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRKLEEEFGVDLNDRKAFIRDQIDLFLRTHVE  60

Query  272  VTPQNN-KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAK  448
             TP ++ +      ++ENVK+E+N++  SQ+E               E +TD  + +KA+
Sbjct  61   ETPNDDVQEVEQEQETENVKEEENDDSCSQEE---------------ENETDTGAKEKAR  105

Query  449  SNTKEKDDKKRGKGFNKPCALSPQL  523
             + K   + K+  GFNKPCALSPQL
Sbjct  106  RSEKMNGEAKKKGGFNKPCALSPQL  130



>ref|XP_009629952.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana tomentosiformis]
Length=328

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 19/146 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR LEE+ GV L DRKAFIRDQIDLFL+ HV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRNLEEEFGVDLNDRKAFIRDQIDLFLRIHVE  60

Query  272  VTPQNN--KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             TP ++  +V+    ++ENVK+E+N++  SQ+E               E ++D  + +K+
Sbjct  61   ETPNDDVQEVEEEEQETENVKEEENDDSCSQEE---------------ENESDTGTKEKS  105

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +S     + KK+G GFNKPCALSPQL
Sbjct  106  QSEKMNGEAKKKG-GFNKPCALSPQL  130



>ref|XP_009629953.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana tomentosiformis]
Length=321

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 97/149 (65%), Gaps = 24/149 (16%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR LEE+ GV L DRKAFIRDQIDLFL+ HV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRNLEEEFGVDLNDRKAFIRDQIDLFLRIHVE  60

Query  272  VTPQNN--KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             TP ++  +V+    ++ENVK+E+N++  SQ+E                 + +  +  K 
Sbjct  61   ETPNDDVQEVEEEEQETENVKEEENDDSCSQEE-----------------ENESDTGTKE  103

Query  446  KSNTKEK---DDKKRGKGFNKPCALSPQL  523
            KS+  EK   + KK+G GFNKPCALSPQL
Sbjct  104  KSHRSEKMNGEAKKKG-GFNKPCALSPQL  131



>ref|XP_009629951.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana tomentosiformis]
Length=329

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 97/149 (65%), Gaps = 24/149 (16%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDS LV RL +IL+ ++LET TA SVRR LEE+ GV L DRKAFIRDQIDLFL+ HV 
Sbjct  1    MVSDSVLVDRLREILKVSDLETTTAGSVRRNLEEEFGVDLNDRKAFIRDQIDLFLRIHVE  60

Query  272  VTPQNN--KVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             TP ++  +V+    ++ENVK+E+N++  SQ+E                 + +  +  K 
Sbjct  61   ETPNDDVQEVEEEEQETENVKEEENDDSCSQEE-----------------ENESDTGTKE  103

Query  446  KSNTKEK---DDKKRGKGFNKPCALSPQL  523
            KS+  EK   + KK+G GFNKPCALSPQL
Sbjct  104  KSHRSEKMNGEAKKKG-GFNKPCALSPQL  131



>ref|XP_006346439.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum tuberosum]
Length=335

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS LV RL +ILR ++LE ATA +VRRRLEE+LGV LLDRK FIRDQIDLFL+  V 
Sbjct  1    MVSDSVLVDRLREILRVSDLEIATAGTVRRRLEEELGVDLLDRKVFIRDQIDLFLRIQVE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeei-------ddqdekeeedtdekS  433
                N V     ++EN K+ +N++  SQ+E   ++ +          ++E  E+ +  +S
Sbjct  61   ETPKNDVH----EAENGKEGENDDSCSQEEQEEEQVKEDENGDSCSQEEEVGEDKSATRS  116

Query  434  TQKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
             +KA+S     + KK+G GFNKPCALSPQL
Sbjct  117  KKKARSEKMNGEAKKKG-GFNKPCALSPQL  145



>ref|XP_006346438.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum tuberosum]
Length=336

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS LV RL +ILR ++LE ATA +VRRRLEE+LGV LLDRK FIRDQIDLFL+  V 
Sbjct  1    MVSDSVLVDRLREILRVSDLEIATAGTVRRRLEEELGVDLLDRKVFIRDQIDLFLRIQVE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeei-------ddqdekeeedtdekS  433
                N V     ++EN K+ +N++  SQ+E   ++ +          ++E  E+ +  +S
Sbjct  61   ETPKNDVH----EAENGKEGENDDSCSQEEQEEEQVKEDENGDSCSQEEEVGEDKSATRS  116

Query  434  TQKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
             +KA+ + K   + K+  GFNKPCALSPQL
Sbjct  117  KKKARRSEKMNGEAKKKGGFNKPCALSPQL  146



>gb|EYU37715.1| hypothetical protein MIMGU_mgv1a011940mg [Erythranthe guttata]
Length=266

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSE+VGRL +ILR ++LET TAA VRRRLEE+  V L  R+ FIR+QIDLFL+    
Sbjct  1    MVSDSEIVGRLHEILRASDLETTTAACVRRRLEEEFSVNLYGRRVFIREQIDLFLRD-AA  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              QN+ V++  +  EN + +  E    QKE T  +E  ++++  +EED DE S +K    
Sbjct  60   AAQNDVVEQVEEVGENPQNDAVEKEQGQKENTGADENGEEEEASDEEDEDEVSKRKQSRV  119

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            T   D KK+G GF KPCALSPQL
Sbjct  120  T---DVKKKGGGFCKPCALSPQL  139



>ref|XP_008457882.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
melo]
Length=332

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 17/144 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+GRL D LR+++L T T A VRR+LEE  G+ L D+K FIR+Q+DLFLQT   
Sbjct  1    MVSDSELIGRLRDFLRNSDLNTTTTAIVRRKLEEDFGIDLSDKKRFIREQVDLFLQTE--  58

Query  275  TPQNNKVQRGPDDSENVKQEK-NENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
                  V+ G    E V+QE  +ENL  + E     +  D  ++ E+++  + S+ KA  
Sbjct  59   --HEKAVEEGYGHCEEVEQEDGDENLKMETEDG---DSEDGDNDDEDDEKGKTSSDKA--  111

Query  452  NTKEKDDKKRGKGFNKPCALSPQL  523
                   KKRG GF+K C+LSPQL
Sbjct  112  -------KKRGGGFSKLCSLSPQL  128



>ref|XP_010315240.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum lycopersicum]
Length=331

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 87/143 (61%), Gaps = 0/143 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS LV RL +ILR ++L+ ATA +VRRRLEE+ GV LLDRKAFIRDQIDLFL+  V 
Sbjct  1    MVSDSVLVDRLREILRVSDLDIATAGTVRRRLEEEFGVDLLDRKAFIRDQIDLFLRNQVE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                N V    ++ E    +     + Q+    +  +   Q+E+E ED   K  +K   +
Sbjct  61   ETSKNDVHEEENEKEGENDDSCSQEEEQESKEDENGDSCSQEEEEGEDDSAKRAKKKPRS  120

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K   + K+  GFNKPCALSPQL
Sbjct  121  EKMNGEAKKKGGFNKPCALSPQL  143



>ref|XP_004148436.1| PREDICTED: upstream activation factor subunit UAF30 [Cucumis 
sativus]
 gb|KGN62068.1| hypothetical protein Csa_2G295440 [Cucumis sativus]
Length=332

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 81/144 (56%), Gaps = 17/144 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL D LR+++L T T A VRR+LEE  G+ L D+K FIR+Q+DLFLQT   
Sbjct  1    MVSDSELISRLRDFLRNSDLNTTTTAIVRRKLEEDFGIDLSDKKLFIREQVDLFLQTE--  58

Query  275  TPQNNKVQRGPDDSENVKQEK-NENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
                  VQ G    E V QE  +ENL  + E            + + ED D  +    K 
Sbjct  59   --HEKAVQEGYAHCEEVHQEDGDENLKMETE------------DGDSEDGDNDNEDDEKG  104

Query  452  NTKEKDDKKRGKGFNKPCALSPQL  523
             T  +  KKRG GF K C+LSPQL
Sbjct  105  KTSSEKVKKRGGGFTKLCSLSPQL  128



>ref|XP_004230795.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum lycopersicum]
Length=333

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 87/143 (61%), Gaps = 0/143 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS LV RL +ILR ++L+ ATA +VRRRLEE+ GV LLDRKAFIRDQIDLFL+  V 
Sbjct  1    MVSDSVLVDRLREILRVSDLDIATAGTVRRRLEEEFGVDLLDRKAFIRDQIDLFLRNQVE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                N V    ++ E    +     + Q+    +  +   Q+E+E ED   K  +K   +
Sbjct  61   ETSKNDVHEEENEKEGENDDSCSQEEEQESKEDENGDSCSQEEEEGEDDSAKRAKKKPRS  120

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K   + K+  GFNKPCALSPQL
Sbjct  121  EKMNGEAKKKGGFNKPCALSPQL  143



>ref|XP_007042350.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
 gb|EOX98181.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
Length=472

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 22/143 (15%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILRD++L+TATA SVRR+LE+  GV L DRK F+RDQID+FL+T  +
Sbjct  1    MVSDSDLVTRLREILRDSDLDTATAGSVRRQLEKDFGVDLSDRKGFVRDQIDIFLET--L  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +N K ++GP +SEN K E++++ + + +G                     S +  + +
Sbjct  59   NQENEKEEQGP-ESENAKIEEDDDEEEESKGE-------------------GSEKPRRGS  98

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
              +K  KKRG GF K C+LSPQL
Sbjct  99   KVDKPVKKRGGGFQKVCSLSPQL  121



>ref|XP_012079173.1| PREDICTED: upstream activation factor subunit spp27-like [Jatropha 
curcas]
 gb|KDP31884.1| hypothetical protein JCGZ_12345 [Jatropha curcas]
Length=334

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 94/148 (64%), Gaps = 9/148 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+GRL + LR+++L+T T   VRR+LEE   + L D+KAFIR+Q+DLFLQ+   
Sbjct  1    MVSDSELIGRLREFLRNSDLDTTTTGIVRRQLEEDFSIDLSDKKAFIREQVDLFLQSQFE  60

Query  275  TPQNNKVQRGP-----DDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQ  439
                N+ + G      D + NVK E+ E  DS++EG       D+++E+E   ++ K+  
Sbjct  61   EQSENEEEGGEGGGEDDQAANVKSEETEASDSREEGDG----NDEEEEEEATASNGKNKA  116

Query  440  KAKSNTKEKDDKKRGKGFNKPCALSPQL  523
              +SNT   + KKRG GF+K C LSPQL
Sbjct  117  NRRSNTHNNEGKKRGGGFSKLCNLSPQL  144



>ref|XP_003517282.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
1 [Glycine max]
Length=337

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 9/149 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+SEL+GRL + LR ++L T T A+VRR+LE   G+ L DRKAFIR+Q+DLFLQT   
Sbjct  1    MVSESELIGRLREFLRSSDLNTTTTATVRRQLEADFGIDLSDRKAFIREQVDLFLQTEHN  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ    +R  DD E  ++E   N   Q + +  +EE D+++E EEE+   +  + AK N
Sbjct  61   QPQQE--ERQNDDVEE-QEEDAPNNPEQSQPSDSKEETDEEEEGEEEEDKPEQAKNAKKN  117

Query  455  TKEKDD------KKRGKGFNKPCALSPQL  523
                +       KKRG GF K C+LSPQL
Sbjct  118  KGRSNKLGDEVVKKRGGGFCKLCSLSPQL  146



>ref|XP_006425831.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
 ref|XP_006466650.1| PREDICTED: upstream activation factor subunit spp27-like [Citrus 
sinensis]
 gb|ESR39071.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
Length=338

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 96/150 (64%), Gaps = 7/150 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL + L++++L T T   VRR+LE+  GV L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDSELIARLQEFLKNSDLNTTTTGIVRRQLEKDFGVDLTDKKIFIREQVDLFLQSQFE  60

Query  275  TPQN---NKVQRGPDDSEN--VKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQ  439
              QN   N+ Q+  DD E+  + + K++  D   +  V+E + D+ DE + +D   ++  
Sbjct  61   NDQNDGGNEEQQQEDDGEDDQMAKVKSDETDGSDDAAVEEGDDDNNDENDNDDEANEAKG  120

Query  440  KAKSNTKEKDD--KKRGKGFNKPCALSPQL  523
             AK  +++ ++  KKRG GF+K CALSPQL
Sbjct  121  PAKRRSRKLNNEVKKRGGGFSKLCALSPQL  150



>ref|XP_002313088.2| hypothetical protein POPTR_0009s10990g [Populus trichocarpa]
 gb|EEE87043.2| hypothetical protein POPTR_0009s10990g [Populus trichocarpa]
Length=242

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 91/145 (63%), Gaps = 27/145 (19%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA+S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATASSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
                  + +G   S NV + E NEN       TV+++E ++   K          ++ + 
Sbjct  58   ------LNKGDGQSWNVTENEDNEN------DTVEDDENENDGIK----------EEEEE  95

Query  452  NTK-EKDDKKRGKGFNKPCALSPQL  523
            +TK ++D KKRG GF K C+LSPQL
Sbjct  96   DTKVDEDVKKRGGGFTKLCSLSPQL  120



>gb|KHG25549.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=515

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 92/143 (64%), Gaps = 18/143 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILRD++L+TATA SVR++LE+  G+ L DRK+F+RDQID+FL+T   
Sbjct  1    MVSDSDLVARLREILRDSDLDTATAGSVRKQLEKDFGIDLSDRKSFVRDQIDIFLETL--  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                        + +N K+ +NE    Q   +  EE  ++ D++EEE++  + +Q  + +
Sbjct  59   ------------NRDNEKEGENE----QAPESENEELQEENDDEEEEESKGEGSQNTRRS  102

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
              +K  KKRG GF   C+LSPQL
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQL  125



>gb|EPS57960.1| hypothetical protein M569_16857, partial [Genlisea aurea]
Length=198

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 81/144 (56%), Gaps = 17/144 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDSEL+ RL + L   +L+T T A VRRRLE   GV L DRKAFIRDQ+D +LQ+ + 
Sbjct  1    MVSDSELIVRLREFLSTCDLDTTTTAIVRRRLEADFGVDLSDRKAFIRDQVDDYLQSRME  60

Query  272  VTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
            +  + NK     +  +  ++E++E  D+ +   +                 + S+  +K+
Sbjct  61   IVEEGNKGGEAEEMIDEEEEEQHER-DAAESALI---------------DGKCSSSSSKT  104

Query  452  NTKEKDDKKRGKGFNKPCALSPQL  523
               + + KKRG GF KPC LSP+L
Sbjct  105  GLGDSETKKRGGGFTKPCRLSPEL  128



>gb|KJB32414.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=514

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 89/143 (62%), Gaps = 18/143 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILRD++L+TATA SVR++LE+  G+ L DRK+F+RDQID+FL+T   
Sbjct  1    MVSDSDLVARLREILRDSDLDTATAGSVRKQLEKDFGIDLSDRKSFVRDQIDIFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              Q+N               + E  + Q   +  EE  ++ D++EEE++    +Q  + +
Sbjct  58   LNQDN---------------EKEGEEEQAPESENEELQEENDDEEEEESKGGGSQNTRRS  102

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
              +K  KKRG GF   C+LSPQL
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQL  125



>gb|KJB32416.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=513

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 89/143 (62%), Gaps = 18/143 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILRD++L+TATA SVR++LE+  G+ L DRK+F+RDQID+FL+T   
Sbjct  1    MVSDSDLVARLREILRDSDLDTATAGSVRKQLEKDFGIDLSDRKSFVRDQIDIFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              Q+N               + E  + Q   +  EE  ++ D++EEE++    +Q  + +
Sbjct  58   LNQDN---------------EKEGEEEQAPESENEELQEENDDEEEEESKGGGSQNTRRS  102

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
              +K  KKRG GF   C+LSPQL
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQL  125



>ref|XP_011009270.1| PREDICTED: protein TRI1-like [Populus euphratica]
Length=316

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 79/143 (55%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL  RL + LR+A+L+  T  +VRR+LEE   + L D+K FIR+Q+DLFLQ  + 
Sbjct  1    MVSDSELTERLKEFLRNADLDKTTTGTVRRKLEEDFAIDLSDKKVFIREQVDLFLQNELD  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              Q N       + + V  E N+  D Q+E               + D +EK   K   N
Sbjct  61   NGQKNGDNEYTHEDQKVNVE-NDGCDLQEE--------------VQSDDEEKGNVKRGYN  105

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
              + + KKRG GF+K C+LSPQL
Sbjct  106  ENKNEGKKRGSGFSKLCSLSPQL  128



>ref|XP_002891515.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67774.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=372

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 31/143 (22%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T ASVRR+LE   GV L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRSSDLETTTPASVRRQLEAYFGVELTDKKAFVREQIDAFLESEAL  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 + +    + +   +E +EN D + E  VK                          
Sbjct  61   LESKPEEEEEDCNGDQNDEEGSENDDDKTEPPVKA-------------------------  95

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG GFNK C LSPQL
Sbjct  96   ------KKRGGGFNKICQLSPQL  112



>ref|XP_002522329.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
 gb|EEF40013.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
Length=322

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 15/146 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL + L++++L T T   VRR+LEE  G+ L D+KAFIR+Q+DLFLQ+   
Sbjct  1    MVSDSELIERLREFLKNSDLNTTTTGIVRRQLEEDFGIDLSDKKAFIREQVDLFLQSQFE  60

Query  275  TPQNNKVQRGPDDSE---NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                N+ +   DD +   NVK E+ +  +   E              E   ++  S  K 
Sbjct  61   ENDQNEEEEQEDDDDQRANVKSEQTDGDNDDDEEE------------ESTASNGTSNAKR  108

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +SN ++ + KKRG GF+K C+LSPQL
Sbjct  109  RSNEQKNEGKKRGGGFSKLCSLSPQL  134



>gb|KJB43614.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=242

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV DSEL+ RLW+ L +++L T T A VRRRLEE  G+ L DRK FIR+Q+DL+LQ    
Sbjct  1    MVLDSELIARLWEFLGESDLNTTTTAIVRRRLEEDFGIDLTDRKKFIREQVDLYLQNQFE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  + Q+  +D +  K +  E   S  +           +E+ E   ++K+T K +S 
Sbjct  61   NAEEQQQQQQNEDDQTAKIKSEETDGSDSDDE---------EEEHERAKNKKATSKKRSK  111

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                + K+RG GFNK   LSPQL
Sbjct  112  GVNSEGKRRGGGFNKVSRLSPQL  134



>ref|NP_175375.2| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AAY25460.1| At1g49520 [Arabidopsis thaliana]
 gb|AEE32438.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=372

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 31/143 (22%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T ASVRR+LE   GV L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRSSDLETTTPASVRRQLEVYFGVELTDKKAFVREQIDAFLESDAL  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 + +    + +   +E +EN D + E  VK                          
Sbjct  61   LESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKA-------------------------  95

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG GFNK C LSPQL
Sbjct  96   ------KKRGGGFNKICQLSPQL  112



>gb|AAD43149.1|AC007504_4 Hypothetical Protein [Arabidopsis thaliana]
Length=386

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 31/143 (22%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T ASVRR+LE   GV L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRSSDLETTTPASVRRQLEVYFGVELTDKKAFVREQIDAFLESDAL  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 + +    + +   +E +EN D + E  VK                          
Sbjct  61   LESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKA-------------------------  95

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG GFNK C LSPQL
Sbjct  96   ------KKRGGGFNKICQLSPQL  112



>gb|KJB43608.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43612.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV DSEL+ RLW+ L +++L T T A VRRRLEE  G+ L DRK FIR+Q+DL+LQ    
Sbjct  1    MVLDSELIARLWEFLGESDLNTTTTAIVRRRLEEDFGIDLTDRKKFIREQVDLYLQNQFE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  + Q+  +D +  K +  E   S  +           +E+ E   ++K+T K +S 
Sbjct  61   NAEEQQQQQQNEDDQTAKIKSEETDGSDSDDE---------EEEHERAKNKKATSKKRSK  111

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                + K+RG GFNK   LSPQL
Sbjct  112  GVNSEGKRRGGGFNKVSRLSPQL  134



>gb|KJB43609.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43611.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=331

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV DSEL+ RLW+ L +++L T T A VRRRLEE  G+ L DRK FIR+Q+DL+LQ    
Sbjct  1    MVLDSELIARLWEFLGESDLNTTTTAIVRRRLEEDFGIDLTDRKKFIREQVDLYLQNQFE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  + Q+  +D +  K +  E   S  +           +E+ E   ++K+T K +S 
Sbjct  61   NAEEQQQQQQNEDDQTAKIKSEETDGSDSDDE---------EEEHERAKNKKATSKKRSK  111

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                + K+RG GFNK   LSPQL
Sbjct  112  GVNSEGKRRGGGFNKVSRLSPQL  134



>gb|KJB43610.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV DSEL+ RLW+ L +++L T T A VRRRLEE  G+ L DRK FIR+Q+DL+LQ    
Sbjct  1    MVLDSELIARLWEFLGESDLNTTTTAIVRRRLEEDFGIDLTDRKKFIREQVDLYLQNQFE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  + Q+  +D +  K +  E   S  +           +E+ E   ++K+T K +S 
Sbjct  61   NAEEQQQQQQNEDDQTAKIKSEETDGSDSDDE---------EEEHERAKNKKATSKKRSK  111

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                + K+RG GFNK   LSPQL
Sbjct  112  GVNSEGKRRGGGFNKVSRLSPQL  134



>ref|XP_010941848.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Elaeis guineensis]
Length=302

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 3/143 (2%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + LR ++L T T A VRR+LEE  GV L ++KAFIR+Q+DLFL  H  
Sbjct  1    MVSDAELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSNKKAFIREQVDLFL--HSE  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N +V  G    E   +++ E    + E    E+E D ++E E       S++K + N
Sbjct  59   FNDNKEVDYGSGGEEG-DRDREEGSGEEDEEEEDEQEDDKEEEDEGRSNGGGSSRKRRLN  117

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP L
Sbjct  118  KLNKEVKKRGGGFTKLCSLSPAL  140



>ref|XP_010941845.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=334

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 3/143 (2%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + LR ++L T T A VRR+LEE  GV L ++KAFIR+Q+DLFL  H  
Sbjct  1    MVSDAELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSNKKAFIREQVDLFL--HSE  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N +V  G    E   +++ E    + E    E+E D ++E E       S++K + N
Sbjct  59   FNDNKEVDYGSGGEEG-DRDREEGSGEEDEEEEDEQEDDKEEEDEGRSNGGGSSRKRRLN  117

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP L
Sbjct  118  KLNKEVKKRGGGFTKLCSLSPAL  140



>ref|XP_010941846.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010941847.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=323

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 3/143 (2%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + LR ++L T T A VRR+LEE  GV L ++KAFIR+Q+DLFL  H  
Sbjct  1    MVSDAELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSNKKAFIREQVDLFL--HSE  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N +V  G    E   +++ E    + E    E+E D ++E E       S++K + N
Sbjct  59   FNDNKEVDYGSGGEEG-DRDREEGSGEEDEEEEDEQEDDKEEEDEGRSNGGGSSRKRRLN  117

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP L
Sbjct  118  KLNKEVKKRGGGFTKLCSLSPAL  140



>ref|XP_006303686.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
 gb|EOA36584.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
Length=376

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 80/143 (56%), Gaps = 27/143 (19%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T AS+RR+LE   GV L D+KAF+R+QID FL+T  +
Sbjct  1    MVSDSDLVTQLREILRSSDLETTTPASIRRQLEAYFGVELTDKKAFVREQIDAFLETDAL  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 +V +  +D E+   ++N+   S+ +                        +K +  
Sbjct  61   LESKPEVHKEHED-EDCNGDQNDEEGSENDN-----------------------EKTERP  96

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K K  K+RG GFNK C LSPQL
Sbjct  97   VKAK--KRRG-GFNKICQLSPQL  116



>ref|XP_010028508.1| PREDICTED: DNA ligase 1 [Eucalyptus grandis]
 gb|KCW55248.1| hypothetical protein EUGRSUZ_I01179 [Eucalyptus grandis]
Length=469

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 95/143 (66%), Gaps = 7/143 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L  RL +ILR+++L+ ATA SVRR+LE   G+ L DRK FIR+QID +LQ+ + 
Sbjct  1    MVSESDLASRLREILRNSDLDQATAGSVRRQLESDFGLDLSDRKTFIREQIDAYLQS-IG  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             P++     G     +VK+E++  ++   E   +EEE +  DE+E +      ++K +S 
Sbjct  60   NPEDGANDDGQCSGPDVKREEDGEVEEDGEEEGEEEEEEGDDEEEGKK-----SKKRRSA  114

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            +KEK +K+RG GFNK C+LSPQL
Sbjct  115  SKEKVNKRRG-GFNKLCSLSPQL  136



>gb|KHG26278.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=331

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV DSEL+ RLW+ L +++L T T A VRRRLEE  G+ L DRK FIR+Q+DL+LQ    
Sbjct  1    MVLDSELIARLWEFLGESDLNTTTTAIVRRRLEEDFGIDLTDRKKFIREQVDLYLQNQFE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +           +  +Q +++  D  K       + DD++E++E   ++K+T K +S 
Sbjct  61   NAEE---------QQQQEQNEDDQTDKIKSEETDGSDSDDEEEEQERAKNKKATSKKRSK  111

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                + K+RG GFNK   LSPQL
Sbjct  112  GVNSEGKRRGGGFNKVSKLSPQL  134



>ref|XP_006384456.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|ERP62253.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=384

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE LGV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVTRLREILRRSDLDTATAGSIRRQLEEDLGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                     G   SENV + +N   D+     V +EE ++   KEEE+  E  T+++K +
Sbjct  58   ------FNGGEGKSENVSENENTENDA-----VGDEENENDAVKEEEEEVETETKESKGS  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K    +KRG GF K  +LSPQL
Sbjct  107  NKTGKVRKRG-GFTKLSSLSPQL  128



>ref|XP_010905630.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=326

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 8/147 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdek----STQK  442
               N+  +   DDS  V +   +  +   E   ++ E    ++ +EED        S++K
Sbjct  60   ---NDNKEAEEDDSSGVDEGDEDGEEGSGEEGDQQVEEQVDEDGDEEDEGRSNEGGSSRK  116

Query  443  AKSNTKEKDDKKRGKGFNKPCALSPQL  523
             + N   K+ K+RG GF K C+LSP L
Sbjct  117  RRFNKLNKEVKRRGGGFTKLCSLSPAL  143



>ref|XP_010905631.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=325

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 8/147 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdek----STQK  442
               N+  +   DDS  V +   +  +   E   ++ E    ++ +EED        S++K
Sbjct  60   ---NDNKEAEEDDSSGVDEGDEDGEEGSGEEGDQQVEEQVDEDGDEEDEGRSNEGGSSRK  116

Query  443  AKSNTKEKDDKKRGKGFNKPCALSPQL  523
             + N   K+ K+RG GF K C+LSP L
Sbjct  117  RRFNKLNKEVKRRGGGFTKLCSLSPAL  143



>ref|XP_003537360.1| PREDICTED: upstream activation factor subunit spp27-like [Glycine 
max]
Length=346

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 12/155 (8%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVS+SEL+GRL + LR ++L T T A+VRR+LE   G+ L DRKAFIR+Q+DLFLQT   
Sbjct  1    MVSESELIGRLREFLRSSDLNTTTTATVRRQLEADFGIDLSDRKAFIREQVDLFLQTEHN  60

Query  266  --------HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedt  421
                         QN+ V+   +D+ N  ++   +   +     +EEE ++++E + +  
Sbjct  61   QSQQEEEEKEEKHQNDHVEEQEEDAPNNPEQSQPSDSKEVTDEDEEEEDEEEEEDKPKHA  120

Query  422  dekSTQKAKSNT-KEKDDKKRGKGFNKPCALSPQL  523
             +    K +SNT  ++  KKRG GF K C+LSPQL
Sbjct  121  KKAKKNKGRSNTLGDEVVKKRGGGFCKLCSLSPQL  155



>ref|XP_010096161.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB63556.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=463

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 81/143 (57%), Gaps = 24/143 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV D +L  RL DILR ++L+T T  SVRR+LE   GV L DRKAFI +QIDLFL +H+ 
Sbjct  1    MVPDKKLAERLRDILRSSDLDTTTPGSVRRQLEADFGVDLSDRKAFIGEQIDLFLASHMA  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ  +V+    ++E  ++EK++  DS   G                       +K +SN
Sbjct  61   NPQEEEVEEDGKEAEAEEEEKDDEDDSGSRG----------------------RRKGRSN  98

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             KE   KKRG GFNK C+LSP L
Sbjct  99   -KEDKVKKRG-GFNKLCSLSPHL  119



>emb|CDO97141.1| unnamed protein product [Coffea canephora]
Length=553

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVS+SELV RL +ILR ++L+ ATA SVRR+LEE+ GV L DRK FI +QID FL     
Sbjct  1    MVSESELVNRLREILRTSDLDIATAGSVRRQLEEEFGVSLHDRKTFISEQIDSFLSELRN  60

Query  266  -HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQK  442
                     + Q    D E V++ K E++    E         +    ++E +D   +++
Sbjct  61   DDAQQQHREETQEDSSDDEEVREVKVEDVKQDDENEDSGSHTQEVAIGKDEGSDGVRSKQ  120

Query  443  AKSNTKEKDDKKRGKGFNKPCALSPQL  523
             +S+ K+K++KK+G GF K  ALSPQL
Sbjct  121  KRSHKKDKNEKKKGNGFGKTWALSPQL  147



>ref|XP_009375740.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X4 [Pyrus x bretschneideri]
Length=367

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +IL  ++L+TATA SVRR+L+   GV L DRK FIRDQID++L+T   
Sbjct  1    MVSDSELLTRLREILGTSDLDTATAGSVRRQLQADFGVDLSDRKKFIRDQIDIYLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                   Q  P D E  ++    + ++++   V     ++ +E+EEE+ +EK +++ +  
Sbjct  58   -------QTEPQDEEAEEEVGEASENAEQNDHV----KEEDEEEEEEEGEEKGSKRKRRK  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            T +K   KRG GFNK C+LSPQL
Sbjct  107  TVDKGVAKRG-GFNKICSLSPQL  128



>ref|XP_009375738.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +IL  ++L+TATA SVRR+L+   GV L DRK FIRDQID++L+T   
Sbjct  1    MVSDSELLTRLREILGTSDLDTATAGSVRRQLQADFGVDLSDRKKFIRDQIDIYLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                   Q  P D E  ++    + ++++   V     ++ +E+EEE+ +EK +++ +  
Sbjct  58   -------QTEPQDEEAEEEVGEASENAEQNDHV----KEEDEEEEEEEGEEKGSKRKRRK  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            T +K   KRG GFNK C+LSPQL
Sbjct  107  TVDKGVAKRG-GFNKICSLSPQL  128



>ref|XP_009375739.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X3 [Pyrus x bretschneideri]
Length=368

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +IL  ++L+TATA SVRR+L+   GV L DRK FIRDQID++L+T   
Sbjct  1    MVSDSELLTRLREILGTSDLDTATAGSVRRQLQADFGVDLSDRKKFIRDQIDIYLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                   Q  P D E  ++    + ++++   V     ++ +E+EEE+ +EK +++ +  
Sbjct  58   -------QTEPQDEEAEEEVGEASENAEQNDHV----KEEDEEEEEEEGEEKGSKRKRRK  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            T +K   KRG GFNK C+LSPQL
Sbjct  107  TVDKGVAKRG-GFNKICSLSPQL  128



>ref|XP_009375737.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +IL  ++L+TATA SVRR+L+   GV L DRK FIRDQID++L+T   
Sbjct  1    MVSDSELLTRLREILGTSDLDTATAGSVRRQLQADFGVDLSDRKKFIRDQIDIYLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                   Q  P D E  ++    + ++++   V     ++ +E+EEE+ +EK +++ +  
Sbjct  58   -------QTEPQDEEAEEEVGEASENAEQNDHV----KEEDEEEEEEEGEEKGSKRKRRK  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
            T +K   KRG GFNK C+LSPQL
Sbjct  107  TVDKGVAKRG-GFNKICSLSPQL  128



>gb|KFK39235.1| hypothetical protein AALP_AA3G218000 [Arabis alpina]
Length=470

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 74/143 (52%), Gaps = 23/143 (16%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+T T ASVRR+LE   G+ L D+K FIRDQID FL+++V 
Sbjct  1    MVSDSDLVTRLREILRSSDLDTTTPASVRRQLEADFGIDLTDKKGFIRDQIDAFLESNVG  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N +V +     E  K +      ++ EG                  +  S       
Sbjct  61   LEDNTEVDQDTSSDETPKPK------AETEG-----------------DEIGSESDQDKE  97

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +    KKRG GF K C LSP+L
Sbjct  98   QRPVKAKKRGNGFTKVCQLSPKL  120



>ref|XP_007156836.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28830.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=341

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+SEL+GRL + LR+++L T T A+VRR+LE   G+ L  RKAFIR+Q+DLFLQT   
Sbjct  1    MVSESELIGRLREFLRNSDLNTTTTATVRRQLEADFGIDLSHRKAFIREQVDLFLQTEHN  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ  + Q      +  +++  +N +  +    KE+  +D D  EEE    K ++ AK N
Sbjct  61   QPQQQQQQNDDVPEDEEEEDGPDNPEQSQPSDTKEQSEEDDDNDEEERDKPKHSKNAKKN  120

Query  455  TKEKDD------KKRGKGFNKPCALSPQL  523
                +       KKRG GF K C+LSPQL
Sbjct  121  KGRSNKLGDEVVKKRGGGFCKLCSLSPQL  149



>ref|XP_007156837.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28831.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=340

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 6/149 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+SEL+GRL + LR+++L T T A+VRR+LE   G+ L  RKAFIR+Q+DLFLQT   
Sbjct  1    MVSESELIGRLREFLRNSDLNTTTTATVRRQLEADFGIDLSHRKAFIREQVDLFLQTEHN  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ  + Q      +  +++  +N +  +    KE+  +D D  EEE    K ++ AK N
Sbjct  61   QPQQQQQQNDDVPEDEEEEDGPDNPEQSQPSDTKEQSEEDDDNDEEERDKPKHSKNAKKN  120

Query  455  TKEKDD------KKRGKGFNKPCALSPQL  523
                +       KKRG GF K C+LSPQL
Sbjct  121  KGRSNKLGDEVVKKRGGGFCKLCSLSPQL  149



>gb|KDO49158.1| hypothetical protein CISIN_1g0161771mg, partial [Citrus sinensis]
 gb|KDO49159.1| hypothetical protein CISIN_1g0161771mg, partial [Citrus sinensis]
 gb|KDO49160.1| hypothetical protein CISIN_1g0161771mg, partial [Citrus sinensis]
 gb|KDO49161.1| hypothetical protein CISIN_1g0161771mg, partial [Citrus sinensis]
 gb|KDO49162.1| hypothetical protein CISIN_1g0161771mg, partial [Citrus sinensis]
Length=276

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 24/143 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL DILR+++L+TATA SVRR LEE   V L DRKAF+ +QIDLFLQT   
Sbjct  1    MVSDSDLVTRLRDILRNSDLDTATAGSVRRLLEEDFKVDLSDRKAFVSEQIDLFLQTL--  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                              +++ E ++    G V+    D ++E+EE ++  + + K    
Sbjct  59   ------------------EKEREEIEDDGNGAVEANADDKEEEEEESESKREKSIKVGRQ  100

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K    ++ G GFNK C+LS QL
Sbjct  101  VK----RRGGGGFNKLCSLSTQL  119



>ref|XP_008236632.1| PREDICTED: upstream activation factor subunit UAF30 isoform X2 
[Prunus mume]
Length=363

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 25/146 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+++ RL +IL  ++L+TATA SVRR+LE   GV L DRK FIRDQID+FL+TH  
Sbjct  1    MVSNSDILTRLTEILSTSDLDTATAGSVRRQLENDFGVDLSDRKKFIRDQIDIFLETHRA  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ+ +   G +  E  +  + E    ++                      +   K K+ 
Sbjct  61   EPQDEEEAEGEEVGEGSENAEEEEDGDEEG---------------------EEDNKGKNK  99

Query  455  TKEKDDK---KRGKGFNKPCALSPQL  523
             ++  DK   KRG GFNK C+LSPQL
Sbjct  100  RRKTVDKGVVKRG-GFNKICSLSPQL  124



>ref|XP_012072456.1| PREDICTED: DNA ligase 1 isoform X4 [Jatropha curcas]
Length=481

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSDS+LV RL ++L+D++L+TATA S+RR+LEE+ GV L DRKAFIR+QID++L+T
Sbjct  60   MVSDSDLVTRLREVLQDSDLDTATAGSIRRKLEEEFGVNLSDRKAFIREQIDIYLET  116



>ref|XP_008236631.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Prunus mume]
Length=364

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 25/146 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+++ RL +IL  ++L+TATA SVRR+LE   GV L DRK FIRDQID+FL+TH  
Sbjct  1    MVSNSDILTRLTEILSTSDLDTATAGSVRRQLENDFGVDLSDRKKFIRDQIDIFLETHRA  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
             PQ+ +   G +  E  +  + E    ++                      +   K K+ 
Sbjct  61   EPQDEEEAEGEEVGEGSENAEEEEDGDEEG---------------------EEDNKGKNK  99

Query  455  TKEKDDK---KRGKGFNKPCALSPQL  523
             ++  DK   KRG GFNK C+LSPQL
Sbjct  100  RRKTVDKGVVKRG-GFNKICSLSPQL  124



>ref|XP_012072453.1| PREDICTED: DNA ligase 1 isoform X1 [Jatropha curcas]
Length=518

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSDS+LV RL ++L+D++L+TATA S+RR+LEE+ GV L DRKAFIR+QID++L+T
Sbjct  60   MVSDSDLVTRLREVLQDSDLDTATAGSIRRKLEEEFGVNLSDRKAFIREQIDIYLET  116



>ref|XP_012072454.1| PREDICTED: DNA ligase 1 isoform X2 [Jatropha curcas]
Length=517

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSDS+LV RL ++L+D++L+TATA S+RR+LEE+ GV L DRKAFIR+QID++L+T
Sbjct  60   MVSDSDLVTRLREVLQDSDLDTATAGSIRRKLEEEFGVNLSDRKAFIREQIDIYLET  116



>emb|CDP02467.1| unnamed protein product [Coffea canephora]
Length=323

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 89/149 (60%), Gaps = 20/149 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV+++ELV RL + L  ++L T T A VRR+LEE  G+ L DRKAFIR+Q+D++LQT   
Sbjct  1    MVTETELVDRLREFLSTSDLNTTTTAIVRRKLEEDFGIDLSDRKAFIREQVDIYLQTQF-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKE--GTVkeeeiddqdekeeedtdekSTQKAK  448
                          E  ++ K EN D+Q +    +  EE ++++E EEE+++E S  K  
Sbjct  60   -------------QEQAEEYKEENGDAQAQVPAVIDAEEEEEEEEDEEEESEEPSNGKPT  106

Query  449  S----NTKEKDDKKRGKGFNKPCALSPQL  523
            S      K K+ K+RG GF K C+LSPQL
Sbjct  107  SKKGLKKKNKEVKRRGGGFTKLCSLSPQL  135



>ref|XP_012072455.1| PREDICTED: DNA ligase 1 isoform X3 [Jatropha curcas]
Length=500

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSDS+LV RL ++L+D++L+TATA S+RR+LEE+ GV L DRKAFIR+QID++L+T
Sbjct  60   MVSDSDLVTRLREVLQDSDLDTATAGSIRRKLEEEFGVNLSDRKAFIREQIDIYLET  116



>ref|XP_007199917.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
 gb|EMJ01116.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
Length=373

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+++ RL +IL  ++L+TATA SVRR+LE   GV L DRK FIRDQID+FL+TH  
Sbjct  1    MVSNSDILTRLTEILSTSDLDTATAGSVRRQLENDFGVDLSDRKKFIRDQIDIFLETHRA  60

Query  275  TPQN  286
             PQ+
Sbjct  61   EPQD  64



>ref|XP_006406538.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
 gb|ESQ47991.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
Length=378

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 84/143 (59%), Gaps = 13/143 (9%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD +LV RL +ILR ++L TAT ASVRR+LE    V L D+K FIRDQID FL++   
Sbjct  1    MVSDLDLVTRLQEILRSSDLHTATPASVRRQLEADFDVELTDKKGFIRDQIDAFLES---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N  V+  PD   + K E++EN D   E T  + E +  D+++++  D   + + K  
Sbjct  58   ---NGGVEDKPD---SPKAEEDENTD---EMTQPKAEFEGGDDEDDDAGDASDSNEDKEE  108

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K  KKR  GF K C LSPQL
Sbjct  109  RPVK-AKKRASGFTKVCQLSPQL  130



>ref|XP_010500494.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=379

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 76/147 (52%), Gaps = 32/147 (22%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L  ILR ++LET T ASVRR+LE   GV L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLRKILRGSDLETTTPASVRRQLEAYFGVELTDKKAFVREQIDAFLESDAL  60

Query  275  T---PQNNKVQRGPDDSE-NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQK  442
                P+N K +   +D + N  Q   E  DS  E T                        
Sbjct  61   LESKPENYKEEEVDEDEDCNGDQNYEEGSDSNDEKT------------------------  96

Query  443  AKSNTKEKDDKKRGKGFNKPCALSPQL  523
                 +  + KKR  GFNK C LSPQL
Sbjct  97   ----ERPVEAKKRRGGFNKICQLSPQL  119



>ref|XP_002306454.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
 gb|EEE93450.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
Length=316

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 74/143 (52%), Gaps = 34/143 (24%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL  RL + LR+A+L+  T  +VRR+LEE   + L D+K FIR+Q+DLFLQ    
Sbjct  1    MVSDSELTERLKEFLRNADLDKTTTGTVRRKLEEDFAIDLSDKKVFIREQVDLFLQ----  56

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                N++  G  + +N    +++ ++ + +G                             
Sbjct  57   ----NELDDGQKNGDNEYTHEDQKVNVENDGC--------------------------DL  86

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +E   KKRG GF+K C+LSPQL
Sbjct  87   QEEVQGKKRGGGFSKLCSLSPQL  109



>ref|XP_010263744.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
 ref|XP_010263745.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
Length=329

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 1/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + L+ ++L T T A VRR+LE+  G+ L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDTELVERLREFLQTSDLSTTTTAIVRRKLEQDFGIDLSDKKVFIREQVDLFLQSQFD  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +    +   ++ E   + K+E  +S       +E  D+++E+EE    + S +K++SN
Sbjct  61   KAEEEGGEDEKEEEEAKPKTKSEESNSSDS-EGDDESGDEEEEEEETGNGKGSRKKSRSN  119

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C LSPQL
Sbjct  120  KLSKEVKKRGGGFTKLCTLSPQL  142



>ref|XP_010263742.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nelumbo nucifera]
Length=366

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 1/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + L+ ++L T T A VRR+LE+  G+ L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDTELVERLREFLQTSDLSTTTTAIVRRKLEQDFGIDLSDKKVFIREQVDLFLQSQFD  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +    +   ++ E   + K+E  +S       +E  D+++E+EE    + S +K++SN
Sbjct  61   KAEEEGGEDEKEEEEAKPKTKSEESNSSDS-EGDDESGDEEEEEEETGNGKGSRKKSRSN  119

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C LSPQL
Sbjct  120  KLSKEVKKRGGGFTKLCTLSPQL  142



>ref|XP_006480142.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Citrus sinensis]
Length=365

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 24/143 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL DILR+++L+TATA SVRR LEE   V L DRKAF+ +QIDLFLQT   
Sbjct  1    MVSDSDLVTRLRDILRNSDLDTATAGSVRRLLEEDFKVDLSDRKAFVSEQIDLFLQTL--  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                              +++ E ++    G V+    D ++E+EE ++  + + K    
Sbjct  59   ------------------EKEREEIEDDGNGAVEANADDKEEEEEESESKREKSIKVGRQ  100

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K    ++ G GFNK C+LS QL
Sbjct  101  VK----RRGGGGFNKLCSLSTQL  119



>emb|CBI23284.3| unnamed protein product [Vitis vinifera]
Length=303

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 87/147 (59%), Gaps = 8/147 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDSELV RL + LR ++L T T A VRR+LEE  G+ L  +KAFIR+ +DLFLQ+ + 
Sbjct  1    MVSDSELVARLHEFLRSSDLNTTTTAIVRRKLEEDFGIDLSGKKAFIREHVDLFLQSQLE  60

Query  272  ---VTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQK  442
                   +   +   +   NVK E +   DS+ E      + DD++E+ EE ++ K  +K
Sbjct  61   KAEEDEGDGGEEEEEEHKSNVKSEGSNGSDSKDEND----DDDDEEEEVEESSNGKGAKK  116

Query  443  AKSNTKEKDDKKRGKGFNKPCALSPQL  523
              S    K+ KKRG GF K C+LSP+L
Sbjct  117  RGSKKSNKEVKKRGGGFCKLCSLSPEL  143



>ref|XP_006480141.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Citrus sinensis]
Length=394

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 24/143 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL DILR+++L+TATA SVRR LEE   V L DRKAF+ +QIDLFLQT   
Sbjct  1    MVSDSDLVTRLRDILRNSDLDTATAGSVRRLLEEDFKVDLSDRKAFVSEQIDLFLQTL--  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                              +++ E ++    G V+    D ++E+EE ++  + + K    
Sbjct  59   ------------------EKEREEIEDDGNGAVEANADDKEEEEEESESKREKSIKVGRQ  100

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K    ++ G GFNK C+LS QL
Sbjct  101  VK----RRGGGGFNKLCSLSTQL  119



>emb|CDX99270.1| BnaC05g33850D [Brassica napus]
Length=464

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 18/143 (13%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +IL  ++LET T A+VRR+LE   GV L D+KAFIRDQID FL+++  
Sbjct  1    MVSDSDLVTRLREILSSSDLETTTPATVRRQLEADFGVELTDKKAFIRDQIDAFLESNGG  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +N    +  +D++    E  ++ D +KE  ++ + I ++              KAK  
Sbjct  61   GEENPVSPKAEEDAD----EMTKDGDEEKEERIEFKGIKEKRLALFLPV------KAK--  108

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  K+ G GF K C LSPQL
Sbjct  109  ------KRGGGGFAKVCQLSPQL  125



>emb|CAN83123.1| hypothetical protein VITISV_044372 [Vitis vinifera]
Length=332

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 87/143 (61%), Gaps = 0/143 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  G+ L  +KAFIR+ +DLFLQ+ + 
Sbjct  1    MVSDSELVARLHEFLRSSDLNTTTTAIVRRKLEEDFGIDLSGKKAFIREHVDLFLQSQLE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              + ++   G ++ E  K        +  +   + ++ DD++E+ EE ++ K  +K  S 
Sbjct  61   KAEEDEGDGGEEEEEEHKSNVKSEGSNGSDSKDENDDDDDEEEEVEESSNGKGAKKRGSK  120

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP+L
Sbjct  121  KSNKEVKKRGGGFCKLCSLSPEL  143



>ref|XP_010652654.1| PREDICTED: upstream activation factor subunit spp27-like [Vitis 
vinifera]
Length=332

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 87/143 (61%), Gaps = 0/143 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  G+ L  +KAFIR+ +DLFLQ+ + 
Sbjct  1    MVSDSELVARLHEFLRSSDLNTTTTAIVRRKLEEDFGIDLSGKKAFIREHVDLFLQSQLE  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              + ++   G ++ E  K        +  +   + ++ DD++E+ EE ++ K  +K  S 
Sbjct  61   KAEEDEGDGGEEEEEEHKSNVKSEGSNGSDSKDENDDDDDEEEEVEESSNGKGAKKRGSK  120

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP+L
Sbjct  121  KSNKEVKKRGGGFCKLCSLSPEL  143



>ref|XP_010263746.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Nelumbo nucifera]
Length=328

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + L+ ++L T T A VRR+LE+  G+ L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDTELVERLREFLQTSDLSTTTTAIVRRKLEQDFGIDLSDKKVFIREQVDLFLQSQF-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  +     +  E   + K ++ +S    +  ++E  D++E+EEE  + K ++K  SN
Sbjct  60   -DKAEEEGGEDEKEEEEAKPKTKSEESNSSDSEGDDESGDEEEEEEETGNGKGSRKKSSN  118

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C LSPQL
Sbjct  119  KLSKEVKKRGGGFTKLCTLSPQL  141



>ref|XP_009345973.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Pyrus x bretschneideri]
Length=363

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 87/146 (60%), Gaps = 18/146 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +ILR ++L+TAT  SVRR+LE   GV L DRK FI DQID++L+T   
Sbjct  1    MVSDSELLTRLREILRSSDLDTATPGSVRRKLETDFGVDLSDRKKFIGDQIDIYLETQ-T  59

Query  275  TPQN---NKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             PQ     +     + SEN   E+N+++  + E             +EEE+ +EK  +  
Sbjct  60   KPQGEEAEEEDEVGESSENA--EQNDDVKEEDEEE-----------EEEEEEEEKENKSK  106

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +  T +K   KRG GFNK C+LSPQL
Sbjct  107  RRKTVDKVVVKRG-GFNKICSLSPQL  131



>ref|XP_010263743.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nelumbo nucifera]
Length=365

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+ELV RL + L+ ++L T T A VRR+LE+  G+ L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDTELVERLREFLQTSDLSTTTTAIVRRKLEQDFGIDLSDKKVFIREQVDLFLQSQF-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  +     +  E   + K ++ +S    +  ++E  D++E+EEE  + K ++K  SN
Sbjct  60   -DKAEEEGGEDEKEEEEAKPKTKSEESNSSDSEGDDESGDEEEEEEETGNGKGSRKKSSN  118

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C LSPQL
Sbjct  119  KLSKEVKKRGGGFTKLCTLSPQL  141



>ref|XP_008792695.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008792696.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Phoenix dactylifera]
Length=319

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 89/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  GV L  +KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSSKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N+  +   DD   + +E+ E    +  G   EEE D+Q++ EEE+ +  S++K +  
Sbjct  60   ---NDNKEVEEDD--GLGREEGERDREEGRGEADEEEDDEQEDDEEEEDEGGSSRKRRLT  114

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP L
Sbjct  115  KLNKEVKKRGGGFTKLCSLSPAL  137



>ref|XP_009345971.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 87/146 (60%), Gaps = 18/146 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +ILR ++L+TAT  SVRR+LE   GV L DRK FI DQID++L+T   
Sbjct  1    MVSDSELLTRLREILRSSDLDTATPGSVRRKLETDFGVDLSDRKKFIGDQIDIYLETQ-T  59

Query  275  TPQN---NKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             PQ     +     + SEN   E+N+++  + E             +EEE+ +EK  +  
Sbjct  60   KPQGEEAEEEDEVGESSENA--EQNDDVKEEDEEE-----------EEEEEEEEKENKSK  106

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +  T +K   KRG GFNK C+LSPQL
Sbjct  107  RRKTVDKVVVKRG-GFNKICSLSPQL  131



>ref|XP_010255131.1| PREDICTED: upstream activation factor subunit spp27-like [Nelumbo 
nucifera]
Length=323

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 9/143 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + L+ ++L T T A VRR+LEE  GV L D+KAFIR+Q+DLFLQ+   
Sbjct  1    MVSDSELVERLREFLQTSDLNTTTTAIVRRKLEEDFGVDLSDKKAFIREQVDLFLQS---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 + ++  ++ E+ ++E     +S+       EE +D DE+EEE ++ +  +K  SN
Sbjct  58   -----QFEKAEEEQEDDEEEGKHKTNSEDNNGSDSEEDEDGDEEEEEGSNGRGRRKRSSN  112

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               KD +KRG GF K C LSP L
Sbjct  113  KLNKDVRKRG-GFTKLCKLSPLL  134



>ref|XP_009345972.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 87/146 (60%), Gaps = 18/146 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +ILR ++L+TAT  SVRR+LE   GV L DRK FI DQID++L+T   
Sbjct  1    MVSDSELLTRLREILRSSDLDTATPGSVRRKLETDFGVDLSDRKKFIGDQIDIYLETQ-T  59

Query  275  TPQN---NKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             PQ     +     + SEN +Q  N+++  + E             +EEE+ +EK  +  
Sbjct  60   KPQGEEAEEEDEVGESSENAEQ--NDDVKEEDEEE-----------EEEEEEEEKENKSK  106

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +  T +K   KRG GFNK C+LSPQL
Sbjct  107  RRKTVDKVVVKRG-GFNKICSLSPQL  131



>ref|XP_008792693.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Phoenix dactylifera]
Length=337

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 89/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LEE  GV L  +KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEEDFGVDLSSKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N+  +   DD   + +E+ E    +  G   EEE D+Q++ EEE+ +  S++K +  
Sbjct  60   ---NDNKEVEEDDG--LGREEGERDREEGRGEADEEEDDEQEDDEEEEDEGGSSRKRRLT  114

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K+ KKRG GF K C+LSP L
Sbjct  115  KLNKEVKKRGGGFTKLCSLSPAL  137



>ref|XP_006423075.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
 gb|ESR36315.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
Length=378

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 25/151 (17%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+LV RL DILR+++L+TATA SVRR LEE   V L DRKAF+ +QID+FLQT   
Sbjct  1    MVSDSDLVTRLRDILRNSDLDTATAGSVRRLLEEDFRVDLSDRKAFVSEQIDIFLQTLEK  60

Query  266  ---HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                +    N+ V+   DD E  ++E+ E  + ++E                   +E+S 
Sbjct  61   EREEIEDDGNDAVEANADDKEEEEEEEEEEEEEEEEEE-----------------EEESE  103

Query  437  QKAKSNTKEKDDKKR--GKGFNKPCALSPQL  523
            +K + + K   + KR  G GFNK C+LS QL
Sbjct  104  RKREKSIKVGREVKRRGGGGFNKICSLSTQL  134



>ref|XP_002521839.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF40475.1| brg-1 associated factor, putative [Ricinus communis]
Length=614

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSDS+LV RL +IL+D++L TATA SVRR+LEE  GV L DRKAFIR+QID +L+T
Sbjct  1    MVSDSDLVTRLREILQDSDLNTATAGSVRRKLEEVFGVDLSDRKAFIREQIDSYLET  57



>gb|KDO79320.1| hypothetical protein CISIN_1g0196441mg, partial [Citrus sinensis]
 gb|KDO79321.1| hypothetical protein CISIN_1g0196441mg, partial [Citrus sinensis]
 gb|KDO79322.1| hypothetical protein CISIN_1g0196441mg, partial [Citrus sinensis]
Length=125

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL + L++++L T T   VRR+LE+  GV L D+K FIR+Q+DLFLQ+   
Sbjct  1    MVSDSELIARLQEFLKNSDLNTTTTGIVRRQLEKDFGVDLTDKKIFIREQVDLFLQSQFE  60

Query  275  TPQNN  289
              QN+
Sbjct  61   NDQND  65



>ref|NP_001148210.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|ACG30187.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=329

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 0/143 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL     
Sbjct  1    MVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFLAEVAA  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              +  + +    +   V +E+        E   + E  ++++E+EEE+ +++++  A+  
Sbjct  61   KAEPQEPKEEEPEEAPVPKEEEPEELEGVEEEGEGEYEEEEEEEEEEECEDENSSGARKK  120

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +  D KKRG GF K C+LSP L
Sbjct  121  QRGNDGKKRGGGFTKLCSLSPAL  143



>ref|XP_010999905.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X6 [Populus euphratica]
Length=393

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_009345974.1| PREDICTED: ABC transporter F family member 4 [Pyrus x bretschneideri]
Length=483

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 87/146 (60%), Gaps = 18/146 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL +ILR ++L+TAT  SVRR+LE   GV L DRK FI DQID++L+T   
Sbjct  1    MVSDSELLTRLREILRSSDLDTATPGSVRRKLETDFGVDLSDRKKFIGDQIDIYLETQ-T  59

Query  275  TPQN---NKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
             PQ     +     + SEN +Q  N+++  + E             +EEE+ +EK  +  
Sbjct  60   KPQGEEAEEEDEVGESSENAEQ--NDDVKEEDEEE-----------EEEEEEEEKENKSK  106

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            +  T +K   KRG GFNK C+LSPQL
Sbjct  107  RRKTVDKVVVKRG-GFNKICSLSPQL  131



>ref|XP_010999870.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Populus euphratica]
Length=428

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_010999877.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X5 [Populus euphratica]
Length=407

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_010999856.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X2 [Populus 
euphratica]
Length=448

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_010999862.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=438

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_010999846.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X1 [Populus 
euphratica]
Length=449

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +ILR ++L+TATA S+RR+LEE  GV L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVARLREILRSSDLDTATAGSIRRQLEEDFGVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQ-EKNEN  346
                  + +G   S NV + E NEN
Sbjct  58   ------LNKGDGQSGNVTENEDNEN  76



>ref|XP_011001190.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Populus euphratica]
Length=411

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +IL  ++L+TATA S+RR+LEE L V L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVTRLREILGRSDLDTATAGSIRRQLEEDLSVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                     G   SENV + +N   D+     V +EE ++   KEEE+ +E  T+++K +
Sbjct  58   ------FNGGEGKSENVSENENTENDA-----VDDEENENDGVKEEEEEEETETKESKGS  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K +  +KRG GF K  +LSPQL
Sbjct  107  NKTEKVRKRG-GFAKLSSLSPQL  128



>ref|XP_011001192.1| PREDICTED: protein TRI1-like isoform X2 [Populus euphratica]
Length=383

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +IL  ++L+TATA S+RR+LEE L V L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVTRLREILGRSDLDTATAGSIRRQLEEDLSVDLSEKKKFIREQIDTFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                     G   SENV + +N   D+     V +EE ++   KEEE+ +E  T+++K +
Sbjct  58   ------FNGGEGKSENVSENENTENDA-----VDDEENENDGVKEEEEEEETETKESKGS  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K +  +KRG GF K  +LSPQL
Sbjct  107  NKTEKVRKRG-GFAKLSSLSPQL  128



>ref|XP_006393249.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
 gb|ESQ30535.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
Length=384

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +IL  ++LET T ASVRR+LE   GV L D+KAF+RDQID FL++  V
Sbjct  1    MVSDSDLVTRLREILSSSDLETTTPASVRRQLEAYFGVELTDKKAFVRDQIDAFLESDAV  60

Query  275  T  277
             
Sbjct  61   V  61



>ref|XP_010461790.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 34/149 (23%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET TAASVRR+LE   GV L  +KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRGSDLETTTAASVRRQLEAYFGVELTYKKAFVREQIDAFLESGAL  60

Query  275  T---PQNNKVQRGPDDSE---NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                P+N+K +    D +   N  Q   E  +S  E                        
Sbjct  61   LESKPENHKEEEEEVDEDEECNGDQNYEEGSESNNEKP----------------------  98

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
                   +  + KKR  GFNK C LSPQL
Sbjct  99   ------ERPVEAKKRRGGFNKICQLSPQL  121



>ref|XP_011001193.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=361

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV RL +IL  ++L+TATA S+RR+LEE L V L ++K FIR+QID FL+T   
Sbjct  1    MVSDSDLVTRLREILGRSDLDTATAGSIRRQLEEDLSVDLSEKKKFIREQIDTFLETF--  58

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                     G   SENV + +N   D+     V +EE ++   KEEE+ +E  T+++K +
Sbjct  59   -------NGGEGKSENVSENENTENDA-----VDDEENENDGVKEEEEEEETETKESKGS  106

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K +  +KRG GF K  +LSPQL
Sbjct  107  NKTEKVRKRG-GFAKLSSLSPQL  128



>ref|XP_010461791.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Camelina sativa]
Length=380

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 34/149 (23%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET TAASVRR+LE   GV L  +KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRGSDLETTTAASVRRQLEAYFGVELTYKKAFVREQIDAFLESGAL  60

Query  275  T---PQNNKVQRGPDDSE---NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                P+N+K +    D +   N  Q   E  +S  E                        
Sbjct  61   LESKPENHKEEEEEVDEDEECNGDQNYEEGSESNNEKP----------------------  98

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
                   +  + KKR  GFNK C LSPQL
Sbjct  99   ------ERPVEAKKRRGGFNKICQLSPQL  121



>ref|XP_011458333.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
 ref|XP_011458334.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
Length=387

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L+ RL +IL  ++L+TATA SVRR LE+  G  L DRKAFIRDQID++L++ V 
Sbjct  1    MVSESDLLTRLREILSSSDLDTATAGSVRRELEKHFGADLSDRKAFIRDQIDIYLESQVA  60

Query  275  TPQ  283
              Q
Sbjct  61   NHQ  63



>ref|XP_004290311.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
 ref|XP_011458332.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
Length=388

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L+ RL +IL  ++L+TATA SVRR LE+  G  L DRKAFIRDQID++L++ V 
Sbjct  1    MVSESDLLTRLREILSSSDLDTATAGSVRRELEKHFGADLSDRKAFIRDQIDIYLESQVA  60

Query  275  TPQ  283
              Q
Sbjct  61   NHQ  63



>gb|AFW67527.1| hypothetical protein ZEAMMB73_352797 [Zea mays]
Length=316

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 83/143 (58%), Gaps = 1/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD ELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL   V 
Sbjct  1    MVSDLELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL-AEVA  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 +  +  ++ E+    K E  +  +    + E  +  +E+EEE+ +E  +  A+  
Sbjct  60   AKAEPEEPKEEEELEDAPVPKAEEAEEGEGVEEEGEGEEGGEEEEEEEEEEVDSSSARKK  119

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +  D KKRG GF K C+LSP L
Sbjct  120  QRGNDGKKRGGGFTKLCSLSPAL  142



>ref|XP_011458331.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Fragaria vesca subsp. vesca]
Length=393

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L+ RL +IL  ++L+TATA SVRR LE+  G  L DRKAFIRDQID++L++ V 
Sbjct  1    MVSESDLLTRLREILSSSDLDTATAGSVRRELEKHFGADLSDRKAFIRDQIDIYLESQVA  60

Query  275  TPQ  283
              Q
Sbjct  61   NHQ  63



>ref|XP_011458329.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011458330.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
Length=394

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L+ RL +IL  ++L+TATA SVRR LE+  G  L DRKAFIRDQID++L++ V 
Sbjct  1    MVSESDLLTRLREILSSSDLDTATAGSVRRELEKHFGADLSDRKAFIRDQIDIYLESQVA  60

Query  275  TPQ  283
              Q
Sbjct  61   NHQ  63



>ref|XP_007047161.1| SWIB complex BAF60b domain-containing protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOX91318.1| SWIB complex BAF60b domain-containing protein, putative isoform 
2, partial [Theobroma cacao]
Length=241

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 17/149 (11%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MV DSEL+ RL + L++++L T T A VRRRLEE   + L ++K FIR+Q+DL+LQ+   
Sbjct  1    MVLDSELIARLREFLKESDLNTTTTAIVRRRLEEDFRIDLSEKKKFIREQVDLYLQSQFE  60

Query  272  -----VTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                    Q ++     D +  +K E+ +  DS +E             + E   +++++
Sbjct  61   NAEEQEQEQEDENNEEDDQTAKIKSEETDGSDSNEEEE-----------ESERARNKRAS  109

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
             K  S     + K+RG GFNK C+LSPQL
Sbjct  110  AKKGSKRVNNEVKRRGGGFNKVCSLSPQL  138



>ref|NP_001147426.1| LOC100281035 [Zea mays]
 gb|ACG27473.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|AFW67526.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=328

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 83/143 (58%), Gaps = 1/143 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD ELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL   V 
Sbjct  1    MVSDLELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL-AEVA  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                 +  +  ++ E+    K E  +  +    + E  +  +E+EEE+ +E  +  A+  
Sbjct  60   AKAEPEEPKEEEELEDAPVPKAEEAEEGEGVEEEGEGEEGGEEEEEEEEEEVDSSSARKK  119

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +  D KKRG GF K C+LSP L
Sbjct  120  QRGNDGKKRGGGFTKLCSLSPAL  142



>ref|XP_010479386.1| PREDICTED: protein TRI1-like isoform X2 [Camelina sativa]
Length=380

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 34/149 (23%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T ASVRR+LE   G  L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRRSDLETTTPASVRRQLEAYFGDELTDKKAFVREQIDAFLESDAL  60

Query  275  T---PQNNKVQRGPDDSE---NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                P+N+K +   +D +   N  Q   E  +S  E T                      
Sbjct  61   LESKPENHKEEEADEDEDEDCNGDQNDEEGSESNDEKT----------------------  98

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
                   +  + KKR  GFNK C LSPQL
Sbjct  99   ------ERPVEAKKRRGGFNKICQLSPQL  121



>ref|XP_010479385.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 34/149 (23%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+LV +L +ILR ++LET T ASVRR+LE   G  L D+KAF+R+QID FL++  +
Sbjct  1    MVSDSDLVTQLREILRRSDLETTTPASVRRQLEAYFGDELTDKKAFVREQIDAFLESDAL  60

Query  275  T---PQNNKVQRGPDDSE---NVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                P+N+K +   +D +   N  Q   E  +S  E T                      
Sbjct  61   LESKPENHKEEEADEDEDEDCNGDQNDEEGSESNDEKT----------------------  98

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
                   +  + KKR  GFNK C LSPQL
Sbjct  99   ------ERPVEAKKRRGGFNKICQLSPQL  121



>gb|ERN14421.1| hypothetical protein AMTR_s00033p00241730 [Amborella trichopoda]
Length=287

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 76/146 (52%), Gaps = 31/146 (21%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + L  A+L T T ++VR+ LE + GV L ++KAFIRDQI+L+      
Sbjct  1    MVSDSELVERLKEFLSTADLNTTTNSTVRKHLENEFGVDLSEKKAFIRDQINLYF-----  55

Query  275  TPQNNKVQRGPDDSENVKQEKNENLD-SQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
                       D  E  ++ K E  D S+ EG             E+   +E+  +   S
Sbjct  56   -----------DSLEGNEETKEEGRDPSESEGE------------EDRAVEEEEEKGKGS  92

Query  452  NTKEKDDKKR--GKGFNKPCALSPQL  523
              +   DKKR  G GF+KPC LSP+L
Sbjct  93   KRRMSKDKKRTGGGGFSKPCGLSPEL  118



>ref|XP_008792594.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Phoenix dactylifera]
Length=266

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LE   GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEGDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdek-----STQ  439
               +NK     D S   + +++    S +EG  +EEE DD DE E E+ +       S++
Sbjct  60   --NDNKEGEEEDGSGGEEGDRHGEEGSGEEGDQEEEEDDDGDEDENEEDEGTSNGVGSSR  117

Query  440  KAKSNTKEKDDKKRGKGFNKPCALSPQL  523
            K + N   K  K+RG GF K C+LSP L
Sbjct  118  KRRFNKLNKVVKRRGGGFTKLCSLSPAL  145



>ref|XP_008792593.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Phoenix dactylifera]
Length=267

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 83/148 (56%), Gaps = 8/148 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LE   GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEGDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKN-----ENLDSQKEGTVkeeeiddqdekeeedtdekSTQ  439
               +NK     D S   + +++          Q+E    + + D+ +E E       S++
Sbjct  60   --NDNKEGEEEDGSGGEEGDRHGEEGSGEEGDQEEEEDDDGDEDENEEDEGTSNGVGSSR  117

Query  440  KAKSNTKEKDDKKRGKGFNKPCALSPQL  523
            K + N   K  K+RG GF K C+LSP L
Sbjct  118  KRRFNKLNKVVKRRGGGFTKLCSLSPAL  145



>ref|XP_007047160.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX91317.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=322

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 17/149 (11%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MV DSEL+ RL + L++++L T T A VRRRLEE   + L ++K FIR+Q+DL+LQ+   
Sbjct  1    MVLDSELIARLREFLKESDLNTTTTAIVRRRLEEDFRIDLSEKKKFIREQVDLYLQSQFE  60

Query  272  -----VTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekST  436
                    Q ++     D +  +K E+ +  DS +E             + E   +++++
Sbjct  61   NAEEQEQEQEDENNEEDDQTAKIKSEETDGSDSNEEEE-----------ESERARNKRAS  109

Query  437  QKAKSNTKEKDDKKRGKGFNKPCALSPQL  523
             K  S     + K+RG GFNK C+LSPQL
Sbjct  110  AKKGSKRVNNEVKRRGGGFNKVCSLSPQL  138



>ref|XP_011458335.1| PREDICTED: upstream activation factor subunit spp27 isoform X5 
[Fragaria vesca subsp. vesca]
Length=381

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+L+ RL +IL  ++L+TATA SVRR LE+  G  L DRKAFIRDQID++L++ V 
Sbjct  1    MVSESDLLTRLREILSSSDLDTATAGSVRRELEKHFGADLSDRKAFIRDQIDIYLESQVA  60

Query  275  TPQ  283
              Q
Sbjct  61   NHQ  63



>ref|XP_011626436.1| PREDICTED: upstream activation factor subunit spp27 [Amborella 
trichopoda]
Length=303

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 76/146 (52%), Gaps = 31/146 (21%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + L  A+L T T ++VR+ LE + GV L ++KAFIRDQI+L+      
Sbjct  1    MVSDSELVERLKEFLSTADLNTTTNSTVRKHLENEFGVDLSEKKAFIRDQINLYF-----  55

Query  275  TPQNNKVQRGPDDSENVKQEKNENLD-SQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
                       D  E  ++ K E  D S+ EG             E+   +E+  +   S
Sbjct  56   -----------DSLEGNEETKEEGRDPSESEGE------------EDRAVEEEEEKGKGS  92

Query  452  NTKEKDDKKR--GKGFNKPCALSPQL  523
              +   DKKR  G GF+KPC LSP+L
Sbjct  93   KRRMSKDKKRTGGGGFSKPCGLSPEL  118



>ref|XP_008792591.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Phoenix dactylifera]
Length=327

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LE   GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEGDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdek-----STQ  439
               +NK     D S   + +++    S +EG  +EEE DD DE E E+ +       S++
Sbjct  60   --NDNKEGEEEDGSGGEEGDRHGEEGSGEEGDQEEEEDDDGDEDENEEDEGTSNGVGSSR  117

Query  440  KAKSNTKEKDDKKRGKGFNKPCALSPQL  523
            K + N   K  K+RG GF K C+LSP L
Sbjct  118  KRRFNKLNKVVKRRGGGFTKLCSLSPAL  145



>ref|XP_008792590.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Phoenix dactylifera]
Length=328

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL + LR ++L T T A VRR+LE   GV L D+KAFIR+Q+DLFL + + 
Sbjct  1    MVSDSELVERLREFLRASDLSTTTTAIVRRKLEGDFGVDLSDKKAFIREQVDLFLHSEL-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdek-----STQ  439
               +NK     D S   + +++    S +EG  +EEE DD DE E E+ +       S++
Sbjct  60   --NDNKEGEEEDGSGGEEGDRHGEEGSGEEGDQEEEEDDDGDEDENEEDEGTSNGVGSSR  117

Query  440  KAKSNTKEKDDKKRGKGFNKPCALSPQL  523
            K + N   K  K+RG GF K C+LSP L
Sbjct  118  KRRFNKLNKVVKRRGGGFTKLCSLSPAL  145



>gb|AES94759.2| upstream activation factor subunit UAF30, putative [Medicago 
truncatula]
Length=344

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT--H  268
            MVS+SEL+ RL + LR+++L T T ++VRR+LE   G+ L DRK+FIR+Q+DLFLQT   
Sbjct  1    MVSESELIDRLREFLRNSDLNTTTTSTVRRQLESDFGIDLSDRKSFIREQVDLFLQTVQQ  60

Query  269  VVTPQNNKVQ  298
               PQN+ V+
Sbjct  61   DDEPQNDAVE  70



>ref|XP_002883161.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59420.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=463

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 82/143 (57%), Gaps = 17/143 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD +LV RL +IL  ++L TAT ASVRR+LE   G+ L D+KA+IRDQID FL++   
Sbjct  1    MVSDLDLVTRLREILGSSDLNTATPASVRRQLEADFGIDLTDKKAYIRDQIDTFLES---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N  V+  P+ S   K E++ N +  K   ++  + +D D    E  +EK  +  K+ 
Sbjct  58   ---NGAVEDKPESS---KPEEDINAEEIK-AEIEGGDGEDLDGDGSESEEEKEERPVKA-  109

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG GF K   LSPQL
Sbjct  110  ------KKRGGGFTKVSQLSPQL  126



>ref|XP_010419877.1| PREDICTED: uncharacterized protein LOC104705555 [Camelina sativa]
Length=541

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 78/143 (55%), Gaps = 11/143 (8%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD +LV RL +IL  ++LE AT ASVRR+LE   GV   D+KAFIRDQID FL+T   
Sbjct  1    MVSDLDLVTRLREILGSSDLEKATPASVRRQLETDFGVDFTDKKAFIRDQIDAFLET---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N  V+   ++ E  K E + + D      +K E      E E+ D D  S  + +  
Sbjct  58   ---NGAVEEEEEEEETPKAEHDSDADG-----IKSEIEVADGEGEDGDGDGGSESEEEKE  109

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             +    KKRG GF K   LSPQL
Sbjct  110  ERPVKAKKRGGGFTKVSQLSPQL  132



>ref|XP_004511971.1| PREDICTED: upstream activation factor subunit spp27-like [Cicer 
arietinum]
Length=352

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 6/74 (8%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+SEL+GRL + LR ++L T T ++VRR+LE   G+ L DRKAFIR+Q+DLFLQ+   
Sbjct  1    MVSESELIGRLREFLRSSDLNTTTTSTVRRQLESDFGIDLSDRKAFIREQVDLFLQSVQQ  60

Query  275  T------PQNNKVQ  298
                   PQN+ V+
Sbjct  61   QQDAQEEPQNDDVE  74



>ref|XP_003611801.1| Upstream activation factor subunit spp27 [Medicago truncatula]
Length=361

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT--H  268
            MVS+SEL+ RL + LR+++L T T ++VRR+LE   G+ L DRK+FIR+Q+DLFLQT   
Sbjct  1    MVSESELIDRLREFLRNSDLNTTTTSTVRRQLESDFGIDLSDRKSFIREQVDLFLQTVQQ  60

Query  269  VVTPQNNKVQ  298
               PQN+ V+
Sbjct  61   DDEPQNDAVE  70



>ref|XP_010317157.1| PREDICTED: LOW QUALITY PROTEIN: upstream activation factor subunit 
spp27-like [Solanum lycopersicum]
Length=324

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV R+ + L  A+L+T T   VRR+LEE   + L DRK FIR+QIDL+L+++  
Sbjct  1    MVSDSELVDRIHEFLSTADLDTTTNNIVRRKLEEDFNIDLSDRKVFIREQIDLYLESYY-  59

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
              Q N+ Q        V+ ++ E+ +  +E    EEE D ++ K  +  + KS++K K  
Sbjct  60   --QINQEQM------EVENDQEEDPEEDEEEEDPEEEEDLEESKAVDKAEGKSSEK-KPG  110

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
             K +  K++  GF K C+LSPQL
Sbjct  111  KKNESGKRKAGGFTKICSLSPQL  133



>ref|XP_010536330.1| PREDICTED: synaptonemal complex protein 1 isoform X5 [Tarenaya 
hassleriana]
Length=1056

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+L  RL +ILR ++L+TAT ASVRR+LE   GV L +RK FIR+QID FL++   
Sbjct  1    MVSDSDLATRLREILRSSDLDTATPASVRRQLEADFGVDLTERKGFIREQIDAFLESDGG  60

Query  266  HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                P+N  V+      E+   E+N + ++++EG             E ED       + 
Sbjct  61   EGEKPENQMVE------EDCNAEQNYDGEAKEEGD-----------GEGEDDGGSEGDEG  103

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            K     K  K+RG GF+K   LSPQL
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQL  129



>ref|XP_010536329.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
isoform X4 [Tarenaya hassleriana]
Length=1056

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+L  RL +ILR ++L+TAT ASVRR+LE   GV L +RK FIR+QID FL++   
Sbjct  1    MVSDSDLATRLREILRSSDLDTATPASVRRQLEADFGVDLTERKGFIREQIDAFLESDGG  60

Query  266  HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                P+N  V+      E+   E+N + ++++EG             E ED       + 
Sbjct  61   EGEKPENQMVE------EDCNAEQNYDGEAKEEGD-----------GEGEDDGGSEGDEG  103

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            K     K  K+RG GF+K   LSPQL
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQL  129



>ref|XP_010536328.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X3 [Tarenaya hassleriana]
Length=1056

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+L  RL +ILR ++L+TAT ASVRR+LE   GV L +RK FIR+QID FL++   
Sbjct  1    MVSDSDLATRLREILRSSDLDTATPASVRRQLEADFGVDLTERKGFIREQIDAFLESDGG  60

Query  266  HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                P+N  V+      E+   E+N + ++++EG             E ED       + 
Sbjct  61   EGEKPENQMVE------EDCNAEQNYDGEAKEEGD-----------GEGEDDGGSEGDEG  103

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            K     K  K+RG GF+K   LSPQL
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQL  129



>ref|XP_010536327.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X2 [Tarenaya hassleriana]
Length=1056

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+L  RL +ILR ++L+TAT ASVRR+LE   GV L +RK FIR+QID FL++   
Sbjct  1    MVSDSDLATRLREILRSSDLDTATPASVRRQLEADFGVDLTERKGFIREQIDAFLESDGG  60

Query  266  HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                P+N  V+      E+   E+N + ++++EG             E ED       + 
Sbjct  61   EGEKPENQMVE------EDCNAEQNYDGEAKEEGD-----------GEGEDDGGSEGDEG  103

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            K     K  K+RG GF+K   LSPQL
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQL  129



>ref|XP_010536324.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010536326.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
Length=1057

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT---  265
            MVSDS+L  RL +ILR ++L+TAT ASVRR+LE   GV L +RK FIR+QID FL++   
Sbjct  1    MVSDSDLATRLREILRSSDLDTATPASVRRQLEADFGVDLTERKGFIREQIDAFLESDGG  60

Query  266  HVVTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKA  445
                P+N  V+      E+   E+N + ++++EG             E ED       + 
Sbjct  61   EGEKPENQMVE------EDCNAEQNYDGEAKEEGD-----------GEGEDDGGSEGDEG  103

Query  446  KSNTKEKDDKKRGKGFNKPCALSPQL  523
            K     K  K+RG GF+K   LSPQL
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQL  129



>ref|NP_188538.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AEE76191.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=462

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 79/143 (55%), Gaps = 17/143 (12%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD +LV RL +IL  ++L TAT ASVRR+LE   GV L D+KA+IRDQID FL++   
Sbjct  1    MVSDLDLVTRLREILGSSDLNTATPASVRRQLEADFGVDLTDKKAYIRDQIDTFLES---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N  V+  P   E+ K E+  N D  K   ++  + +D D       +EK  +  K+ 
Sbjct  58   ---NGAVEDKP---ESPKVEEYINADEIK-AEIEGGDGEDLDGDGSGSEEEKEERPVKA-  109

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG G  K   LSPQL
Sbjct  110  ------KKRGGGITKVSQLSPQL  126



>tpg|DAA51565.1| TPA: hypothetical protein ZEAMMB73_913346, partial [Zea mays]
Length=249

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            +VSDSELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL
Sbjct  3    LVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL  57



>ref|XP_010229398.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Brachypodium distachyon]
Length=299

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++L+D++L T T  ++RRRLEE  GV L D+KAF+R+Q+D+ L
Sbjct  1    MVSDSELVERLREVLKDSDLTTTTTGALRRRLEEDFGVDLSDKKAFVREQVDILL  55



>ref|XP_004981658.1| PREDICTED: upstream activation factor subunit spp27-like [Setaria 
italica]
Length=332

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR ++L T T A++RRRLEE+ G  L  +KAFIR+Q+DL+L
Sbjct  1    MVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEEFGTDLSHKKAFIREQVDLYL  55



>gb|AGT16808.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=326

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL
Sbjct  1    MVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL  55



>ref|XP_002466401.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
 gb|EER93399.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
Length=326

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL
Sbjct  1    MVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL  55



>gb|AGT16365.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
 gb|AGT16695.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=332

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR ++L T T A++RRRLEE  G  L  +KAFIR+Q+DLFL
Sbjct  1    MVSDSELVERLQEVLRSSDLNTTTTAALRRRLEEDFGADLSHKKAFIREQVDLFL  55



>ref|XP_003558997.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Brachypodium distachyon]
Length=334

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++L+D++L T T  ++RRRLEE  GV L D+KAF+R+Q+D+ L
Sbjct  1    MVSDSELVERLREVLKDSDLTTTTTGALRRRLEEDFGVDLSDKKAFVREQVDILL  55



>ref|XP_010489932.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104767632 
[Camelina sativa]
Length=437

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTH  268
            MVSD +LV RL +IL  ++LE AT ASVRR+LE   GV   D+KAFIRDQID FL+T+
Sbjct  1    MVSDLDLVTRLREILGSSDLEKATPASVRRQLETDFGVDFTDKKAFIRDQIDAFLETN  58



>ref|XP_009587440.1| PREDICTED: upstream activation factor subunit UAF30-like [Nicotiana 
tomentosiformis]
Length=344

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 89/144 (62%), Gaps = 1/144 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV-  271
            MVSDSELVGRL + L  ++L T T  +VRR+LEE  G+ L D+KAFIR+Q+DL+L++   
Sbjct  1    MVSDSELVGRLREFLSTSDLTTTTTTAVRRKLEEDFGIDLSDKKAFIREQVDLYLESQFQ  60

Query  272  VTPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
            +  Q N+ +   +  E    E ++  +      V+EEE ++++E E     ++ + K KS
Sbjct  61   LDQQKNEGEMHEEVDEGPSAEVSDEEEDAVNEEVEEEEEEEEEESEAVTKIKRRSSKKKS  120

Query  452  NTKEKDDKKRGKGFNKPCALSPQL  523
              K ++ K++  GF K C+LSPQL
Sbjct  121  EKKNENVKRKAGGFTKVCSLSPQL  144



>gb|EYU44365.1| hypothetical protein MIMGU_mgv1a025674mg [Erythranthe guttata]
Length=305

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSEL+ RL + L  ++L T T A VRRRLE++  + L DRKAFIR+Q+D+++Q+   
Sbjct  1    MVSDSELIERLREFLSTSDLNTTTTAIVRRRLEQEFDIDLSDRKAFIREQVDVYMQSQFE  60

Query  275  TPQNNK  292
            +  NN+
Sbjct  61   SVANNE  66



>dbj|BAB01706.1| unnamed protein product [Arabidopsis thaliana]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTH  268
            MVSD +LV RL +IL  ++L TAT ASVRR+LE   GV L D+KA+IRDQID FL+++
Sbjct  1    MVSDLDLVTRLREILGSSDLNTATPASVRRQLEADFGVDLTDKKAYIRDQIDTFLESN  58



>ref|XP_006650641.1| PREDICTED: upstream activation factor subunit spp27-like [Oryza 
brachyantha]
Length=338

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR+++L T T A +RRRLEE  GV L D+K FIR+Q+DL L
Sbjct  1    MVSDSELVERLREVLRESDLNTTTTAILRRRLEEDFGVDLSDKKLFIREQVDLLL  55



>ref|XP_006297542.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
 gb|EOA30440.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
Length=483

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  92   KMVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTH  268
            KMVSD ++V RL +IL  ++L+TAT A+VRR+LE   GV   D+KAFIRDQID FL+++
Sbjct  77   KMVSDLDIVTRLREILGSSDLDTATPATVRRQLEADFGVDFTDKKAFIRDQIDAFLESN  135



>gb|AAL34119.1|AC090713_6 putative parathymosin [Oryza sativa Japonica Group]
Length=303

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 85/145 (59%), Gaps = 2/145 (1%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDSELV RL ++LR ++L T T A +RRRLEE  GV L D+K FIR+Q+DL L     
Sbjct  1    MVSDSELVERLREVLRSSDLNTTTTAILRRRLEEDFGVDLSDKKLFIREQVDLLLSEVAG  60

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAK--  448
              +  + +   ++      E         EG  +EEE ++++E+EEE+ ++ S  + K  
Sbjct  61   KAEQEEAEVPKEEEPETGAEAAGGEPGGAEGEGEEEEEEEEEEEEEEEEEDSSGSRKKRR  120

Query  449  SNTKEKDDKKRGKGFNKPCALSPQL  523
            S+    D K++G GF K C++SP L
Sbjct  121  SDGANTDGKRKGGGFTKLCSISPTL  145



>ref|XP_011099216.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Sesamum indicum]
Length=324

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+EL+ RL + L  ++L T T A VRRRLEE  G+ L DRK FIR+Q+D+++Q+   
Sbjct  1    MVSDTELIERLREFLSTSDLNTTTTAIVRRRLEEDFGIDLSDRKGFIREQVDVYMQSQFE  60

Query  275  TPQNN  289
               +N
Sbjct  61   NADDN  65



>ref|XP_011099215.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Sesamum indicum]
Length=325

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSD+EL+ RL + L  ++L T T A VRRRLEE  G+ L DRK FIR+Q+D+++Q+   
Sbjct  1    MVSDTELIERLREFLSTSDLNTTTTAIVRRRLEEDFGIDLSDRKGFIREQVDVYMQSQFE  60

Query  275  TPQNN  289
               +N
Sbjct  61   NADDN  65



>gb|ABF99032.1| SWIB complex BAF60b domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEC76232.1| hypothetical protein OsI_13647 [Oryza sativa Indica Group]
 gb|EEE59982.1| hypothetical protein OsJ_12695 [Oryza sativa Japonica Group]
Length=334

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR ++L T T A +RRRLEE  GV L D+K FIR+Q+DL L
Sbjct  1    MVSDSELVERLREVLRSSDLNTTTTAILRRRLEEDFGVDLSDKKLFIREQVDLLL  55



>gb|ACJ85465.1| unknown [Medicago truncatula]
Length=320

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT--H  268
            MVS+SEL+ RL + LR+++  T T ++VRR+LE   G+ L DRK+FIR Q DLFLQT   
Sbjct  1    MVSESELIDRLREFLRNSDPNTTTTSTVRRQLESDFGIDLSDRKSFIRGQADLFLQTVQQ  60

Query  269  VVTPQNNKVQ  298
               PQN+ V+
Sbjct  61   DDEPQNDAVE  70



>gb|ABK24867.1| unknown [Picea sitchensis]
Length=297

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 9/144 (6%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MV + E+  RL +IL+ A+L T T  S+RR+LEE+LGV L  +KAFIR+Q+DL+L     
Sbjct  1    MVLEQEIAERLKEILQTADLTTTTTTSIRRKLEEELGVDLTSKKAFIREQVDLYLLQQQQ  60

Query  275  TPQNNKVQRGPDDSENVKQE-KNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKS  451
              +NN+V+   D  E ++ E K E   S++ G       +++DE+E+ED       K  S
Sbjct  61   QLENNEVKEEAD--EGIENEVKEEEHSSEQPGD------EEEDEEEDEDEGSGKRSKKSS  112

Query  452  NTKEKDDKKRGKGFNKPCALSPQL  523
            + KEK  K  G GFNK C LSP+L
Sbjct  113  SNKEKSRKGTGGGFNKLCGLSPEL  136



>ref|XP_009803137.1| PREDICTED: protein TRI1-like isoform X2 [Nicotiana sylvestris]
Length=319

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV  271
            MVSDSELVGRL + L  ++L T T  +VRR+LEE  G+ L D+KAFIR+Q+DL+L++  
Sbjct  1    MVSDSELVGRLREFLSTSDLTTTTTTAVRRKLEEDFGIDLSDKKAFIREQVDLYLESQF  59



>ref|XP_009803136.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Nicotiana sylvestris]
Length=340

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV  271
            MVSDSELVGRL + L  ++L T T  +VRR+LEE  G+ L D+KAFIR+Q+DL+L++  
Sbjct  1    MVSDSELVGRLREFLSTSDLTTTTTTAVRRKLEEDFGIDLSDKKAFIREQVDLYLESQF  59



>gb|EMS67367.1| Upstream activation factor subunit spp27 [Triticum urartu]
Length=489

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDSELV RL ++LR+++L T T  ++RRRLEE  GV L D+K F+R+Q+DL L
Sbjct  1    MVSDSELVERLREVLRESDLTTTTTGALRRRLEEDFGVDLSDKKTFVREQVDLLL  55



>gb|KFK36005.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=371

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDS+LV RL +ILR+++L+T T A+VRR+LE    V L D+KAF+R+QID +L
Sbjct  1    MVSDSDLVTRLREILRNSDLDTTTPANVRRQLEAYFSVELTDKKAFVREQIDAYL  55



>gb|KFK36004.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=370

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSDS+LV RL +ILR+++L+T T A+VRR+LE    V L D+KAF+R+QID +L
Sbjct  1    MVSDSDLVTRLREILRNSDLDTTTPANVRRQLEAYFSVELTDKKAFVREQIDAYL  55



>ref|XP_009397729.1| PREDICTED: upstream activation factor subunit UAF30-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            MVSD+ELVGRL ++LR ++L T T  SVRR+LEE  G+ L D+KAFIR Q+DLFL
Sbjct  1    MVSDAELVGRLREVLRASDLSTTTTTSVRRQLEEDFGIDLSDKKAFIRQQVDLFL  55



>emb|CDX92300.1| BnaA05g21070D [Brassica napus]
Length=452

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 69/143 (48%), Gaps = 34/143 (24%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVS+S+LV RL +IL  ++LET T A+VRR+LE   GV L ++KAFIRDQID FL++   
Sbjct  1    MVSESDLVTRLREILSSSDLETTTPATVRRQLEADFGVELTEKKAFIRDQIDAFLES---  57

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
               N  V+  P   +  +  + E+                               + K  
Sbjct  58   ---NGGVEENPVSPKAEEDAEEED----------------------------DGDEEKEE  86

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
               K  K+ G GF K C LSPQL
Sbjct  87   RPVKAKKRGGGGFAKVCQLSPQL  109



>ref|XP_010691015.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=335

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+L+ RL +IL+ ++L T +A +VRR+L+E  GV L DRK FI  QID  LQ   +
Sbjct  1    MVSDSDLITRLREILQASDLNTTSAGAVRRQLQEDFGVDLSDRKKFISQQIDEILQADEI  60

Query  275  TPQNNKVQRGP---DDSEN  322
                +     P   DD+EN
Sbjct  61   NGAEDDNVTPPTEEDDAEN  79



>gb|ABK26533.1| unknown [Picea sitchensis]
Length=299

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 78/153 (51%), Gaps = 32/153 (21%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAA-SVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTH-  268
            MVSD ELVGRL  +LR  +  T T A S+R++LE + GV L D++AFI   I+L++Q H 
Sbjct  1    MVSDEELVGRLETLLRHVDFSTITTADSIRQKLEGEFGVKLGDKEAFISHHINLYIQCHR  60

Query  269  --VVTPQNNKVQRGPDDSENVKQ----EKNENLDSQKEGTVkeeeiddqdekeeedtdek  430
              V    +N+ +  P     V++    E+N +++ +++                      
Sbjct  61   PLVSAWVHNEHRYHPQLEAKVEEAGRNEENAHMEVKEQ----------------------  98

Query  431  STQKAKSNTKEKDDKKRGK--GFNKPCALSPQL  523
            + ++    +   + +KRG+  G NK C +SP+L
Sbjct  99   NIEEPIKESTLLEGRKRGRPGGLNKICGVSPEL  131



>ref|XP_010691016.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            MVSDS+L+ RL +IL+ ++L T +A +VRR+L+E  GV L DRK FI  QID  LQ   +
Sbjct  1    MVSDSDLITRLREILQASDLNTTSAGAVRRQLQEDFGVDLSDRKKFISQQIDEILQADEI  60

Query  275  TPQNNKVQRGP---DDSEN  322
                +     P   DD+EN
Sbjct  61   NGAEDDNVTPPTEEDDAEN  79



>gb|KHN36203.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=354

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 9/124 (7%)
 Frame = +2

Query  170  ASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVVTPQNNKVQRGPDDSENVKQEKNENL  349
            A+VRR+LE   G+ L DRKAFIR+Q+DLFLQT    PQ    +R  DD E  ++E   N 
Sbjct  83   ATVRRQLEADFGIDLSDRKAFIREQVDLFLQTEHNQPQQE--ERQNDDVEE-QEEDAPNN  139

Query  350  DSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN----TKEKDD--KKRGKGFNKPCAL  511
              Q + +  +EE D+++E EEE+   +  + AK N     K  D+  KKRG GF K C+L
Sbjct  140  PEQSQPSDSKEETDEEEEGEEEEDKPEQAKNAKKNKGRSNKLGDEVVKKRGGGFCKLCSL  199

Query  512  SPQL  523
            SPQL
Sbjct  200  SPQL  203



>ref|XP_001768652.1| predicted protein [Physcomitrella patens]
 gb|EDQ66590.1| predicted protein [Physcomitrella patens]
Length=308

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQ  262
            MVSD+E+V  L  +L+ A+L T T   +R++L+  LGV L D+KAFIR Q+DL+LQ
Sbjct  1    MVSDAEIVRHLTAVLKKADLNTTTTTEIRQQLQSDLGVDLSDKKAFIRQQVDLYLQ  56



>ref|XP_002508564.1| animal specific-mbd4, 5 and 6 [Micromonas sp. RCC299]
 gb|ACO69822.1| animal specific-mbd4, 5 and 6 [Micromonas sp. RCC299]
Length=288

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  104  DSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHV  271
            DS+++ RL  IL+ A+LE  T  +++++LE  LGV + DRK FIR++++ FL+++ 
Sbjct  16   DSQVIKRLHQILKTADLEKTTVKNIQKQLEADLGVPMSDRKQFIREEVEKFLKSNA  71



>ref|XP_002979488.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
 gb|EFJ19377.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
Length=320

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            +V+DS++V  +  +L  A+L T + + +R  LE+ LGV L  +K FIR Q+D FL  +  
Sbjct  17   LVADSDIVREIGLVLNSADLSTTSMSDIRAVLEKNLGVELAHKKDFIRQQVDEFLAHNTS  76

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                  + +G D+  N      E      E ++  ++  +Q  +  E   E ST K K  
Sbjct  77   L---GSLVKG-DEEANATAPAQEEQQGTAEDSLPNDQELEQFRENIELAIEDSTPKEK--  130

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG G NK C LSP+L
Sbjct  131  ------KKRG-GLNKLCRLSPEL  146



>ref|XP_002977839.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
 gb|EFJ21177.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
Length=342

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQTHVV  274
            +V+DS++V  +  +L  A+L T + + +R  LE+ LGV L  +K FIR Q+D FL  +  
Sbjct  17   LVADSDIVREIGLVLNSADLSTTSMSDIRAVLEKNLGVELAHKKDFIRQQVDEFLAHNTS  76

Query  275  TPQNNKVQRGPDDSENVKQEKNENLDSQKEGTVkeeeiddqdekeeedtdekSTQKAKSN  454
                  + +G D+  N      E      E ++  ++  +Q  +  E   E ST K K  
Sbjct  77   L---GSLVKG-DEEANATAPAQEEQQGTAEDSLPNDQELEQFRENIELAIEDSTPKEK--  130

Query  455  TKEKDDKKRGKGFNKPCALSPQL  523
                  KKRG G NK C LSP+L
Sbjct  131  ------KKRG-GLNKLCRLSPEL  146



>ref|XP_010680445.1| PREDICTED: uncharacterized protein LOC104895589 [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFLQT  265
            MVSD+EL  ++ + LR ++L+  T   V  +LE   GV L D+K F+R+Q+D FLQ+
Sbjct  1    MVSDAELAEKVHEFLRGSDLKKTTNNIVITKLESDFGVDLSDKKPFLRNQVDRFLQS  57



>ref|XP_002985006.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
 gb|EFJ13881.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
Length=311

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  95   MVSDSELVGRLWDILRDANLETATAASVRRRLEEQLGVCLLDRKAFIRDQIDLFL  259
            M  D+ +  R+ +IL  ANL   ++  +R+++EE++GV L  +KAF+R+QI+ F+
Sbjct  1    MPPDAAIAKRVREILASANLSEVSSKDIRKQMEEEMGVSLRSKKAFLREQIESFM  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 583217858240