BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4601

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610601.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        345   1e-112   Nicotiana tomentosiformis
ref|XP_006345964.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    343   1e-111   Solanum tuberosum [potatoes]
ref|XP_009791207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    340   4e-111   Nicotiana sylvestris
ref|XP_004239793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        340   2e-110   Solanum lycopersicum
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    333   2e-108   Sesamum indicum [beniseed]
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    330   3e-107   Nicotiana tomentosiformis
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    329   4e-107   Nicotiana sylvestris
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      328   1e-106   Solanum lycopersicum
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    324   6e-105   Solanum tuberosum [potatoes]
emb|CDP00093.1|  unnamed protein product                                323   9e-105   Coffea canephora [robusta coffee]
gb|AHL24655.1|  Fra e 9.02 allergen                                     314   5e-101   Fraxinus excelsior
gb|EPS63364.1|  glycoside hydrolase                                     313   6e-101   Genlisea aurea
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                310   8e-100   Erythranthe guttata [common monkey flower]
gb|AHL24654.1|  Fra e 9.01 allergen                                     296   5e-94    Fraxinus excelsior
gb|EPS69142.1|  hypothetical protein M569_05624                         291   2e-93    Genlisea aurea
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    291   3e-92    
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        285   9e-90    Glycine max [soybeans]
ref|XP_008233624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    285   1e-89    Prunus mume [ume]
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                283   3e-89    Erythranthe guttata [common monkey flower]
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   280   3e-88    Medicago truncatula
gb|KGN50541.1|  hypothetical protein Csa_5G181480                       279   7e-88    Cucumis sativus [cucumbers]
ref|XP_004147695.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        279   1e-87    Cucumis sativus [cucumbers]
ref|XP_008342287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    276   1e-87    
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        279   1e-87    Cucumis melo [Oriental melon]
ref|XP_008382814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   1e-86    Malus domestica [apple tree]
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    276   1e-86    Cicer arietinum [garbanzo]
dbj|BAB40807.1|  endo-1,3-beta-glucanase-like protein                   275   1e-86    Pyrus pyrifolia [sha li]
ref|XP_009357725.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    275   1e-86    
ref|XP_008382813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   1e-85    
ref|XP_004307514.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    274   2e-85    Fragaria vesca subsp. vesca
ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    273   4e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    273   6e-85    
ref|XP_008343598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    268   1e-84    
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        270   4e-84    Vitis vinifera
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        267   5e-83    Eucalyptus grandis [rose gum]
ref|XP_007220314.1|  hypothetical protein PRUPE_ppa005160m1g            263   7e-83    
ref|XP_009357726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        268   8e-83    
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 266   8e-83    Pyrus x bretschneideri x Pyrus pyrifolia
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             265   2e-82    Phaseolus vulgaris [French bean]
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    264   7e-82    
ref|XP_008362701.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    265   7e-82    Malus domestica [apple tree]
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    263   1e-81    Malus domestica [apple tree]
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    263   2e-81    
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    260   3e-80    Ricinus communis
ref|XP_009343476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        261   3e-80    Pyrus x bretschneideri [bai li]
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    260   3e-80    Nelumbo nucifera [Indian lotus]
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    259   8e-80    Populus euphratica
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             256   9e-79    Populus trichocarpa [western balsam poplar]
gb|ABK95730.1|  unknown                                                 256   9e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    254   4e-78    Elaeis guineensis
emb|CAB85903.1|  beta-1,3 glucanase                                     254   9e-78    Pisum sativum [garden pea]
ref|XP_002312098.1|  glucan endo-1 family protein                       253   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_011470609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    259   1e-77    Fragaria vesca subsp. vesca
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    253   2e-77    Populus euphratica
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        252   5e-77    Nelumbo nucifera [Indian lotus]
ref|XP_012089256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    251   1e-76    Jatropha curcas
ref|XP_012089248.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    250   1e-76    
gb|AAM66982.1|  beta-1,3-glucanase-like protein                         250   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein               250   2e-76    Arabidopsis thaliana [mouse-ear cress]
gb|AAK76666.1|  putative beta-1,3-glucanase                             250   2e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KCW85568.1|  hypothetical protein EUGRSUZ_B02365                     246   3e-76    Eucalyptus grandis [rose gum]
ref|XP_010043554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    246   4e-76    Eucalyptus grandis [rose gum]
ref|XP_010516112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    249   5e-76    Camelina sativa [gold-of-pleasure]
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        249   7e-76    Phoenix dactylifera
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg             248   1e-75    Eutrema salsugineum [saltwater cress]
ref|XP_010043553.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    246   2e-75    Eucalyptus grandis [rose gum]
ref|XP_010504397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    248   2e-75    Camelina sativa [gold-of-pleasure]
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970             247   2e-75    
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    247   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             246   1e-74    
gb|KJB37375.1|  hypothetical protein B456_006G202300                    247   1e-74    Gossypium raimondii
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        245   2e-74    Malus domestica [apple tree]
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    245   3e-74    
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     244   3e-74    Eucalyptus grandis [rose gum]
ref|XP_010427314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    244   3e-74    Camelina sativa [gold-of-pleasure]
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg             244   6e-74    Capsella rubella
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    245   6e-74    Eucalyptus grandis [rose gum]
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            243   2e-73    
emb|CDY41232.1|  BnaC08g26260D                                          243   2e-73    Brassica napus [oilseed rape]
gb|KFK34786.1|  hypothetical protein AALP_AA5G193500                    242   2e-73    Arabis alpina [alpine rockcress]
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             242   2e-73    Citrus clementina [clementine]
ref|XP_011658156.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        243   2e-73    Cucumis sativus [cucumbers]
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        243   2e-73    Gossypium arboreum [tree cotton]
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    242   2e-73    Citrus sinensis [apfelsine]
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             242   3e-73    Populus trichocarpa [western balsam poplar]
emb|CDY41234.1|  BnaC08g26240D                                          242   3e-73    Brassica napus [oilseed rape]
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        241   5e-73    Tarenaya hassleriana [spider flower]
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        241   5e-73    Vitis vinifera
ref|XP_008810606.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        238   6e-73    
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    241   6e-73    Solanum tuberosum [potatoes]
emb|CDY53692.1|  BnaA07g37860D                                          241   8e-73    Brassica napus [oilseed rape]
emb|CDP21469.1|  unnamed protein product                                241   9e-73    Coffea canephora [robusta coffee]
emb|CDY62387.1|  BnaCnng40170D                                          240   1e-72    Brassica napus [oilseed rape]
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        243   1e-72    
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    240   1e-72    Elaeis guineensis
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        241   2e-72    Gossypium arboreum [tree cotton]
emb|CDY40218.1|  BnaA09g35000D                                          240   2e-72    Brassica napus [oilseed rape]
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    240   2e-72    Brassica rapa
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    239   3e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    239   3e-72    
gb|KDP35193.1|  hypothetical protein JCGZ_09352                         239   4e-72    Jatropha curcas
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    239   5e-72    Brassica rapa
ref|XP_012075168.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    239   5e-72    Jatropha curcas
ref|XP_009419749.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    239   6e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009620579.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    236   6e-72    
emb|CDY40219.1|  BnaA09g35010D                                          238   6e-72    Brassica napus [oilseed rape]
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    236   6e-72    
ref|XP_012075958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   9e-72    Jatropha curcas
gb|KJB83778.1|  hypothetical protein B456_013G263800                    239   1e-71    Gossypium raimondii
ref|XP_012075957.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   1e-71    Jatropha curcas
ref|XP_011027355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        238   1e-71    Populus euphratica
ref|XP_011654593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   1e-71    Cucumis sativus [cucumbers]
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    237   2e-71    Solanum lycopersicum
ref|XP_009799239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    235   2e-71    Nicotiana sylvestris
ref|XP_006846179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        238   3e-71    Amborella trichopoda
ref|XP_002315222.2|  hypothetical protein POPTR_0010s21130g             238   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_007016412.1|  O-Glycosyl hydrolases family 17 protein isof...    236   3e-71    
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    236   4e-71    Nicotiana sylvestris
emb|CDX76097.1|  BnaA04g03610D                                          236   5e-71    
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   236   9e-71    
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    237   9e-71    
gb|KJB23726.1|  hypothetical protein B456_004G111800                    233   1e-70    Gossypium raimondii
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        236   1e-70    Cucumis melo [Oriental melon]
emb|CDY02936.1|  BnaC04g25500D                                          234   2e-70    
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    236   2e-70    Populus euphratica
ref|XP_011654592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   3e-70    Cucumis sativus [cucumbers]
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             236   3e-70    Prunus persica
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    235   3e-70    Ricinus communis
ref|XP_009139167.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    234   3e-70    Brassica rapa
ref|XP_010318035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        231   4e-70    Solanum lycopersicum
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    235   4e-70    Populus euphratica
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    235   5e-70    Pyrus x bretschneideri [bai li]
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    235   5e-70    Pyrus x bretschneideri [bai li]
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    235   6e-70    Pyrus x bretschneideri [bai li]
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    233   6e-70    Arabis alpina [alpine rockcress]
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             233   8e-70    Prunus persica
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        234   8e-70    Eucalyptus grandis [rose gum]
emb|CDP05033.1|  unnamed protein product                                233   1e-69    Coffea canephora [robusta coffee]
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        233   1e-69    Prunus mume [ume]
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        231   3e-69    
ref|XP_010519454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   3e-69    Tarenaya hassleriana [spider flower]
emb|CDX87130.1|  BnaC09g04450D                                          231   9e-69    
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    232   1e-68    Prunus mume [ume]
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             230   1e-68    Citrus clementina [clementine]
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        230   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_003588492.1|  Glucan endo-1,3-beta-glucosidase                   227   1e-68    
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    231   1e-68    Populus euphratica
ref|XP_006350517.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    228   2e-68    Solanum tuberosum [potatoes]
ref|XP_007013798.1|  O-Glycosyl hydrolases family 17 protein, put...    229   3e-68    
ref|XP_010519453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   3e-68    Tarenaya hassleriana [spider flower]
emb|CBI16129.3|  unnamed protein product                                226   3e-68    Vitis vinifera
ref|XP_003561280.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    229   4e-68    Brachypodium distachyon [annual false brome]
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    229   4e-68    
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            228   5e-68    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151227.1|  glucan endo-1,3-beta-glucosidase precursor         229   5e-68    Zea mays [maize]
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    230   5e-68    Fragaria vesca subsp. vesca
gb|ERM95173.1|  hypothetical protein AMTR_s00009p00263650               229   5e-68    Amborella trichopoda
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        228   7e-68    
ref|XP_006827757.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        228   7e-68    
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            228   8e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KJB19861.1|  hypothetical protein B456_003G121900                    225   9e-68    Gossypium raimondii
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    228   1e-67    Citrus sinensis [apfelsine]
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g             229   1e-67    Phaseolus vulgaris [French bean]
ref|XP_011044676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    226   1e-67    Populus euphratica
ref|XP_011044679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    226   1e-67    Populus euphratica
ref|XP_007137073.1|  hypothetical protein PHAVU_009G097400g             224   2e-67    Phaseolus vulgaris [French bean]
ref|XP_002281025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    226   2e-67    Vitis vinifera
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   227   2e-67    
gb|ABK24695.1|  unknown                                                 227   3e-67    Picea sitchensis
emb|CAN72975.1|  hypothetical protein VITISV_019488                     226   3e-67    Vitis vinifera
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    226   4e-67    Camelina sativa [gold-of-pleasure]
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                        223   6e-67    Glycine soja [wild soybean]
ref|XP_009586622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    224   6e-67    
dbj|BAK07810.1|  predicted protein                                      226   7e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004959111.1|  PREDICTED: uncharacterized protein LOC101782084    233   8e-67    
ref|XP_011046747.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    223   9e-67    Populus euphratica
ref|XP_011046750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    223   9e-67    Populus euphratica
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    224   1e-66    
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             224   2e-66    
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        224   2e-66    Gossypium arboreum [tree cotton]
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    225   2e-66    Cicer arietinum [garbanzo]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    225   2e-66    
emb|CBI31680.3|  unnamed protein product                                221   7e-66    Vitis vinifera
ref|XP_011075984.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        221   7e-66    
emb|CDY19838.1|  BnaA09g04910D                                          223   7e-66    Brassica napus [oilseed rape]
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        223   8e-66    Brassica rapa
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        223   9e-66    Camelina sativa [gold-of-pleasure]
gb|EMT11580.1|  Glucan endo-1,3-beta-glucosidase                        225   9e-66    
ref|XP_010535497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        220   1e-65    
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        223   1e-65    Fragaria vesca subsp. vesca
gb|KJB53907.1|  hypothetical protein B456_009G010800                    220   6e-65    Gossypium raimondii
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  220   9e-65    Citrus sinensis [apfelsine]
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    221   1e-64    Citrus sinensis [apfelsine]
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             221   1e-64    Citrus clementina [clementine]
ref|XP_010043552.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    219   2e-64    
gb|KCW85567.1|  hypothetical protein EUGRSUZ_B02364                     219   3e-64    Eucalyptus grandis [rose gum]
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    218   5e-64    Elaeis guineensis
ref|XP_002321390.2|  hypothetical protein POPTR_0015s01240g             214   8e-64    
gb|KJB73920.1|  hypothetical protein B456_011G261000                    214   2e-63    Gossypium raimondii
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    216   3e-63    
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    216   4e-63    Phoenix dactylifera
ref|XP_010671896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        213   6e-63    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002459582.1|  hypothetical protein SORBIDRAFT_02g007050          216   1e-62    
ref|XP_006846181.2|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    215   4e-62    
gb|EAZ03332.1|  hypothetical protein OsI_25474                          210   1e-60    Oryza sativa Indica Group [Indian rice]
ref|NP_001059262.1|  Os07g0240200                                       210   2e-60    
ref|XP_006658422.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    207   6e-60    
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   206   4e-59    
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  207   4e-59    Medicago truncatula
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    202   5e-58    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250          201   1e-57    Sorghum bicolor [broomcorn]
ref|XP_009143300.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        201   2e-57    Brassica rapa
emb|CDY53600.1|  BnaA05g34730D                                          200   4e-57    Brassica napus [oilseed rape]
emb|CDY20461.1|  BnaC04g05830D                                          200   4e-57    Brassica napus [oilseed rape]
gb|EMS57155.1|  Glucan endo-1,3-beta-glucosidase                        201   5e-57    Triticum urartu
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    199   1e-56    
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    197   4e-56    
ref|NP_001151529.1|  LOC100285163 precursor                             197   4e-56    Zea mays [maize]
gb|EEC68648.1|  hypothetical protein OsI_37085                          197   5e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   6e-56    Pyrus x bretschneideri [bai li]
ref|NP_001068545.2|  Os11g0704600                                       197   6e-56    
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    198   7e-56    Oryza sativa Japonica Group [Japonica rice]
ref|NP_190241.1|  Glycosyl hydrolase superfamily protein                194   9e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    194   7e-55    Malus domestica [apple tree]
gb|EEE52578.1|  hypothetical protein OsJ_34867                          197   2e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      191   1e-53    Pyrus x bretschneideri [bai li]
ref|XP_006411190.1|  hypothetical protein EUTSA_v10017897mg             192   2e-53    Eutrema salsugineum [saltwater cress]
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    190   2e-53    Setaria italica
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   5e-53    
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    189   7e-53    
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   8e-53    
gb|KDO69312.1|  hypothetical protein CISIN_1g0384522mg                  187   8e-53    Citrus sinensis [apfelsine]
ref|XP_009392256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        188   1e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             188   1e-52    Prunus persica
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    188   1e-52    Triticum aestivum [Canadian hard winter wheat]
gb|EPS68882.1|  hypothetical protein M569_05882                         186   2e-52    Genlisea aurea
ref|XP_002877494.1|  predicted protein                                  185   2e-52    
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   3e-52    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78268.1|  hypothetical protein OsI_17962                          192   4e-52    Oryza sativa Indica Group [Indian rice]
emb|CAJ86292.1|  H0124B04.9                                             193   5e-52    Oryza sativa [red rice]
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   2e-51    
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   2e-51    
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   2e-51    
ref|XP_006292633.1|  hypothetical protein CARUB_v10018875mg             182   2e-51    
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   3e-51    Camelina sativa [gold-of-pleasure]
ref|XP_002867117.1|  hypothetical protein ARALYDRAFT_491210             181   4e-51    
ref|XP_010478378.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   5e-51    Camelina sativa [gold-of-pleasure]
ref|XP_006307574.1|  hypothetical protein CARUB_v10009196mg             182   8e-51    Capsella rubella
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      183   1e-50    Cucumis sativus [cucumbers]
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      183   1e-50    Cucumis melo [Oriental melon]
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                    182   1e-50    Arabis alpina [alpine rockcress]
emb|CDO97058.1|  unnamed protein product                                182   1e-50    Coffea canephora [robusta coffee]
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   1e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    184   1e-50    
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      182   2e-50    Prunus mume [ume]
emb|CBI30910.3|  unnamed protein product                                180   2e-50    Vitis vinifera
gb|AAM96962.1|  putative beta-1,3-glucanase precursor                   181   2e-50    Arabidopsis thaliana [mouse-ear cress]
gb|ADE76367.1|  unknown                                                 182   3e-50    Picea sitchensis
ref|XP_006651673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   3e-50    
ref|XP_002270153.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     180   5e-50    Vitis vinifera
ref|XP_009115194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     179   6e-50    Brassica rapa
ref|XP_010499522.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   7e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010091462.1|  putative glucan endo-1,3-beta-glucosidase A6       173   7e-50    
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 181   8e-50    
emb|CDY26296.1|  BnaA09g26470D                                          179   9e-50    Brassica napus [oilseed rape]
gb|EMT31321.1|  Glucan endo-1,3-beta-glucosidase                        182   9e-50    
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg             182   1e-49    Capsella rubella
ref|XP_010460784.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   1e-49    Camelina sativa [gold-of-pleasure]
ref|XP_006304941.1|  hypothetical protein CARUB_v10011427mg             179   2e-49    Capsella rubella
gb|AFK46350.1|  unknown                                                 175   2e-49    Medicago truncatula
gb|AAG52058.1|AC022455_12  beta-1,3-glucanase precursor, putative...    177   2e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 179   3e-49    Morus notabilis
ref|XP_010507244.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    177   3e-49    
emb|CDX99881.1|  BnaC05g23030D                                          177   3e-49    
ref|XP_010478704.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   3e-49    Camelina sativa [gold-of-pleasure]
ref|NP_174300.2|  glycosyl hydrolases family protein                    178   4e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   4e-49    
ref|XP_009380510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   4e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421254.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   5e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001780679.1|  predicted protein                                  176   5e-49    
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg                176   5e-49    
ref|XP_008781529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   6e-49    
ref|XP_010461089.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     177   6e-49    
ref|XP_009380509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   6e-49    
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    180   6e-49    
ref|XP_009380508.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   6e-49    
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    181   7e-49    
ref|XP_010512954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    181   7e-49    
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      179   7e-49    
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182              175   7e-49    
ref|XP_010499813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   7e-49    
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      178   8e-49    
ref|XP_002893598.1|  predicted protein                                  176   9e-49    
ref|XP_006415516.1|  hypothetical protein EUTSA_v10007753mg             177   1e-48    
ref|NP_181494.1|  glycosyl hydrolase-17                                 179   1e-48    
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    177   1e-48    
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    178   1e-48    
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   1e-48    
emb|CDX93815.1|  BnaA09g24150D                                          176   1e-48    
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             177   1e-48    
ref|XP_008225490.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-48    
emb|CDX90225.1|  BnaA08g17590D                                          176   2e-48    
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037             174   2e-48    
ref|XP_007211424.1|  hypothetical protein PRUPE_ppa007088mg             175   2e-48    
ref|XP_004500813.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    176   2e-48    
gb|AIR93908.1|  glucanase                                               177   2e-48    
ref|XP_012071831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-48    
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein               178   2e-48    
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    177   3e-48    
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   3e-48    
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909             173   4e-48    
ref|XP_008225491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   4e-48    
gb|KJB32497.1|  hypothetical protein B456_005G243100                    174   5e-48    
gb|EMS59735.1|  Glucan endo-1,3-beta-glucosidase 11                     175   5e-48    
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      177   5e-48    
gb|KFK44831.1|  hypothetical protein AALP_AA1G308300                    174   6e-48    
ref|XP_002971087.1|  hypothetical protein SELMODRAFT_95153              172   8e-48    
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                175   8e-48    
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             175   9e-48    
ref|XP_009114852.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     174   9e-48    
ref|NP_001130652.1|  uncharacterized protein LOC100191753 precursor     174   1e-47    
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    175   1e-47    
ref|XP_010279617.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   1e-47    
ref|XP_010279618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   1e-47    
gb|AAP44659.1|  putative beta 1,3-glucanase                             174   2e-47    
gb|EYU33370.1|  hypothetical protein MIMGU_mgv1a018482mg                172   2e-47    
ref|XP_010542063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     173   2e-47    
gb|EAY91326.1|  hypothetical protein OsI_12942                          174   2e-47    
ref|XP_008383474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   3e-47    
gb|ABR16583.1|  unknown                                                 172   3e-47    
ref|XP_008358612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   3e-47    
ref|XP_009109623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   3e-47    
ref|XP_011085243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   3e-47    
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   174   3e-47    
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    174   3e-47    
ref|XP_002275642.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     172   3e-47    
ref|XP_004499143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   4e-47    
ref|XP_006856026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      173   4e-47    
gb|KHG11479.1|  hypothetical protein F383_06303                         173   4e-47    
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   4e-47    
tpg|DAA38987.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    172   4e-47    
ref|XP_002519678.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    171   5e-47    
gb|KJB32499.1|  hypothetical protein B456_005G243100                    174   5e-47    
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   6e-47    
gb|KJB32496.1|  hypothetical protein B456_005G243100                    173   6e-47    
gb|KCW75916.1|  hypothetical protein EUGRSUZ_D00293                     171   6e-47    
ref|XP_004499144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   7e-47    
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      173   7e-47    
ref|XP_010274875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   7e-47    
gb|EEE61922.1|  hypothetical protein OsJ_16662                          177   7e-47    
gb|KDO78187.1|  hypothetical protein CISIN_1g016045mg                   171   7e-47    
ref|XP_010549489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     171   7e-47    
ref|XP_006449699.1|  hypothetical protein CICLE_v10015646mg             171   7e-47    
ref|XP_010052055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     171   7e-47    
ref|XP_006467461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   8e-47    
ref|XP_004507424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   9e-47    
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      172   9e-47    
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               172   9e-47    
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      172   9e-47    
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   1e-46    
ref|XP_002306099.1|  hypothetical protein POPTR_0004s16120g             171   1e-46    
gb|ERN06714.1|  hypothetical protein AMTR_s00058p00220600               171   1e-46    
ref|XP_009360891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     171   1e-46    
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   1e-46    
ref|XP_012071830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   1e-46    
ref|XP_008457927.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    172   1e-46    
gb|AIR93913.1|  glucanase                                               172   1e-46    
emb|CDY69080.1|  BnaCnng61800D                                          171   2e-46    
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    172   2e-46    
ref|NP_001141385.1|  uncharacterized protein LOC100273476 precursor     172   2e-46    
gb|ACF79258.1|  unknown                                                 172   2e-46    
ref|XP_008667523.1|  PREDICTED: uncharacterized protein LOC100273...    172   2e-46    
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    171   2e-46    
ref|XP_002893744.1|  glycosyl hydrolase family 17 protein               171   2e-46    
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      172   2e-46    
ref|XP_006476269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46    
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46    
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46    
ref|XP_002960423.1|  hypothetical protein SELMODRAFT_73476              171   2e-46    
gb|ACJ84511.1|  unknown                                                 170   2e-46    
ref|XP_002967295.1|  hypothetical protein SELMODRAFT_87381              171   2e-46    
ref|NP_001241760.1|  glucan endo-1,3-beta-glucosidase precursor         171   2e-46    
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46    
ref|XP_003603912.1|  Glucan endo-1,3-beta-glucosidase                   171   3e-46    
ref|XP_011096565.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46    
ref|XP_011096566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   3e-46    
ref|XP_007025069.1|  Glycosyl hydrolase superfamily protein             170   4e-46    
ref|XP_002306003.2|  hypothetical protein POPTR_0004s13980g             169   4e-46    
emb|CDP07525.1|  unnamed protein product                                171   4e-46    
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    171   5e-46    
emb|CAB80165.1|  putative protein (fragment)                            168   5e-46    
ref|XP_009123249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      171   7e-46    
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    171   7e-46    
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             171   8e-46    
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             170   8e-46    
ref|XP_006403361.1|  hypothetical protein EUTSA_v10003213mg             169   8e-46    
ref|XP_009804917.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    170   9e-46    
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   9e-46    
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   9e-46    
gb|KDO76773.1|  hypothetical protein CISIN_1g015263mg                   169   1e-45    
gb|KJB57237.1|  hypothetical protein B456_009G154800                    167   1e-45    
ref|XP_010939269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   1e-45    
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    170   1e-45    
emb|CDP18512.1|  unnamed protein product                                168   1e-45    
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    169   2e-45    
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      170   2e-45    
gb|KJB57236.1|  hypothetical protein B456_009G154800                    168   2e-45    
ref|XP_004148850.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    169   2e-45    
ref|XP_010540580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45    
gb|KDP37980.1|  hypothetical protein JCGZ_04623                         167   2e-45    
ref|XP_006341928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-45    
ref|XP_004233126.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     167   2e-45    
ref|XP_009804916.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    169   2e-45    
emb|CAN80621.1|  hypothetical protein VITISV_043431                     169   2e-45    
gb|ERN17158.1|  hypothetical protein AMTR_s00044p00136160               164   3e-45    
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   3e-45    
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45    
ref|XP_006372047.1|  hypothetical protein POPTR_0018s08710g             166   3e-45    
ref|XP_010489192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45    
ref|XP_012072111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     167   3e-45    
ref|XP_011009939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45    
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                        168   3e-45    
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    169   3e-45    
ref|XP_011009938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   4e-45    
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             168   4e-45    
emb|CDY26761.1|  BnaC09g08880D                                          169   4e-45    
emb|CDX69064.1|  BnaC01g03890D                                          169   4e-45    
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      169   4e-45    
ref|XP_008377425.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    168   4e-45    
ref|XP_006372048.1|  hypothetical protein POPTR_0018s08710g             166   4e-45    
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   4e-45    
ref|XP_003544417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   4e-45    
ref|XP_006595937.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   4e-45    
gb|AAF31288.1|AC006424_17  CDS                                          167   4e-45    
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   4e-45    
gb|ABK25242.1|  unknown                                                 168   5e-45    
emb|CDY45313.1|  BnaA03g52860D                                          172   5e-45    
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      169   5e-45    
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   5e-45    
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             167   5e-45    
ref|XP_006415143.1|  hypothetical protein EUTSA_v10007671mg             167   5e-45    
ref|XP_008681421.1|  PREDICTED: uncharacterized protein LOC100273...    168   5e-45    
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             167   5e-45    
gb|ABK24319.1|  unknown                                                 168   6e-45    
ref|XP_006581121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   6e-45    
ref|XP_009411141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   6e-45    
ref|XP_003603913.1|  Glucan endo-1,3-beta-glucosidase                   168   6e-45    
ref|XP_008681422.1|  PREDICTED: uncharacterized protein LOC100273...    167   6e-45    
ref|XP_010063141.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    167   6e-45    
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   7e-45    
ref|XP_006581120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   7e-45    
ref|XP_010668075.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     166   7e-45    
ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   7e-45    
ref|NP_174563.2|  glucan endo-1,3-beta-glucosidase 11                   167   7e-45    
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             168   8e-45    
gb|KDO76771.1|  hypothetical protein CISIN_1g015263mg                   166   8e-45    
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   9e-45    
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    168   9e-45    
ref|XP_012069916.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      167   9e-45    
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        167   1e-44    
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   1e-44    
ref|XP_002321270.2|  hypothetical protein POPTR_0014s18290g             162   1e-44    
ref|XP_004293577.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     166   1e-44    
ref|XP_006439198.1|  hypothetical protein CICLE_v10020391mg             166   1e-44    
ref|XP_002317055.2|  glycosyl hydrolase family 17 family protein        164   1e-44    
ref|XP_006657020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   1e-44    
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   2e-44    
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-44    
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   2e-44    
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-44    
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-44    
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-44    
ref|XP_002437077.1|  hypothetical protein SORBIDRAFT_10g020900          165   2e-44    
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        165   2e-44    
ref|XP_011658291.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   2e-44    
ref|XP_004238250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      166   3e-44    
ref|XP_008371763.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    165   3e-44    
gb|KJB10702.1|  hypothetical protein B456_001G216900                    166   3e-44    
gb|KJB34916.1|  hypothetical protein B456_006G090600                    166   3e-44    
ref|XP_009592800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44    
ref|XP_012086629.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44    
ref|XP_006377609.1|  glycosyl hydrolase family 17 family protein        164   3e-44    
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             166   3e-44    
dbj|BAE99425.1|  beta-1,3-glucanase-like protein                        160   3e-44    
emb|CDX72483.1|  BnaC07g45050D                                          169   3e-44    
ref|XP_011657236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44    
gb|AAD22313.1|  putative beta-1,3-glucanase                             166   3e-44    
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   4e-44    
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   4e-44    
ref|XP_008220789.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      166   4e-44    
ref|XP_008377338.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    166   4e-44    
ref|XP_002313051.1|  glycosyl hydrolase family 17 family protein        164   4e-44    
gb|KDO49089.1|  hypothetical protein CISIN_1g0122622mg                  160   4e-44    
gb|KJB10701.1|  hypothetical protein B456_001G216900                    165   5e-44    
emb|CDX75437.1|  BnaA01g02650D                                          166   6e-44    
gb|KJB52394.1|  hypothetical protein B456_008G260000                    164   6e-44    
ref|XP_011623680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     164   6e-44    
ref|XP_002865493.1|  glycosyl hydrolase family 17 protein               164   7e-44    
ref|XP_006653891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   7e-44    
gb|KJB52393.1|  hypothetical protein B456_008G260000                    164   7e-44    



>ref|XP_009610601.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=494

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 196/241 (81%), Gaps = 3/241 (1%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  215
            MEMS + +  FL FL  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSFLFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  216  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  395
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  396  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRP  575
            +GNE+LHW TPE+QN LV AMR+ Y AL++SGI  IKVS+PHSLGI+L ++PPSM +FRP
Sbjct  121  IGNEILHWETPEVQNKLVPAMRTFYQALIQSGINTIKVSTPHSLGILLSSNPPSMAKFRP  180

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            GWDVGILAPML+FLRET GPFMVNPYPYF Y P + D  LF+ NKG  DRF+++ Y NMF
Sbjct  181  GWDVGILAPMLQFLRETKGPFMVNPYPYFAYNPQQVDFLLFKQNKGVFDRFTKKLYTNMF  240

Query  756  D  758
            D
Sbjct  241  D  241



>ref|XP_006345964.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=504

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 199/243 (82%), Gaps = 6/243 (2%)
 Frame = +3

Query  45   MEMSLRP--SPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  209
            ME+S +   SP+F F  +S+ +FI     V S+GVNYGTLG+NLPPP++VA+FLK+KT+I
Sbjct  1    MEVSYKKITSPLFTFLFISS-IFIQCLPYVSSLGVNYGTLGNNLPPPSQVAQFLKDKTII  59

Query  210  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  389
            D+IKIFDVNPDIL+AFA T I VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++
Sbjct  60   DKIKIFDVNPDILKAFANTNISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDV  119

Query  390  IAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRF  569
            IAVGNE+LHW TPE+QN LV AMR+LY AL +SGI  IKVS+PHSLGI+L ++PPS+ +F
Sbjct  120  IAVGNEILHWETPEVQNKLVGAMRTLYQALTQSGINTIKVSTPHSLGILLSSNPPSLAKF  179

Query  570  RPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGN  749
            RPGWDV ILAPML+FLRET GPFMVNPYPYFGY P++ D  LF+ NKG  D+FSRRTY N
Sbjct  180  RPGWDVTILAPMLQFLRETKGPFMVNPYPYFGYNPEQVDFLLFKQNKGVFDKFSRRTYSN  239

Query  750  MFD  758
            MFD
Sbjct  240  MFD  242



>ref|XP_009791207.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=490

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 193/241 (80%), Gaps = 3/241 (1%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  215
            MEMS + +  FL  L  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSILFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  216  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  395
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIHKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  396  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRP  575
            +GNE+LHW TPE+QN LV AMR+ Y AL++SGI  IKVS+PHSLGI+L ++PPSM RFRP
Sbjct  121  IGNEILHWETPEVQNKLVPAMRTFYQALIQSGINTIKVSTPHSLGILLSSNPPSMARFRP  180

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            GWDVGILAPML+FLRET GPFM NPYPYF Y P + D  LF+ N G  DRFS++ Y NMF
Sbjct  181  GWDVGILAPMLQFLRETKGPFMANPYPYFAYNPQQVDFLLFKQNNGVFDRFSKKLYTNMF  240

Query  756  D  758
            D
Sbjct  241  D  241



>ref|XP_004239793.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=526

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 196/242 (81%), Gaps = 4/242 (2%)
 Frame = +3

Query  45   MEMSLRP--SPIFLFFLVSAFL--FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVID  212
            ME+S +   SP+F F  +S+    F   V  IGVNYGTLG+NLPPP++VA+FLK+KT+ID
Sbjct  1    MEVSNKKITSPLFTFLFISSIFIQFFPYVSCIGVNYGTLGNNLPPPSQVAQFLKDKTIID  60

Query  213  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  392
            +IKIFDVNPDIL+AFA T I VTVTVPN EI  L+D GYA  +V ANIKPFYP TKI++I
Sbjct  61   KIKIFDVNPDILKAFANTNISVTVTVPNSEIPKLQDIGYAKSYVEANIKPFYPQTKIDVI  120

Query  393  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFR  572
            AVGNE+LHW TPE+QN LV AMR+LY AL +SGI  +KVS+PHSLGI+L ++PPS+ +FR
Sbjct  121  AVGNEILHWETPEVQNKLVGAMRTLYQALTQSGINTVKVSTPHSLGILLSSNPPSLAKFR  180

Query  573  PGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNM  752
            PGWDVGILAPML+FLRET GPFMVNPYPYFGY P++ D  LF+ NKG  D FS+RTY NM
Sbjct  181  PGWDVGILAPMLQFLRETKGPFMVNPYPYFGYNPEQVDFLLFKQNKGVFDNFSKRTYTNM  240

Query  753  FD  758
            FD
Sbjct  241  FD  242



>ref|XP_011091523.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=457

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = +3

Query  105  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  284
            F+  V+SIGVNYGTLGDNLPPP +VA+FLKEKT IDRIKIFDVNPDILRAFA TGILV V
Sbjct  21   FLAAVQSIGVNYGTLGDNLPPPAQVAQFLKEKTTIDRIKIFDVNPDILRAFANTGILVAV  80

Query  285  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  464
            T+PNGEI  L DAGYA +W+AANI+PFYPATKIN I VGNE+LHWG   +++ LVAAMRS
Sbjct  81   TIPNGEIPGLTDAGYARRWLAANIQPFYPATKINYILVGNEILHWGPQNLRDNLVAAMRS  140

Query  465  LYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
            ++ AL+ SGIK+IKV++ HSLGI+  ++PPS+ +FRPGWD G+LAP+L+F RET  PFMV
Sbjct  141  VHQALLLSGIKDIKVTTAHSLGILESSEPPSLAKFRPGWDTGVLAPLLQFHRETKTPFMV  200

Query  645  NPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            NPYPYFGY+P+ A+ ++F P KG  D+F+RRTYGNMFD
Sbjct  201  NPYPYFGYSPENANFSVFHPTKGVFDKFTRRTYGNMFD  238



>ref|XP_009593199.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=464

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 187/233 (80%), Gaps = 0/233 (0%)
 Frame = +3

Query  60   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            RPS + +     A LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPSMLLVLIFFVAPLFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VGNEVLHW
Sbjct  65   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNEVLHW  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
              P++Q  LV AM++ Y AL +SG+K+IKVSSPHSLGI+LR++PPS  RFRPGWDVGILA
Sbjct  125  DGPDIQMKLVPAMKTFYQALGQSGLKDIKVSSPHSLGILLRSNPPSAARFRPGWDVGILA  184

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML+FLRET GPFMVNPYPYFGY P + +  LFR NKG  DRFS++ Y N FD
Sbjct  185  PMLQFLRETKGPFMVNPYPYFGYNPKQENFLLFRKNKGVYDRFSKKWYTNSFD  237



>ref|XP_009789910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=463

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/233 (70%), Positives = 187/233 (80%), Gaps = 1/233 (0%)
 Frame = +3

Query  60   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            RPS + L   V   LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPSLLLLILFVVP-LFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  63

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VGNEVLHW
Sbjct  64   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNEVLHW  123

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
              P++Q  LV AM++ Y AL +SG+K+IKVSSPHSLGI+LR++PPS  RFRPGWDVGILA
Sbjct  124  DGPDIQMKLVPAMKTFYQALGQSGLKDIKVSSPHSLGILLRSNPPSAARFRPGWDVGILA  183

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML+FLRET GPFMVNPYPYFGY P + D  LFR NKG  DRFS++ Y N FD
Sbjct  184  PMLQFLRETKGPFMVNPYPYFGYNPKQEDFLLFRKNKGVYDRFSKKWYTNSFD  236



>ref|NP_001234416.1| beta-glucosidase 08 precursor [Solanum lycopersicum]
 gb|ACH56716.1| beta-glucosidase 08 [Solanum lycopersicum]
Length=459

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            F+ FL++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD+NPDILRA
Sbjct  7    FVLFLIAIALFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFDINPDILRA  66

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TK+++I VGNEVLHW TPE+
Sbjct  67   FANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKMDVILVGNEVLHWDTPEV  126

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
            QN LV AM+  Y AL  SG+K IKVSS HSLGI+LR++PPS  RFRPGWDVGILAPML+F
Sbjct  127  QNKLVPAMKVFYQALGLSGLKGIKVSSAHSLGILLRSNPPSAARFRPGWDVGILAPMLQF  186

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LRET GPFMVNPYPYFGY   + D  LFR NKG  DRFS++ Y N FD
Sbjct  187  LRETKGPFMVNPYPYFGYNKKQEDFLLFRKNKGVYDRFSKKWYTNSFD  234



>ref|NP_001275174.1| glucan endo-1,3-beta-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52649.1| beta-1,3-glucanase 14 [Solanum tuberosum]
Length=462

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = +3

Query  51   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +S + S I  FF+++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD
Sbjct  4    ISSKTSFILFFFVIA--LFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFD  61

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
            +NPDILRAFA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TKI+++ VGNEV
Sbjct  62   INPDILRAFANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKIDVVLVGNEV  121

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            LHW TPE+QN LV AM+  Y AL  SG+K IKVSS HSLGI+LR++PPS  RFRPGWDVG
Sbjct  122  LHWDTPEVQNKLVPAMKVFYQALGLSGLKGIKVSSAHSLGILLRSNPPSAARFRPGWDVG  181

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            ILAPML+FL ET GPFMVNPYPYFGY   + D  LFR NKG  DRFS++ Y N FD
Sbjct  182  ILAPMLQFLHETKGPFMVNPYPYFGYNKKQEDFLLFRKNKGVYDRFSKKWYMNSFD  237



>emb|CDP00093.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 187/239 (78%), Gaps = 3/239 (1%)
 Frame = +3

Query  51   MSLR-PSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            MS R  S     FLV A    H   V+SIGVNYGT+ DNLPPP +V +F+K+KT IDR+K
Sbjct  1    MSKRTQSSAMAIFLVFALFIQHFSAVQSIGVNYGTVADNLPPPAQVVQFIKDKTFIDRVK  60

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  401
            IFDVNPDI+RAFA TGIL+TVTVPNGEI  L +  YA +WV  +IKPFYP TKIN IAVG
Sbjct  61   IFDVNPDIIRAFANTGILLTVTVPNGEIPNLTNIRYARRWVNEHIKPFYPQTKINYIAVG  120

Query  402  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGW  581
            NEVLHWG   + + LVAAMR+L+ ALVK+GI ++KV++PHSLGI+  A PPS+ +FRPGW
Sbjct  121  NEVLHWGPQNLIDNLVAAMRTLHQALVKNGITDVKVTTPHSLGILESAKPPSLAKFRPGW  180

Query  582  DVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            DVG+LAPML+FLRET  PFMVNPYPYFG+ P + D  LFRPN+GY DRFS+R+Y N FD
Sbjct  181  DVGVLAPMLQFLRETKSPFMVNPYPYFGFDPKEIDFDLFRPNRGYYDRFSKRSYTNQFD  239



>gb|AHL24655.1| Fra e 9.02 allergen [Fraxinus excelsior]
Length=468

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 183/240 (76%), Gaps = 2/240 (1%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  218
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  219  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  398
            K+FDVNPDILR FAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRTFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPG  578
            GNEVLHWG   + + LV AMR+L+NAL++SGI+ + V++ H+L I+  +DPPS+ +FRPG
Sbjct  121  GNEVLHWGAQNVIDNLVGAMRALHNALIRSGIQGVNVTTAHALSILESSDPPSLAKFRPG  180

Query  579  WDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            WD G LAP+L+FLR+T  PFMVNPYPYFGY+P+KAD ALF+PN G  D+++++ Y NMFD
Sbjct  181  WDKGDLAPILQFLRQTKSPFMVNPYPYFGYSPEKADFALFKPNPGVTDKYTKKLYTNMFD  240



>gb|EPS63364.1| glycoside hydrolase, partial [Genlisea aurea]
Length=435

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 177/224 (79%), Gaps = 0/224 (0%)
 Frame = +3

Query  87   LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  266
            ++ + L    V SIGVNYGTL DNLPPP EVA FL+++T IDR+KIFD+NPDILRAFAGT
Sbjct  2    VILSVLLFPAVDSIGVNYGTLADNLPPPLEVAHFLRDRTTIDRVKIFDINPDILRAFAGT  61

Query  267  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  446
            GI V VTVPNG+I  L DAG A +WVAANI+PFYP TKI+ I VGNE+LHWG   +++ L
Sbjct  62   GISVAVTVPNGDIPSLTDAGNAQRWVAANIQPFYPQTKIDSILVGNEILHWGPQNLRDSL  121

Query  447  VAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRET  626
            VAAMR+L  ALV +G+  I V++ HSLGI+  A PPS+ RFRPGWD G+LAP+L+F RET
Sbjct  122  VAAMRTLQRALVAAGVGGINVTTAHSLGILESAQPPSLARFRPGWDTGVLAPVLQFHRET  181

Query  627  NGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              PFMVNPYPYFGY P+ A+ +LF PN G+ D+ SRRTYGNMFD
Sbjct  182  KTPFMVNPYPYFGYDPNNANFSLFLPNSGFFDKLSRRTYGNMFD  225



>gb|EYU33213.1| hypothetical protein MIMGU_mgv1a006294mg [Erythranthe guttata]
Length=449

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            V SIGVNYGT+GDNLPPP +VA+FLK+KT IDRIKIFD NPDILRAF+GTGILV VTVPN
Sbjct  20   VESIGVNYGTMGDNLPPPAQVAQFLKDKTTIDRIKIFDANPDILRAFSGTGILVAVTVPN  79

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            GEI  L D G A +WVAANI+PF+P TKIN I VGNE+LHWG   + + LV+AMRSL+ A
Sbjct  80   GEIPSLTDPGNARRWVAANIQPFHPQTKINYILVGNEILHWGPQNLVDNLVSAMRSLHTA  139

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L  SGI +I V++ HSLGI+  ++PPS+ +FRPGWD G+LAP+L+F RET  PFMVNPYP
Sbjct  140  LSLSGITDIIVTTAHSLGILESSEPPSLAKFRPGWDKGVLAPVLQFHRETKSPFMVNPYP  199

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YFGY+P+ A+ ++F  NKG  DR+++RTYGNMFD
Sbjct  200  YFGYSPEHANFSVFGSNKGLFDRYTKRTYGNMFD  233



>gb|AHL24654.1| Fra e 9.01 allergen [Fraxinus excelsior]
Length=462

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 177/241 (73%), Gaps = 3/241 (1%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  218
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  219  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  398
            K+FDVNPDILRAFAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRAFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPG  578
            GNEVLHWG   + + LV AMR+L+NAL++SGI+ + V++ H+L I+  +DPPS+ +FRPG
Sbjct  121  GNEVLHWGPQNVIDNLVGAMRALHNALIRSGIQGVNVTTAHALSILESSDPPSLAKFRPG  180

Query  579  WDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNK-GYVDRFSRRTYGNMF  755
            WD G LAP+L+FLR+T  PFMVNPYPYFGY+P+K      +    G  D+++++ Y NMF
Sbjct  181  WDKGDLAPILQFLRQTKSPFMVNPYPYFGYSPEKGRFCTLQTQTPGVTDKYTKKLYTNMF  240

Query  756  D  758
            D
Sbjct  241  D  241



>gb|EPS69142.1| hypothetical protein M569_05624, partial [Genlisea aurea]
Length=349

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 0/217 (0%)
 Frame = +3

Query  108  IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVT  287
            I  V SIGVNYGT+ +NLPPP +VA+F+K+KT IDR+KIFDVNPDILRAFA TGILV+VT
Sbjct  18   ISAVHSIGVNYGTIANNLPPPAQVAQFIKQKTFIDRVKIFDVNPDILRAFANTGILVSVT  77

Query  288  VPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  467
            VPNGEI  L +  YA +WV+ NIKPF+P T+IN I VGNE+LHWG     + LV AM++L
Sbjct  78   VPNGEIPNLTNIRYARRWVSVNIKPFHPQTRINYILVGNEILHWGPQAAVDNLVLAMKTL  137

Query  468  YNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
            + AL + GI+++KV++ HSLGI+  +  PS+ RFR GWD GIL+PML+FLR T  PFMVN
Sbjct  138  HRALNREGIRDVKVTTAHSLGILQPSMIPSLARFRKGWDTGILSPMLQFLRRTRSPFMVN  197

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             YPYF Y+PDKA+LALF PNKG  D+F +RTY + FD
Sbjct  198  TYPYFAYSPDKANLALFLPNKGIFDKFVKRTYFSTFD  234



>ref|XP_011101632.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=456

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 177/234 (76%), Gaps = 4/234 (2%)
 Frame = +3

Query  57   LRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  236
            +R +   LF L      I  V+SIGVNYGTLG+NLPPP +VA+FLKEKT++D +KIFDVN
Sbjct  8    IRVAATTLFLLA----IITTVQSIGVNYGTLGNNLPPPAQVAQFLKEKTIVDGVKIFDVN  63

Query  237  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  416
            PDILRAFA TGI VT+TVPN +I  L     A +WVAANIKPFYP TKI+ + VGNE+LH
Sbjct  64   PDILRAFANTGIHVTITVPNDQIPNLTVVRNARRWVAANIKPFYPQTKIHYVLVGNEILH  123

Query  417  WGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGIL  596
            WG   +++ LVAAMR+LY AL   GIK+IKVS+ HSL I+  A+ PSM RFRPGWD GIL
Sbjct  124  WGPQNLRDNLVAAMRTLYKALRMEGIKDIKVSTAHSLAILEPAEIPSMTRFRPGWDKGIL  183

Query  597  APMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            APML+F R T  PFMVNPYPYFGY  +KA+L+LF+PN+G  D  ++  Y NM+D
Sbjct  184  APMLQFHRATKSPFMVNPYPYFGYNKEKANLSLFQPNRGIFDVGTKILYNNMYD  237



>ref|XP_003552703.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Glycine max]
Length=454

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
                IG+NYGTLGDNLPPP  VA FLK KT IDR+KI+DVNPDILRAFAG+GI VTVT P
Sbjct  21   AAHGIGINYGTLGDNLPPPAAVANFLKTKTTIDRVKIYDVNPDILRAFAGSGISVTVTAP  80

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            NG+I  L     A QWVA +IKPF+P TKIN I VG+EVLHWG   M  GLV AMR+L++
Sbjct  81   NGDIAALTKIDSARQWVATHIKPFHPQTKINYILVGSEVLHWGDTNMIRGLVPAMRTLHS  140

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            AL+  GI +IKV++ HSL IM  + PPSMGRFRPG+   +L PMLKFLRET  P MVNPY
Sbjct  141  ALLAEGITDIKVTTAHSLAIMRSSIPPSMGRFRPGYAKHVLGPMLKFLRETRTPLMVNPY  200

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYFGY     +  LFRPN+G  DR+++R+Y N FD
Sbjct  201  PYFGYNGKNVNFLLFRPNRGLYDRYTKRSYTNQFD  235



>ref|XP_008233624.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=478

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYP TKIN IA+GNEVLHWG   ++N LV AMR+ +NALV
Sbjct  82   IPSLTKLRAARRWVVDHVKPFYPQTKINYIAMGNEVLHWGDDNLKNSLVPAMRTFHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML ++PPS GRFRP   + +L PML+FLR+T GPFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSEPPSQGRFRPEV-IPLLTPMLQFLRQTKGPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALF+PNKG  D+F+ ++Y NMFD
Sbjct  201  GWSPEKESFALFKPNKGVHDQFTGKSYTNMFD  232



>gb|EYU19897.1| hypothetical protein MIMGU_mgv1a006105mg [Erythranthe guttata]
Length=457

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYG LGDNLPPP +VA+FLK+KT IDR+KIF VN DIL+AFAGTGILV+VT+PNGEI
Sbjct  25   IGVNYGILGDNLPPPAQVAQFLKDKTTIDRVKIFGVNADILQAFAGTGILVSVTIPNGEI  84

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L +  YA +++AANIKPF+P TK   I VGNE+LHWG  ++++ LVAAM S+  AL  
Sbjct  85   PNLANIHYARRYIAANIKPFHPQTKFQYILVGNEILHWGPQDLRDNLVAAMHSVNKALRL  144

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
              I  +KV++ HSLGI+  +D PS+ RF  GWD   LAP+L+F R+T  PFMVNPYPYFG
Sbjct  145  EKITGVKVTTAHSLGILQPSDLPSLARFTAGWDKDYLAPILEFHRQTRTPFMVNPYPYFG  204

Query  666  YAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            Y+PDK+D ALFRPNKG  D++ RRTYGNMFD
Sbjct  205  YSPDKSDFALFRPNKGVYDKYIRRTYGNMFD  235



>ref|XP_003622030.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES78248.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=448

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            V SIGVNYGTL DNLPPP  VA FLK  T++DR+KIFDV+P IL+AFA TGI VTVT PN
Sbjct  20   VNSIGVNYGTLADNLPPPATVANFLKTNTIVDRVKIFDVSPQILQAFANTGISVTVTAPN  79

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A QWV   IKPFYPATKIN I VG+EVLHWG   M  GLV AMR+L++A
Sbjct  80   GDIAALGNINSARQWVQQKIKPFYPATKINYILVGSEVLHWGDGNMIRGLVPAMRTLHSA  139

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            LV  GI +IKV++ HSL IM ++ PPS G+FRPG+   ++APMLKFLRET  PFMVNPYP
Sbjct  140  LVAEGINDIKVTTAHSLIIMRQSLPPSAGKFRPGFAKHVIAPMLKFLRETRTPFMVNPYP  199

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YFGY P   + ALFRPN+G  DR +R TY N FD
Sbjct  200  YFGYNPKNVNFALFRPNRGLFDRNTRLTYTNQFD  233



>gb|KGN50541.1| hypothetical protein Csa_5G181480 [Cucumis sativus]
Length=441

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVGNE++H     +   LV AMRSL+ 
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNEIIHSNDKPLIARLVPAMRSLHR  142

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            ALV +GI+++KV+SPHSLGI+  ++PPSMGRFR G+D  I  PML+FLRET  PFMVNPY
Sbjct  143  ALVLAGIRDVKVTSPHSLGILSISEPPSMGRFRRGYDRAIFGPMLQFLRETKAPFMVNPY  202

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYFGY+P  A+  LF+PN+G  D++++ TY NMFD
Sbjct  203  PYFGYSPKMANYVLFKPNRGIYDKYTKITYTNMFD  237



>ref|XP_004147695.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=447

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVGNE++H     +   LV AMRSL+ 
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNEIIHSNDKPLIARLVPAMRSLHR  142

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            ALV +GI+++KV+SPHSLGI+  ++PPSMGRFR G+D  I  PML+FLRET  PFMVNPY
Sbjct  143  ALVLAGIRDVKVTSPHSLGILSISEPPSMGRFRRGYDRAIFGPMLQFLRETKAPFMVNPY  202

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYFGY+P  A+  LF+PN+G  D++++ TY NMFD
Sbjct  203  PYFGYSPKMANYVLFKPNRGIYDKYTKITYTNMFD  237



>ref|XP_008342287.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPSMGRFRP   + IL  ML+F R+T  PFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSDPPSMGRFRPEV-IPILTQMLRFCRQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKESYALFRPNNGVHDKFTGKFYTNMFD  232



>ref|XP_008461659.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=449

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 171/229 (75%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            IFL   +S  +F     +IGVNYGTLG+NL PP EV  FLK KT IDR+KIFD NPDILR
Sbjct  13   IFLLLQISTTVF-----AIGVNYGTLGNNLRPPAEVVNFLKTKTKIDRVKIFDTNPDILR  67

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFAG+GILVTVTV NGEI  L +  +A  WVA +I PF+P T+I+ IAVGNE++H     
Sbjct  68   AFAGSGILVTVTVGNGEIPALGNLAFARAWVAEHIAPFHPQTRIHYIAVGNEIIHSNDKP  127

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            +   LV AMRSL+ ALV +GI +IKV+SPHSLGI+  ++PPSMGRFR G+D  I  PML+
Sbjct  128  LIARLVPAMRSLHRALVLAGIWDIKVTSPHSLGILSISEPPSMGRFRRGYDRAIFGPMLQ  187

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FLRET  PFMVNPYPYFGY+P  A+  LF+PN+G  D+++R TY NMFD
Sbjct  188  FLRETKAPFMVNPYPYFGYSPKMANYVLFKPNRGIYDKYTRITYTNMFD  236



>ref|XP_008382814.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Malus 
domestica]
Length=396

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPSMGRFRP   + IL  ML+F R+T  PFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSDPPSMGRFRPEV-IPILTQMLRFCRQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKESYALFRPNNGVHDKFTGKFYTNMFD  232



>ref|XP_004516968.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=450

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            V SIGVNYGTLGDNLPPPT VA FLK  T+IDR+KI+DV+P IL+AFA TGI VTVT PN
Sbjct  21   VNSIGVNYGTLGDNLPPPTTVANFLKTNTIIDRVKIYDVSPQILQAFANTGIAVTVTAPN  80

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A QWV  NIKPF+P TKIN I VG+EVLHWG   M + LV AMR+L++A
Sbjct  81   GDIATLTNIDSARQWVVRNIKPFHPMTKINYILVGSEVLHWGDNNMIHSLVPAMRTLHSA  140

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L+  GI +IKV++ HSL IM  + PPS G+FRPG+   +L PMLKFL+ET  PFMVNPYP
Sbjct  141  LLAEGITDIKVTTAHSLAIMRSSIPPSAGQFRPGYAKHVLGPMLKFLKETKTPFMVNPYP  200

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YFGY P   + ALFRPN G  D+ ++ TY N FD
Sbjct  201  YFGYNPKNVNFALFRPNHGLFDKNTKLTYTNQFD  234



>dbj|BAB40807.1| endo-1,3-beta-glucanase-like protein [Pyrus pyrifolia]
Length=397

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRTAPRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPSMGRFRP   + IL  ML+F R+T  PFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSDPPSMGRFRPEV-IPILTQMLRFCRQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKESYALFRPNNGAHDKFTGKFYTNMFD  232



>ref|XP_009357725.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=397

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRTARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPSMGRFRP   + IL  ML+F R+T  PFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSDPPSMGRFRPEV-IPILTQMLRFCRQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKESYALFRPNNGAHDKFTGKFYTNMFD  232



>ref|XP_008382813.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Malus 
domestica]
Length=486

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPSMGRFRP   + IL  ML+F R+T  PFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSSDPPSMGRFRPEV-IPILTQMLRFCRQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K   ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKESYALFRPNNGVHDKFTGKFYTNMFD  232



>ref|XP_004307514.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 170/228 (75%), Gaps = 6/228 (3%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
             LFF ++   +     SIGVNYGTL DNLPPP +VA F+K +T+ID +KIFDVNPDI+RA
Sbjct  11   LLFFQLATTAY-----SIGVNYGTLADNLPPPAQVANFIKTQTIIDAVKIFDVNPDIIRA  65

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI +T+T+PNGEI  L     A ++VA +I+PFYPATK   I +GNE+LHWG    
Sbjct  66   FANTGISLTITIPNGEIPGLTTLDGAKRYVAQHIQPFYPATKFKYILMGNEILHWGDAAQ  125

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
            +NGLV AM+ LY AL+++GIK++KVS+PHSLGIML ++P S GRFRP   + IL   LKF
Sbjct  126  KNGLVPAMKMLYAALIQAGIKDVKVSTPHSLGIMLSSEPASAGRFRPEV-IPILLDQLKF  184

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             RET  PF+ NPYPYFG++P K + ALFRPNKG  D+F+++ Y NMFD
Sbjct  185  CRETKSPFIFNPYPYFGWSPQKENFALFRPNKGIFDQFTKKMYTNMFD  232



>ref|XP_010690550.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VGNEVLHWG   
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNEVLHWGPQN  127

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            + + LV AMR+LY AL ++G K I+VS+PHSLGI+ R++PPS GRFRPGWDVG+LAPMLK
Sbjct  128  LIDNLVPAMRTLYQALQQAGHKNIRVSTPHSLGILGRSEPPSTGRFRPGWDVGVLAPMLK  187

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FL ET  PF+VNPYPYF   P   +  LF+ N+G  DR++++ Y NMF+
Sbjct  188  FLHETKSPFIVNPYPYFDVGPKNVNFCLFKRNRGRFDRWTKKMYYNMFE  236



>ref|XP_010690542.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=488

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VGNEVLHWG   
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNEVLHWGPQN  127

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            + + LV AMR+LY AL ++G K I+VS+PHSLGI+ R++PPS GRFRPGWDVG+LAPMLK
Sbjct  128  LIDNLVPAMRTLYQALQQAGHKNIRVSTPHSLGILGRSEPPSTGRFRPGWDVGVLAPMLK  187

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FL ET  PF+VNPYPYF   P   +  LF+ N+G  DR++++ Y NMF+
Sbjct  188  FLHETKSPFIVNPYPYFDVGPKNVNFCLFKRNRGRFDRWTKKMYYNMFE  236



>ref|XP_008343598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTKIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  LK+   A +W+  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM + ++AL 
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNEVLHWGDDALKSSLVPAMETFHSALA  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML +DPPS GRFRP   + IL  MLKF  +T  PFMVNPYPYF
Sbjct  142  QEGIKDVKVSTPHSLGIMLSSDPPSTGRFRPEV-IPILTQMLKFCTQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALFRPN+G  D  + + Y NMFD
Sbjct  201  GWSPEKENYALFRPNQGVHDTVTGKFYTNMFD  232



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 168/228 (74%), Gaps = 0/228 (0%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVGNE++      +
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNEIMATADKNL  130

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
               LV AM++L+NALV + I +IKVS+PHSLGI+  ++PPS+GRFR G+D  I APML+F
Sbjct  131  IGHLVPAMKALHNALVLAKITDIKVSTPHSLGILSMSEPPSVGRFRRGYDKVIFAPMLEF  190

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             R+T  PFMVNPYPYFG++P+  +  +F+PN+G  D+F+  TY NMFD
Sbjct  191  HRQTKSPFMVNPYPYFGFSPNMLNYCIFKPNRGVHDKFTGITYTNMFD  238



>ref|XP_010034118.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW50205.1| hypothetical protein EUGRSUZ_J00013 [Eucalyptus grandis]
Length=451

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYGTLGDNLPPP +VA F+K +T+I+R+KIFD NPDILRAFA TGI +TVT  NG+I
Sbjct  24   IGVNYGTLGDNLPPPAQVANFIKSQTIINRVKIFDTNPDILRAFADTGIAMTVTAGNGDI  83

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L    YA QWVA NI PFYP T+I  + VGNE++H     +   L+ AMR+L+NALV 
Sbjct  84   PALTRLAYARQWVAINIAPFYPRTRIVRVLVGNEIIHSQDKRLVVNLLPAMRTLHNALVL  143

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
            +G + I+V++ HSLGI+  ++PPS GRFRPG+   +L PMLKFLR+T  PFMVNPYPYFG
Sbjct  144  AGFRGIQVTTAHSLGILEMSEPPSRGRFRPGY-TRVLVPMLKFLRDTRSPFMVNPYPYFG  202

Query  666  YAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            Y+P KA+ ALF+PN+G  DRF+R TY NMFD
Sbjct  203  YSPRKANYALFKPNRGVYDRFTRITYTNMFD  233



>ref|XP_007220314.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
 gb|EMJ21513.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
Length=330

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 161/212 (76%), Gaps = 11/212 (5%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +WV  ++KPFYP TKIN IA+GNEVLHWG   ++N LV AMR+ +NALV
Sbjct  82   IPSLTKLRTARRWVVDHVKPFYPQTKINYIAMGNEVLHWGDDNLKNSLVPAMRTFHNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLGIML  +            + +L PML+FLR+T GPFMVNPYPYF
Sbjct  142  REGIKDVKVSTPHSLGIMLSPEV-----------IPLLTPMLQFLRQTKGPFMVNPYPYF  190

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALF+PNKG  D+F+ ++Y NMFD
Sbjct  191  GWSPEKENFALFKPNKGVHDQFTGKSYTNMFD  222



>ref|XP_009357726.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=492

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  LK+   A +W+  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM + ++AL 
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNEVLHWGDDALKSSLVPAMETFHSALA  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK+IKVS+PHSLGIML +DPPS GRFRP   + IL  MLKF  +T  PFMVNPYPYF
Sbjct  142  QEGIKDIKVSTPHSLGIMLSSDPPSTGRFRPEV-IPILTQMLKFCTQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALFRPN+G  D  + + Y NMFD
Sbjct  201  GWSPEKENYALFRPNQGVHDTVTGKFYTNMFD  232



>gb|ACM45718.1| endo-1,3-beta-glucanase [Pyrus pyrifolia]
Length=454

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTQTTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A  W+  ++KPFYPATKI  IA+G+EVLHWG   +++ LV AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAMGSEVLHWGDDALKSSLVPAMRTFHNALI  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
              GIK++KVS+PHSLG+ML +DPPS GRFRP   + ILA +L F R+T  PFMVNPYP+F
Sbjct  142  GEGIKDVKVSTPHSLGMMLSSDPPSTGRFRPEV-LPILAQLLLFCRQTKSPFMVNPYPFF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKENYALFRPNSGVRDKFTGKFYTNMFD  232



>ref|XP_007139210.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
 gb|ESW11204.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
Length=443

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
              SIG+NYGTLGDNLPPP  VA FLK +T IDR+KI+DVNP IL+AFA +GI +TVT PN
Sbjct  22   AHSIGINYGTLGDNLPPPATVANFLKTRTTIDRVKIYDVNPQILQAFANSGISMTVTAPN  81

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  LK    A QWV ++IKPF+P TKI  I VG+EVLHWG  +M  GL  A+R+L+ A
Sbjct  82   GDIAVLKQIDTARQWVVSHIKPFHPQTKIEYILVGSEVLHWGDADMIRGLTPAIRTLHAA  141

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L+  GI +IKV++ HSL IM  + PPS GRFRPG+   +L PMLKFL+ET  PFMVNPYP
Sbjct  142  LLAEGITDIKVTTAHSLAIMRSSIPPSAGRFRPGYAKHVLGPMLKFLKETRMPFMVNPYP  201

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YF Y     +  LFRPN+G  DR+++ +Y N FD
Sbjct  202  YFAYNGKNVNFLLFRPNRGLYDRYTKLSYTNQFD  235



>ref|XP_009357727.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=454

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTETTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A  W+  ++KPFYPA+KI  IA+G+EVLHWG   +++ L  AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPASKIKYIAMGSEVLHWGDDAIRSSLAPAMRTFHNALI  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GIK++KVS+PHSLG+ML +DPPS GRFRP   + ILA +L F R+T  PFMVNPYP+F
Sbjct  142  REGIKDVKVSTPHSLGMMLSSDPPSTGRFRPEV-LPILAQLLLFCRQTKSPFMVNPYPFF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKENYALFRPNSGVRDKFTGKFYTNMFD  232



>ref|XP_008362701.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Malus domestica]
Length=473

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNGE  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A +W+  ++KPFYPA+KI  I +GNEVLHWG   +++ LV AM++L NALV
Sbjct  82   IPSLTKLRTARRWIIDHVKPFYPASKIKYIGMGNEVLHWGDDALKSSLVPAMKTLNNALV  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
              GIK++KVS+PHSLGIML ++PPSMGRFRP   + IL  ML+F  +T  PFMVNPYPYF
Sbjct  142  LEGIKDVKVSTPHSLGIMLASEPPSMGRFRPEV-IPILTQMLRFCSQTKSPFMVNPYPYF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALF PN+G  D+F+ + Y NMFD
Sbjct  201  GWSPEKENYALFGPNEGVHDKFTGKFYTNMFD  232



>ref|XP_008371690.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=454

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A  W+  ++KPFYPATKI  IA+G+EVLHWG   ++  LV AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAMGSEVLHWGDDALKASLVPAMRTFHNALI  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + GI+++KVS+PHSLG+ML +DPPS GRFRP     ILA +L F R+T  PFMVNPYP+F
Sbjct  142  REGIEDVKVSTPHSLGMMLSSDPPSTGRFRPEVHP-ILAQILLFCRQTKSPFMVNPYPFF  200

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+K + ALFRPN G  D+F+ + Y NMFD
Sbjct  201  GWSPEKENYALFRPNSGVRDKFTGKFYTNMFD  232



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 158/212 (75%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYGTL +NLPPP++VA FLK +T+ID IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  27   ALGVNYGTLANNLPPPSQVANFLKTQTIIDSIKIFDTNPDILRAFANTGITVTVTVGNGD  86

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +A  A +WV  NIKP+YP TKIN IAVGNE+L  G  +    LV  M++L++ALV
Sbjct  87   IPALSEAHAARRWVNNNIKPYYPQTKINRIAVGNEILMSGVQDWIAHLVPCMKALHHALV  146

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             +GIK+IKVS+PH+LGI+  + PPS  R RPG+   I AP+L+FLRET  P MVNPYPYF
Sbjct  147  LAGIKDIKVSTPHTLGILYNSVPPSAARIRPGYQKSIFAPLLQFLRETKSPLMVNPYPYF  206

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             YAP      LF+PN+G  DR++  TY NMFD
Sbjct  207  SYAPKVDKYILFKPNRGIHDRYTNITYTNMFD  238



>ref|XP_002530863.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31537.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=457

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +3

Query  51   MSLRPSPIFLFFLVSAFLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  227
            M+ +     L  L+S F  +   + +IGVNYGTLG+NLPPP++VA+F+K +T+ID IKIF
Sbjct  1    MTTKTHHRHLLLLISTFFHLSTTIFAIGVNYGTLGNNLPPPSQVAKFIKTQTIIDSIKIF  60

Query  228  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNE  407
            D NPD+LRAFA TGI VTVTV NG+I  L +   A +WV ANI PFYP T+IN I VGNE
Sbjct  61   DTNPDVLRAFANTGISVTVTVGNGDIPALANINNARRWVVANIAPFYPRTRINRIVVGNE  120

Query  408  VLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDV  587
            +L          LV AMR+++NAL+ + I+ I+V++P+SLGI+  ++PPS GRFR G+D 
Sbjct  121  ILASANKAWITNLVPAMRNIHNALLSARIRGIQVTTPNSLGILSISEPPSAGRFRNGFDR  180

Query  588  GILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             I APML+FLRET  PFMVNPYPYFGY P  A+ ALF+ N+G  DRF+  TY NM+D
Sbjct  181  VIFAPMLQFLRETKSPFMVNPYPYFGYFPQMANYALFKRNRGIHDRFTGITYYNMYD  237



>ref|XP_009343476.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=479

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 160/212 (75%), Gaps = 1/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPN E
Sbjct  28   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNSE  87

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  W+  ++KPFYPA+KI  I +GNEVLHWG   +++ LV AM++L NALV
Sbjct  88   IPSLTKLRTARLWIIDHVKPFYPASKIKYIGMGNEVLHWGDDALKSSLVPAMKTLNNALV  147

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
              GIK++KVS+PHSLGIML ++PPSMGRFRP   + IL  ML+F  +T  PFMVNPYPYF
Sbjct  148  LEGIKDVKVSTPHSLGIMLASEPPSMGRFRPEV-IPILTQMLRFCSQTKSPFMVNPYPYF  206

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P++ + ALF PN+G  D+F+ + Y NMFD
Sbjct  207  GWSPERENYALFGPNEGVHDKFTGKFYTNMFD  238



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 167/228 (73%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLF-IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            LF ++S+       V SI VNYGTLG+NLPPP +VA F+K++T+ID++KIFD NPDILRA
Sbjct  16   LFLVLSSLTGDATAVYSIDVNYGTLGNNLPPPAQVATFIKQRTIIDKVKIFDTNPDILRA  75

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI +TVTV NG+I  L +   A  WVA  I PFYP TKIN IAVGNE++      +
Sbjct  76   FANTGIAITVTVGNGDIPQLANLPAARNWVATKITPFYPQTKINRIAVGNEIMATADKNL  135

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
               +V AM+SL+ AL  +GI +I+VS+PHSLGI+  ++PPS+G+FR G+D  I +PML+F
Sbjct  136  IIHMVPAMKSLHAALRLAGIMDIQVSTPHSLGILSISEPPSLGQFRRGYDRVIFSPMLQF  195

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LRET  PFMVNPYPYFG+     + ALF+PN+G  D+F+R TY NMFD
Sbjct  196  LRETKAPFMVNPYPYFGFTAKTLNYALFKPNRGKYDKFTRITYTNMFD  243



>ref|XP_011029669.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=448

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 158/227 (70%), Gaps = 7/227 (3%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
             L F  +AF       +IGVNYGTL +NLP P+EVA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSEVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNTASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             + LV  M+SL+ ALV +GIK+++VS+PH+LGI+  +  PS  R RPG+D  I APML+F
Sbjct  132  ISRLVPCMKSLHQALVHAGIKDVQVSTPHTLGILHNSVQPSAARIRPGYDRVIFAPMLQF  191

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            LR+T  P MVNPYPYF Y P   +  LFRPN+G  D  +  TY NMF
Sbjct  192  LRQTKSPLMVNPYPYFSYTPSMENYILFRPNRGVHDTSTNITYTNMF  238



>ref|XP_002312097.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
 gb|EEE89464.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
Length=448

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 159/227 (70%), Gaps = 7/227 (3%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             + LV  M+SL+ ALV +GIK+++VS+PH+LGI+  +  PS  R RPG+D  I APML+F
Sbjct  132  ISRLVPCMKSLHQALVHAGIKDVQVSTPHTLGILHNSVQPSAARIRPGYDRVIFAPMLQF  191

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            LR+T  P MVNPYPYF Y+P   +  LF+PN+G  D  +  TY NMF
Sbjct  192  LRQTKSPLMVNPYPYFSYSPSMENYILFKPNRGVHDTNTNITYTNMF  238



>gb|ABK95730.1| unknown [Populus trichocarpa]
Length=448

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 159/227 (70%), Gaps = 7/227 (3%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             + LV  M+SL+ ALV +GIK+++VS+PH+LGI+  +  PS  R RPG+D  I APML+F
Sbjct  132  ISRLVPCMKSLHQALVHAGIKDVQVSTPHTLGILHNSVQPSAARIRPGYDRVIFAPMLQF  191

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            LR+T  P MVNPYPYF Y+P   +  LF+PN+G  D  +  TY NMF
Sbjct  192  LRQTKSPLMVNPYPYFSYSPSMENYILFKPNRGVHDTNTNITYTNMF  238



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYGTL DNLPPPT+VA FLKE+T IDR+K+FD NPD++RAFAGTGI V +T PNG+I
Sbjct  26   IGVNYGTLADNLPPPTQVAAFLKERTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGDI  85

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L     A  WVAA++ PFYPAT I++IAVGNE++  G   +   LV AMRSL  ALV+
Sbjct  86   PSLAKLPGAQAWVAAHVAPFYPATNISLIAVGNEIMATGDRFLIAHLVPAMRSLSAALVQ  145

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
            +G  +I+VS+PHSLGI+  ++PPS  RFR G+D  + APML F R+T  PF+VNPYPYFG
Sbjct  146  AGFPKIRVSTPHSLGILSASEPPSSSRFRRGYDRAVFAPMLDFHRKTKSPFVVNPYPYFG  205

Query  666  YAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            Y P   + ALF+PN+G  D  ++  Y NMFD
Sbjct  206  YNPRTLNYALFKPNRGVFDPVTKINYTNMFD  236



>emb|CAB85903.1| beta-1,3 glucanase [Pisum sativum]
Length=453

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 152/220 (69%), Gaps = 0/220 (0%)
 Frame = +3

Query  99   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  278
            F  +  V SIGVNYGTLGDNLPPP  VA FLK  T+ID +KIFDV+P IL+AFA TGI V
Sbjct  18   FHLVATVTSIGVNYGTLGDNLPPPATVANFLKTNTIIDSVKIFDVSPQILQAFANTGISV  77

Query  279  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  458
            TVT PNG+I  L     A QWV  +IKPF+P TKIN I VG+EV HWG   M   LV AM
Sbjct  78   TVTAPNGDIEALAKIDSARQWVVTHIKPFHPQTKINYILVGSEVFHWGDSVMIRNLVPAM  137

Query  459  RSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPF  638
            R+L++AL+  GI +IKV++ HSL I+ ++ PPS G          + PMLKFLR+T  PF
Sbjct  138  RTLHSALLAEGITDIKVTTAHSLAILRQSLPPSAGNSDQDTAKYFIGPMLKFLRQTRTPF  197

Query  639  MVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            MVNPYPYFGY P  A+ ALFRPN+G  DR ++  Y N FD
Sbjct  198  MVNPYPYFGYNPKNANFALFRPNRGLFDRNTKLLYTNQFD  237



>ref|XP_002312098.1| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89465.1| glucan endo-1 family protein [Populus trichocarpa]
Length=454

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  29   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  88

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A  WVAANI PF+P T+IN I VGNE++        + LV AMR+++ AL+
Sbjct  89   IPSLANLNSARGWVAANIAPFHPQTRINRIVVGNEIMATANKPWISNLVPAMRTIHKALL  148

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             +GI+ ++V++PHSLGI+  ++PPS G+FR G+D  I APML+FLRET  PFMVNPYPYF
Sbjct  149  LAGIRNVQVTTPHSLGILSISEPPSAGQFRRGFDRAIFAPMLQFLRETKSPFMVNPYPYF  208

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            GY+P  A+ ALF+ N+G  DR++  TY NM+D
Sbjct  209  GYSPKMANYALFKRNRGVHDRYTGITYTNMYD  240



>ref|XP_011470609.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=702

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 161/212 (76%), Gaps = 3/212 (1%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP++VA FLK +T+ID +KIFD+NPDI+RAFA +GI +T+T+PNG+
Sbjct  20   SIGVNYGTLGDNLPPPSQVANFLKTQTIIDSLKIFDMNPDIIRAFANSGISLTITLPNGD  79

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A +W+  NIKPFYPAT I  I VG EVLHWG    ++ LVAAMR+L NAL 
Sbjct  80   IPTLTNPRAARRWIQQNIKPFYPATLIRYICVGTEVLHWGDDAQKSNLVAAMRTLNNALR  139

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
              G K IKVS+PHSLGIML ++PPS GRFRP     IL  ML+FLRE+N P MVNPYPYF
Sbjct  140  VEGFKGIKVSTPHSLGIMLTSEPPSQGRFRPEV-TPILIQMLRFLRESNSPLMVNPYPYF  198

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++P+  + ALFR ++  +D  ++ TY +MFD
Sbjct  199  GWSPENENYALFRQSR--IDPITKLTYTSMFD  228



>ref|XP_011029787.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=451

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  26   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A  WVAANI PF+P T+IN I VGNE++        + LV AMR+++ AL+
Sbjct  86   IPSLANLNSARGWVAANIAPFHPRTRINRIVVGNEIMATANKPWISNLVPAMRTIHKALL  145

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             +GI+ ++V++PHSLGI+  ++PPS G+FR G+D  I APML+FLRET  PFMVNPYPYF
Sbjct  146  LAGIRNVQVTTPHSLGILSISEPPSKGQFRRGFDRAIFAPMLQFLRETKSPFMVNPYPYF  205

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            GY+P  A+ ALF+ N+G  DR++  TY NM+D
Sbjct  206  GYSPKMANYALFKRNRGVHDRYTGITYTNMYD  237



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 157/212 (74%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL ++LP P++VA FLK+ T ID++KIFD NPD+L+AFA TGI +TV+V NG+
Sbjct  33   SIGVNYGTLANDLPLPSQVAAFLKQSTTIDKVKIFDTNPDVLQAFANTGIAITVSVGNGD  92

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA +I PF+P TKIN IAVGNE++      +   L+ AMRSL+ ALV
Sbjct  93   IPALSKLPAAQDWVATHISPFHPQTKINRIAVGNEIVATSDKNLIAHLLPAMRSLHAALV  152

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            K+GIK+I+VS+PHSLGI+  ++PPS GRFR G+D  I APML+F RET  PFM+NPYPYF
Sbjct  153  KAGIKDIQVSTPHSLGILSTSEPPSTGRFRRGYDRVIFAPMLQFHRETKSPFMINPYPYF  212

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G++    + ALF+PN G  D F+  TY NMFD
Sbjct  213  GFSQKTLNYALFKPNPGIHDNFTGITYTNMFD  244



>ref|XP_012089256.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Jatropha 
curcas]
 gb|KDP44958.1| hypothetical protein JCGZ_01458 [Jatropha curcas]
Length=446

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 158/224 (71%), Gaps = 1/224 (0%)
 Frame = +3

Query  90   VSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  266
            +S FL +    + +GVNYGTL +NLPPP +VA FLK +T+ID IKIFD NP+IL+AFA T
Sbjct  12   ISTFLHLFTTSAALGVNYGTLANNLPPPAQVANFLKTETIIDSIKIFDTNPEILKAFANT  71

Query  267  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  446
             I VTVTV NG+I  L +A  A +WVA NIKP+YP TKIN+IA+GNE+L  G  +    L
Sbjct  72   NITVTVTVGNGDIPSLSNARAARRWVANNIKPYYPQTKINLIAIGNEILMSGVQDWIAHL  131

Query  447  VAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRET  626
            V  M+++++ALV   I  IKVS+PH+LGI+  + PPS  R RPG+   I APML FLRET
Sbjct  132  VPCMKAIHHALVLEKINTIKVSTPHTLGILHNSVPPSSARIRPGYQKPIFAPMLSFLRET  191

Query  627  NGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              P MVNPYPYF YAP  A   LF+PN+G  D+ +  TY NMFD
Sbjct  192  KSPLMVNPYPYFSYAPKVAKYILFQPNRGIHDKATGITYTNMFD  235



>ref|XP_012089248.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Jatropha 
curcas]
Length=448

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 158/224 (71%), Gaps = 1/224 (0%)
 Frame = +3

Query  90   VSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  266
            +S FL +    + +GVNYGTL +NLPPP +VA FLK +T+ID IKIFD NP+IL+AFA T
Sbjct  12   ISTFLHLFTTSAALGVNYGTLANNLPPPAQVANFLKTETIIDSIKIFDTNPEILKAFANT  71

Query  267  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  446
             I VTVTV NG+I  L +A  A +WVA NIKP+YP TKIN+IA+GNE+L  G  +    L
Sbjct  72   NITVTVTVGNGDIPSLSNARAARRWVANNIKPYYPQTKINLIAIGNEILMSGVQDWIAHL  131

Query  447  VAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRET  626
            V  M+++++ALV   I  IKVS+PH+LGI+  + PPS  R RPG+   I APML FLRET
Sbjct  132  VPCMKAIHHALVLEKINTIKVSTPHTLGILHNSVPPSSARIRPGYQKPIFAPMLSFLRET  191

Query  627  NGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              P MVNPYPYF YAP  A   LF+PN+G  D+ +  TY NMFD
Sbjct  192  KSPLMVNPYPYFSYAPKVAKYILFQPNRGIHDKATGITYTNMFD  235



>gb|AAM66982.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=449

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 162/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  87   LVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
              + FL I  V S IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDNVKIFDVNPDILRAFAG  73

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFL  617
            L+ AMR+L NALV++G++++KV++ HSL I+       PS GRFRPGWD GILAP+L + 
Sbjct  134  LLPAMRNLNNALVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPGWDKGILAPILAYH  193

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            R T  PFMVNPYPYFG+ P   + A+FR P K   D F+R  Y NMFD
Sbjct  194  RRTKSPFMVNPYPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMFD  241



>ref|NP_191103.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 emb|CAB75901.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAN12934.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE79383.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=449

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 162/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  87   LVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
              + FL I  V S IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFL  617
            L+ AMR+L NALV++G++++KV++ HSL I+       PS GRFRPGWD GILAP+L + 
Sbjct  134  LLPAMRNLNNALVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPGWDKGILAPILAYH  193

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            R T  PFMVNPYPYFG+ P   + A+FR P K   D F+R  Y NMFD
Sbjct  194  RRTKSPFMVNPYPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMFD  241



>gb|AAK76666.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=449

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 162/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  87   LVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
              + FL I  V S IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFL  617
            L+ AMR+L NALV++G++++KV++ HSL I+       PS GRFRPGWD GILAP+L + 
Sbjct  134  LLPAMRNLNNALVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPGWDKGILAPILAYH  193

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            R T  PFMVNPYPYFG+ P   + A+FR P K   D F+R  Y NMFD
Sbjct  194  RRTKSPFMVNPYPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMFD  241



>gb|KCW85568.1| hypothetical protein EUGRSUZ_B02365, partial [Eucalyptus grandis]
Length=346

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 162/236 (69%), Gaps = 1/236 (0%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL  + +  ++V++PHSLGI+  ++PPS GRFR G+D  
Sbjct  123  LATSDKTLIARLLPAMKALHSALQLANVTNVQVTTPHSLGILSSSEPPSTGRFRRGYDRA  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            I AP+L+F R+T   FMVNPYP+FG+     + ALF+PN G  D  + + Y NMFD
Sbjct  183  IFAPILEFHRQTKSAFMVNPYPFFGFTAKTLNYALFKPNAGIFDAATGKNYTNMFD  238



>ref|XP_010043554.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 162/236 (69%), Gaps = 1/236 (0%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL  + +  ++V++PHSLGI+  ++PPS GRFR G+D  
Sbjct  123  LATSDKTLIARLLPAMKALHSALQLANVTNVQVTTPHSLGILSSSEPPSTGRFRRGYDRA  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            I AP+L+F R+T   FMVNPYP+FG+     + ALF+PN G  D  + + Y NMFD
Sbjct  183  IFAPILEFHRQTKSAFMVNPYPFFGFTAKTLNYALFKPNAGIFDAATGKNYTNMFD  238



>ref|XP_010516112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 159/217 (73%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P T I  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNEILLSGDNNMINNLLPAMRNLNNA  147

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRPGWD GILAP+L + R T  PFMVNP
Sbjct  148  LVRAGVRDVKVTTAHSLNIIAYDLTGAPSTGRFRPGWDKGILAPILAYHRRTKSPFMVNP  207

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+R+ Y NMFD
Sbjct  208  YPYFGFDPKNVNFAIFRTPYKAVRDPFTRKVYTNMFD  244



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 153/212 (72%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP +VA FLKE T IDR+K+FD NPD++RAFAGTGI V +T PNG+
Sbjct  26   SIGVNYGTLADNLPPPAQVAAFLKESTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVAAN+ P YPAT I++IAVGNE++  G   +   LV AMRSL  AL 
Sbjct  86   IPSLAKLPGARAWVAANVAPLYPATNISLIAVGNEIMATGDRSLIAHLVPAMRSLSAALG  145

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            ++G  +I+VS+PHSLGI+  ++PPS  RFR G+D  + +PML+F R+T  PF+VNPYPYF
Sbjct  146  QAGFPKIRVSTPHSLGILSASEPPSSSRFRRGYDRVVFSPMLEFHRKTKSPFVVNPYPYF  205

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            GY P   + ALF+PN G  D  ++  Y NMFD
Sbjct  206  GYNPRTLNYALFKPNAGVFDPVTKINYTNMFD  237



>ref|XP_006403459.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
 gb|ESQ44912.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
Length=456

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 164/228 (72%), Gaps = 7/228 (3%)
 Frame = +3

Query  93   SAFLFIH---GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            SA +FI     + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  16   SAVVFITFPAAISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  74

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            TGI V VTVPNG+I  L +   A +WV+ANI P++P TKI  I+VGNE+L  G   M + 
Sbjct  75   TGISVVVTVPNGDIPALANGRQARRWVSANILPYHPQTKIKYISVGNEILLTGDNNMISN  134

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFL  617
            L+ AMR+L NALV++G+K++KV++ HSL I+       PS GRFRPGWD  ILAP+L + 
Sbjct  135  LLPAMRNLNNALVRAGVKDVKVTTAHSLNIIAYDLTGAPSSGRFRPGWDKNILAPILAYH  194

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            R T  PFMVNPYPYFG+ P   + A+FR P K   D F+R+ Y NM+D
Sbjct  195  RRTKSPFMVNPYPYFGFDPKNVNFAIFRSPYKAVRDPFTRKVYTNMYD  242



>ref|XP_010043553.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Eucalyptus 
grandis]
Length=410

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 162/236 (69%), Gaps = 1/236 (0%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL  + +  ++V++PHSLGI+  ++PPS GRFR G+D  
Sbjct  123  LATSDKTLIARLLPAMKALHSALQLANVTNVQVTTPHSLGILSSSEPPSTGRFRRGYDRA  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            I AP+L+F R+T   FMVNPYP+FG+     + ALF+PN G  D  + + Y NMFD
Sbjct  183  IFAPILEFHRQTKSAFMVNPYPFFGFTAKTLNYALFKPNAGIFDAATGKNYTNMFD  238



>ref|XP_010504397.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 159/217 (73%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P T I  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNEILLSGDNNMINNLLPAMRNLNNA  147

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRPGWD GILAP+L + R T  PFMVNP
Sbjct  148  LVRAGVRDVKVTTAHSLNIIAYDLTGAPSTGRFRPGWDKGILAPILAYHRRTKSPFMVNP  207

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YP+FG+ P   + A+FR P K   D F+R+ Y NMFD
Sbjct  208  YPFFGFDPKNVNFAIFRTPYKAVRDPFTRKVYTNMFD  244



>ref|XP_002878033.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54292.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRP WD GILAP+L + R T  PFMVNP
Sbjct  145  LVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPVWDKGILAPILAYHRRTKSPFMVNP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+R  Y NMFD
Sbjct  205  YPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMFD  241



>ref|XP_009405069.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 158/230 (69%), Gaps = 2/230 (1%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            +F+  L S+   + G+ SIGVNYGT+ DNLPPP +VA FLK+ T+IDRIK++D NPDI+R
Sbjct  18   LFVLILFSSASAVSGL-SIGVNYGTIADNLPPPPQVAAFLKDHTIIDRIKLYDANPDIIR  76

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQ-WVAANIKPFYPATKINIIAVGNEVLHWGTP  428
            AFAGT I VT+T PNGEI     +  AA  WVAAN+ PF PAT+I ++ VGNE+L+ G  
Sbjct  77   AFAGTPISVTITAPNGEIPSFASSREAADAWVAANVAPFVPATRITLVLVGNEILNTGDA  136

Query  429  EMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
             +   LV AM SL  AL  +G   I+VS+PHS+GI+  +DPPS GRF  G+D  + APML
Sbjct  137  GLMERLVPAMVSLSGALSAAGFHRIRVSTPHSMGILSSSDPPSSGRFIRGYDRSVFAPML  196

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             F R+T  PFMVNPYPYF Y P       FRPN+G  DR +  TY NMFD
Sbjct  197  AFHRKTRTPFMVNPYPYFNYNPASLAYTQFRPNRGKRDRVTGITYTNMFD  246



>ref|XP_006394688.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
 gb|ESQ31974.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
Length=458

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 167/247 (68%), Gaps = 3/247 (1%)
 Frame = +3

Query  27   NLILKIMEMSLRPSPIFLFFLVSAFL-FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEK  200
            N +L     S   SPI +F +V A + F  G   SIGVNYGTL +NLPPP +VA FL   
Sbjct  2    NYMLLFFSCSWVISPISMFTMVVALIIFSTGANASIGVNYGTLANNLPPPRQVAEFLLHS  61

Query  201  TVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATK  380
            TVI+RI++FD +P ILRAFA TGI VTVTVPN +I  L +  +A QW++ +I+P +P+T 
Sbjct  62   TVINRIRLFDADPQILRAFAHTGIAVTVTVPNHQITHLTNLSFAEQWISDHIQPHFPSTN  121

Query  381  INIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPS  557
            I  I VGNEV+      +   LV AM+SL+ ALV + + + I++S+PHSLGI+  + PPS
Sbjct  122  IIRILVGNEVISTANHLLIRTLVPAMQSLHTALVSASLHRRIQISTPHSLGILSDSTPPS  181

Query  558  MGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRR  737
              +FR G+D  +L P+L FLR    PF+VNPYP+FGY+PD  D ALFRPN+G +D  S+ 
Sbjct  182  SAKFRQGYDTHVLKPLLSFLRSIASPFVVNPYPFFGYSPDTLDFALFRPNQGLLDHDSKL  241

Query  738  TYGNMFD  758
             Y NMFD
Sbjct  242  LYTNMFD  248



>gb|KJB37375.1| hypothetical protein B456_006G202300 [Gossypium raimondii]
Length=509

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 175/258 (68%), Gaps = 7/258 (3%)
 Frame = +3

Query  6    LNYRNKSNLILKIMEMSLRPSPI---FLFFLVSAFL---FIHGVRSIGVNYGTLGDNLPP  167
            L+ R+ S+L  + + M+ +  P+    L  ++S FL   F+ GV SIGVNYGT+ +NLPP
Sbjct  30   LHQRSPSSLTHQKLAMAKQFIPLSSSILVAVISLFLVSTFVPGVGSIGVNYGTVANNLPP  89

Query  168  PTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVA  347
            P +VA FL E TVI+R+K++D NPDIL+AFA TGI VTVTVPN +I  L    +A QWV 
Sbjct  90   PPQVAHFLLESTVINRVKLYDANPDILKAFAHTGIAVTVTVPNDQIPRLTKLNFARQWVE  149

Query  348  ANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHS  524
             N++P+ PAT I  I VGNEV+      +   LV AM++L+ ALV + + + I+VS+PHS
Sbjct  150  DNVQPYTPATNIVRILVGNEVITTADKMLIGNLVPAMQTLHTALVAASLDRRIQVSTPHS  209

Query  525  LGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRP  704
            LG++  + PPS G+FR G+D+ +L P+L FLR T  PFM+NPYP+FG +PD  D ALFRP
Sbjct  210  LGVLSNSSPPSSGKFRLGYDIHVLKPLLSFLRATKSPFMINPYPFFGCSPDTLDYALFRP  269

Query  705  NKGYVDRFSRRTYGNMFD  758
            N G +D  +   Y NM D
Sbjct  270  NAGVLDENTGLLYTNMLD  287



>ref|XP_008376760.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Malus domestica]
Length=465

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 159/230 (69%), Gaps = 2/230 (1%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
              L  LVS F+   G  SIGVNYGT+  +LPPP +VA FL E T+I+R+++FD NPDILR
Sbjct  14   CILLLLVSIFV-QGGEGSIGVNYGTMASDLPPPAKVAHFLLESTIINRVRLFDTNPDILR  72

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFA TGI VT+T+PN +I  L     A QW+  N++P  PAT I  I VGNEVL      
Sbjct  73   AFAHTGIAVTITIPNDQIPHLTKIRSAQQWLKTNVQPHIPATNIVRILVGNEVLSTTNKL  132

Query  432  MQNGLVAAMRSLYNALVK-SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
               GLV AM++L+NALV  S  ++IKVS+PHSLGI+  + PPS G+FR G+D+ +L P+L
Sbjct  133  FITGLVPAMQALHNALVDASWDRQIKVSTPHSLGILSSSTPPSSGKFRQGYDIHVLKPLL  192

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             FL+ TN PFMVNPYPYFGY+P+  D ALFRPN G +D  ++  Y NM D
Sbjct  193  TFLQSTNSPFMVNPYPYFGYSPETLDFALFRPNPGVLDGNTKMLYTNMLD  242



>ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36121.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=476

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 165/240 (69%), Gaps = 7/240 (3%)
 Frame = +3

Query  60   RPSPIFLFFLVSAFLFIHGV------RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            R S      +V+A LF+          ++GVNYGT+ +NLPPP +VA FL E T+I+R++
Sbjct  3    RESAALYASMVTAILFLQSTIIPGAEGTLGVNYGTVANNLPPPAQVANFLVESTIINRVR  62

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  401
            +FD N +IL+AFA TGI VTVTVPN +I  L    +A QWV +NI+P+ PAT I  I VG
Sbjct  63   LFDTNREILQAFAHTGIEVTVTVPNDQIPRLTKLNFAQQWVKSNIQPYVPATNIIRILVG  122

Query  402  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPG  578
            NEV+      +  GLV AM++L+ ALV + + ++IKVS+PHSLGI+  + PPS G+FR G
Sbjct  123  NEVISTANKMLIAGLVPAMQTLHTALVGASLDRKIKVSTPHSLGILSTSSPPSTGKFRQG  182

Query  579  WDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +DV +L P+L FLR+TN PFM+NPYP+FG +PD  D ALFRPN G +D  ++  Y NM D
Sbjct  183  YDVHVLKPLLSFLRDTNSPFMINPYPFFGCSPDTLDYALFRPNAGVMDDNTKLMYTNMLD  242



>gb|KCW85570.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=460

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 160/236 (68%), Gaps = 1/236 (0%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL    +  ++V++PHSLGI+  ++PPS GRFR G+D  
Sbjct  123  LATSDKNLIARLLPAMKALHSALQLVNVTNVQVTTPHSLGILSSSEPPSTGRFRRGYDRA  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            I AP+L F R+T   FMVNPYP+FG+     + ALF+PN G  D  + + Y NMFD
Sbjct  183  IFAPILDFHRQTKSAFMVNPYPFFGFTAKTLNYALFKPNAGIFDAVTGKNYTNMFD  238



>ref|XP_010427314.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=452

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  28   ISAIGVNYGTLG-NLPPPTQVANFIKTQTTIDSVKIFDVNPDILRAFAGTGISVVVTVPN  86

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF P T I  I+VGNE+L  G   M N L+ AM +L NA
Sbjct  87   GDIPALANGLQARRWVSANILPFNPQTIIKYISVGNEILLSGDNNMINNLLPAMMNLNNA  146

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G+K++KV++ HSL I+       PS GRFRPGWD GILAP+L + R T  PFMVNP
Sbjct  147  LVRAGVKDVKVTTAHSLNIIAYDLTGAPSTGRFRPGWDKGILAPILAYHRRTKSPFMVNP  206

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YP+FG+ P   + A+FR P K   D F+R+ Y NMFD
Sbjct  207  YPFFGFDPKNVNFAIFRSPYKAVRDPFTRKVYTNMFD  243



>ref|XP_006291113.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
 gb|EOA24011.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
Length=454

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  30   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  88

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
             +I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  89   VDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  148

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFR GWD GILAP+L + R T  PFMVNP
Sbjct  149  LVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRAGWDKGILAPILAYHRRTKSPFMVNP  208

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+R  Y NMFD
Sbjct  209  YPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMFD  245



>ref|XP_010043555.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW85569.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=501

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 160/236 (68%), Gaps = 1/236 (0%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL    +  ++V++PHSLGI+  ++PPS GRFR G+D  
Sbjct  123  LATSDKNLIARLLPAMKALHSALQLVNVTNVQVTTPHSLGILSSSEPPSTGRFRRGYDRA  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            I AP+L F R+T   FMVNPYP+FG+     + ALF+PN G  D  + + Y NMFD
Sbjct  183  IFAPILDFHRQTKSAFMVNPYPFFGFTAKTLNYALFKPNAGIFDAVTGKNYTNMFD  238



>ref|XP_007039107.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY23608.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=482

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 161/237 (68%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   IFLFFLVSAFLF------IHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            +F   LV+A LF      + GV  +IG+NYGT+ +NLPPP +VA FL E TVI+R+++FD
Sbjct  25   VFSSVLVAAILFFLASTPVRGVEGTIGINYGTVANNLPPPAQVAHFLLESTVINRVRLFD  84

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             NPDIL+AFA TGI +TVTVPN +I  L     A QWV  NI+P+ PAT I  I VGNEV
Sbjct  85   ANPDILKAFAHTGIAITVTVPNDQIPRLTKLNLAQQWVEDNIQPYTPATNIVRILVGNEV  144

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDV  587
            +      +   LV A+++L+ ALV++ + + I+VS+PHSLGI+  + PPS G+FR G+D 
Sbjct  145  ISTANKLLIGSLVPAVQTLHTALVEASLDRRIQVSTPHSLGILSNSSPPSTGKFRQGYDT  204

Query  588  GILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             +L P+L FLR TN PFMVNPYP+FG +PD  D ALFRPN G  D  +   Y NM D
Sbjct  205  HVLKPLLSFLRATNSPFMVNPYPFFGCSPDTLDYALFRPNAGVFDENTELHYTNMLD  261



>emb|CDY41232.1| BnaC08g26260D [Brassica napus]
Length=451

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 164/236 (69%), Gaps = 7/236 (3%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIH---GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            P     L+SA +F+     + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNP
Sbjct  6    PSISLLLLSAAVFLTLPATISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            DI+RAFAGTGI V VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VGNE+L  
Sbjct  65   DIIRAFAGTGISVVVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNEILLS  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGI  593
            G   M   L+ AM++L  AL  +G+K+IKV++ HSL I+       PS GRFRPGWD G+
Sbjct  125  GDDNMIKNLLPAMKNLNAALFHAGVKDIKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGV  184

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            LAP+L F R+T  PF+VNPYPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  185  LAPILAFHRQTKSPFVVNPYPYFGFDPKNVNFAIFRSPYKAVRDPLTGKVYTNMYD  240



>gb|KFK34786.1| hypothetical protein AALP_AA5G193500 [Arabis alpina]
Length=447

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPP++VA F+K +T ID +KIF+V+P+ILRAFAG+GI V VTVPN
Sbjct  22   ISAIGVNYGTLG-NLPPPSQVANFIKTRTSIDSVKIFNVDPNILRAFAGSGISVVVTVPN  80

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WVAANI P++P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  81   GDIPALANGRQARRWVAANILPYHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  140

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G+K++KV++ HSL I+       PS GRFRPGWD GILAP+L + R T  PFM+NP
Sbjct  141  LVRAGVKDVKVTTAHSLNIIAYDLTGAPSTGRFRPGWDKGILAPILAYHRRTKSPFMINP  200

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+++ Y NM+D
Sbjct  201  YPYFGFDPKNVNFAIFRSPYKAVHDPFTKKVYTNMYD  237



>ref|XP_006435532.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
 gb|ESR48772.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
Length=449

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L     A  WVAANI PFYP+TKI  + VGNE++     +    LV AM+S+  A
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNEIMQSANKDWIYNLVPAMKSINKA  145

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L+++GIK+IK+S+P++LG +  ++PPS G+FR G+D  I+APML+FLRET   FM+NPYP
Sbjct  146  LIEAGIKDIKISTPNTLGFLGVSEPPSAGKFREGYDKDIIAPMLEFLRETKSAFMINPYP  205

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YF YA   +D  LF+PNKG  D  +R TY NMFD
Sbjct  206  YFNYADSISDYILFKPNKGVYDPNTRITYSNMFD  239



>ref|XP_011658156.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ +NLPPP++VA FLK  T IDR+KIFD NPDILRAFAGTGI +TV+V NG+
Sbjct  23   SIGVNYGTVANNLPPPSQVAAFLKSHTSIDRVKIFDANPDILRAFAGTGIALTVSVANGD  82

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA NI PF+P T IN IAVGNE+L      +   L+ AM+++++AL 
Sbjct  83   IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSALK  142

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I ++KVS+PHSLGI+  ++PPS GRFR G+D  I AP+L F  +T  PFMVNPYPYF
Sbjct  143  LAHISDVKVSTPHSLGILSASEPPSTGRFRRGYDRAIFAPILDFHNQTKTPFMVNPYPYF  202

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P   D ALF+PN G  D  + + Y NMFD
Sbjct  203  GFRPATLDYALFKPNPGVFDNATGKHYTNMFD  234



>gb|KHG22731.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=465

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 159/230 (69%), Gaps = 3/230 (1%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            +   FLVS    + GV SIGVNYGT+ +NLPPP +VA FL E TVI+R+K++D NPDIL+
Sbjct  16   VISLFLVSTL--VPGVGSIGVNYGTVANNLPPPPQVAHFLLESTVINRVKLYDANPDILK  73

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFA TGI VTVTVPN +I  L    +A QWV  N++P+ PAT I  I VGNEV+      
Sbjct  74   AFAHTGIAVTVTVPNDQIPRLTKLNFARQWVEDNVQPYTPATNIVRILVGNEVITTADKM  133

Query  432  MQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
            +   LV AM++L+ ALV + + + I+VS+PHSLG++  + PPS G+FR G+D+ +L P+L
Sbjct  134  LIGNLVPAMQTLHTALVAASLDRRIQVSTPHSLGVLSNSSPPSSGKFRLGYDIHVLKPLL  193

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             FLR T  PFM+NPYP+FG +PD  D ALFRPN G +D  +   Y NM D
Sbjct  194  SFLRATKSPFMINPYPFFGCSPDTLDYALFRPNAGVLDENTGLLYTNMLD  243



>ref|XP_006486487.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=449

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L     A  WVAANI PFYP+TKI  + VGNE++     +    LV AM+S+  A
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNEIMQSANKDWIYNLVPAMKSINKA  145

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L+++GIK+IK+S+P++LG +  ++PPS G+FR G+D  I+APML+FLRET   FM+NPYP
Sbjct  146  LIEAGIKDIKISTPNTLGFLGVSEPPSAGKFREGYDKDIIAPMLEFLRETKSAFMINPYP  205

Query  657  YFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YF YA   +D  LF+PNKG  D  +R TY NMFD
Sbjct  206  YFNYADSISDYILFKPNKGVYDPNTRITYSNMFD  239



>ref|XP_002318439.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
 gb|EEE96659.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
Length=460

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 159/228 (70%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL E T+I+R+++FD N +I++AF
Sbjct  16   ILLLASAFNILGAEGSIGVNYGTVADNLPPPAQVAHFLLESTIINRVRLFDTNTEIIQAF  75

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI +T+TVPN +I  L + G+A +WV +N++P+ PAT I  I VGNEV+        
Sbjct  76   AHTGIAITITVPNDQIPHLTNLGFAQEWVKSNVQPYVPATNIVRILVGNEVISIENKLSV  135

Query  438  NGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
              LV AM++L+ ALV++ +   IK+S+PHSLGI+  + PPS G+FR G+   IL P+L+F
Sbjct  136  ASLVPAMKALHTALVRASLDHRIKISTPHSLGILSSSSPPSTGKFRQGYATRILKPLLRF  195

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LR TN PFM+NPYP+FG++ D  D ALFRPN G  D  ++ +Y NM D
Sbjct  196  LRATNSPFMINPYPFFGFSADTLDYALFRPNSGVFDENTKLSYTNMLD  243



>emb|CDY41234.1| BnaC08g26240D [Brassica napus]
Length=455

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  27   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  85

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI+PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  86   GDIPALANGVQARRWVSANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  145

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G+K++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R+T  PFMVNP
Sbjct  146  LVRAGVKDVKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGVLAPILAYHRQTKSPFMVNP  205

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  206  YPYFGFDPKNVNFAIFRSPYKAVRDPLTGKVYTNMYD  242



>ref|XP_010534498.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=449

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 161/234 (69%), Gaps = 7/234 (3%)
 Frame = +3

Query  75   FLFFLVSAFLFIH---GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  245
             L  + +A LF+H   G+ ++GVNYGTLG NLP P +VA F++ +T ID +KIFDVNPDI
Sbjct  11   LLLVISAAVLFLHLPDGISAVGVNYGTLG-NLPSPADVANFIRTRTTIDSVKIFDVNPDI  69

Query  246  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  425
            LRAFAG+GI V VTVPNGEI  L +   A +W AANIKPF+P T+I  I+VGNE+L  G 
Sbjct  70   LRAFAGSGISVVVTVPNGEIPALVNTRQARRWGAANIKPFHPQTRIKYISVGNEILLTGD  129

Query  426  PEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILA  599
              M + LV AM SL+ AL++SGI +IKV++ H+L I+       PS GRFRP WD  +LA
Sbjct  130  SNMISNLVPAMNSLHRALIRSGITDIKVTTAHALNIIEYELNGAPSRGRFRPMWDKTVLA  189

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALF-RPNKGYVDRFSRRTYGNMFD  758
            P+L F R T  PFMVNPYPYFG+ P   + A+F RP K   D F+   Y NMFD
Sbjct  190  PVLAFHRRTKTPFMVNPYPYFGFDPKNVNFAIFRRPYKAVRDLFTGHVYTNMFD  243



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 163/228 (71%), Gaps = 5/228 (2%)
 Frame = +3

Query  87   LVSAFLFIHGV--RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
            L+ A +F  GV   +IGVNYGT+ ++LPPP+EVARFL E T I+R+++FD +P++++AFA
Sbjct  9    LLLASVFFQGVVEGNIGVNYGTVANDLPPPSEVARFLLESTTINRVRMFDADPEMIQAFA  68

Query  261  GTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
             TGI VTVTVPN E+IP L    +A QWV  N++P+ PAT +  I VGNEVL      + 
Sbjct  69   HTGIAVTVTVPN-ELIPRLTKLSFAQQWVKTNVQPYVPATNLIRILVGNEVLSTANKLLI  127

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             GLV AM++L+ AL    + + IKVS+PHSLGI+  + PPS GRFR G+DV ++ P+L F
Sbjct  128  AGLVPAMQTLHTALAAVSLDRRIKVSTPHSLGILSTSSPPSTGRFRQGYDVHVIKPLLSF  187

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LR TN PFM+NPYP+FGY+ +  D ALFRPN G +D  ++R Y NM D
Sbjct  188  LRATNSPFMINPYPFFGYSAETLDYALFRPNSGVLDENTQRVYTNMLD  235



>ref|XP_008810606.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=351

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 146/212 (69%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYG + DNLPPP +VA FLK  T IDR+K+FD NPD +RAFAGTGI + +TVPNG+
Sbjct  22   SIGVNYGAVADNLPPPPQVAAFLKANTFIDRVKLFDSNPDFIRAFAGTGISLMITVPNGD  81

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L     A  W+A N+ PF+PAT I+++AVGNEV+      +   LV AMRSL  AL 
Sbjct  82   VPSLAKVPAARAWIANNVAPFHPATNISLLAVGNEVMATADRNLIAHLVPAMRSLSTALA  141

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            ++G  EI+VS+PHSLGI+  ++PPS GRFR G+D  I APML F R    PF+VNPYPYF
Sbjct  142  EAGFPEIRVSTPHSLGILSASEPPSSGRFRRGYDRIIFAPMLDFHRRAKTPFVVNPYPYF  201

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+     D ALF+PN G  D  +   Y NMFD
Sbjct  202  GFTEKTLDYALFKPNAGVFDPVTGANYTNMFD  233



>ref|XP_006350772.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=448

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 161/233 (69%), Gaps = 5/233 (2%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            PIF  F+    L  +GV S   +G+NYGT+ DNLPPP++VA F+++ T +++IKIFD NP
Sbjct  9    PIFSSFIF--LLLCNGVSSDYLLGINYGTVADNLPPPSQVAAFIRDHTTLNKIKIFDANP  66

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +I+RAFA TG+ VTVTVPNG+I  +     A  WV  N+ PFYP T+I+ I +GNEV+  
Sbjct  67   EIIRAFADTGVWVTVTVPNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICIGNEVMAT  126

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
            G   +   LV AMR+++ AL+ +GI +I+VS+PHSLGI+ R++PPS G FR  +D  I A
Sbjct  127  GDKNLIAHLVPAMRAIHEALLAAGINDIQVSTPHSLGILSRSEPPSSGLFRRVYDRVIFA  186

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML+F RET  PFM+ PYP+FG+  +  D ALF+PN G  D  +   Y NMFD
Sbjct  187  PMLEFHRETKSPFMICPYPFFGFNDETLDYALFKPNNGVYDEATGMNYTNMFD  239



>emb|CDY53692.1| BnaA07g37860D [Brassica napus]
Length=449

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 166/236 (70%), Gaps = 7/236 (3%)
 Frame = +3

Query  69   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGI  593
            G     + L+ AMR++ +ALV++G++++KV++ HSL I+       PS GRFRP W+  I
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGVRDVKVTTAHSLNIIAYDLHGAPSRGRFRPVWEKNI  184

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            LAP+L F R+T  PFMVNPYPYFG+ P   + A+FR P K   D F+R+ Y NM+D
Sbjct  185  LAPILAFHRQTKSPFMVNPYPYFGFDPKNVNFAIFRSPYKAVRDPFTRKIYTNMYD  240



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 164/243 (67%), Gaps = 8/243 (3%)
 Frame = +3

Query  54   SLRPSPIFLF---FLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  209
            S  P+  FLF   F++    F+H        +IGVNYGT+ DNLPPP +VA F+K++T I
Sbjct  5    SSSPAKPFLFSISFVIFLHHFLHHWAVAAGYAIGVNYGTVADNLPPPAQVASFIKDQTSI  64

Query  210  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  389
            D+IKIFD NPDI+RAFA + + +T+TV NG+++ +     A  WV+ N+ P+YP TKI+ 
Sbjct  65   DKIKIFDANPDIIRAFANSNVSLTITVGNGDVLAVSKLPAAQSWVSTNVLPYYPQTKIHR  124

Query  390  IAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRF  569
            I VGNEV+  G   +   LV+AM+S++ AL  +GI +I+VS+PHS+GIM R++PPS GRF
Sbjct  125  IDVGNEVIATGDRSLIAHLVSAMKSVHEALRLAGISDIQVSTPHSMGIMSRSEPPSSGRF  184

Query  570  RPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGN  749
            R G+D  I APML+F R T  PFMV PYP+FG+     D ALF+PN G  D  +   Y N
Sbjct  185  RRGYDRVIFAPMLEFHRRTGSPFMVCPYPFFGFTSKTLDYALFKPNDGIFDNVTGVNYTN  244

Query  750  MFD  758
            MFD
Sbjct  245  MFD  247



>emb|CDY62387.1| BnaCnng40170D [Brassica napus]
Length=449

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 165/236 (70%), Gaps = 7/236 (3%)
 Frame = +3

Query  69   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            P   F L SA   F F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PFISFLLFSAAVLFTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGI  593
            G     + L+ AMR++ +ALV++G++++KV++ HSL I+       PS GRFRP W+  I
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGVRDVKVTTAHSLNIIAYDLHGAPSRGRFRPVWEKSI  184

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            LAP+L F R+T  PFMVNPYPYFG+ P   + A+FR P K   D F+R+ Y NM+D
Sbjct  185  LAPILAFHRQTKSPFMVNPYPYFGFDPKNVNFAIFRSPYKAVRDPFTRKIYTNMYD  240



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ +NLPPPT+VA FLK +T IDR+KIFD NPDILRAFAGTGI +TV++ NG+
Sbjct  103  SIGVNYGTVANNLPPPTQVAAFLKSRTSIDRVKIFDANPDILRAFAGTGIALTVSIANGD  162

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA NI PF+P T IN IAVGNE+L      +   L+ AM+++++AL 
Sbjct  163  IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSALK  222

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I ++KVS+PHSLGI+  ++PPS GRFR G+D  I AP+L F  +T  PFMVNPYP+F
Sbjct  223  LANISDVKVSTPHSLGILSASEPPSTGRFRRGYDRAIFAPILDFHNQTKTPFMVNPYPFF  282

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P   D ALF+PN G  D  + + Y NMFD
Sbjct  283  GFRPATLDYALFKPNAGVFDNATGKHYTNMFD  314



>ref|XP_010937626.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=450

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL DNLPPP++VA FLK  T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  24   SIGVNYGTLADNLPPPSQVAAFLKANTFIDRVKLFDSNPDLIRAFAGTGISLMITVPNGD  83

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L     A  WVA N+ PF+PAT I+++AVGNEV+      +   LV AMRSL  AL 
Sbjct  84   VPSLAKLPAARTWVANNVAPFHPATNISLLAVGNEVMATADRNLIAHLVPAMRSLSAALA  143

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            ++G  EI+VS+PHSLGI+  ++PPS GRFR G+D  I APML F R    PF+VNPYPYF
Sbjct  144  EAGFPEIRVSTPHSLGILSASEPPSSGRFRRGYDRAIFAPMLDFHRGAKTPFVVNPYPYF  203

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+     + ALF+PN G  D  +   Y +MFD
Sbjct  204  GFTEKTLNYALFKPNAGVFDPVTGVNYTDMFD  235



>gb|KHF99783.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=510

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 158/239 (66%), Gaps = 5/239 (2%)
 Frame = +3

Query  57   LRPSPIFLFFLVSAFLFI-----HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP PT+VA+FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTVADNLPTPTQVAKFLKSKTNIDRIK  63

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  401
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  402  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGW  581
            NE+L      +   L+ AM++L +AL  +    +KVS+PHSLGI+  ++PPS G+FR G+
Sbjct  124  NEILATSDKTLIAYLLPAMKALRSALDSANATSVKVSTPHSLGILSTSEPPSAGKFRKGY  183

Query  582  DVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            D  I AP+L+F ++T  PFMVNPYPYFG+ P   D ALF+PN G  D  +   Y NMFD
Sbjct  184  DKLIFAPILEFHKQTKSPFMVNPYPYFGFKPQTLDYALFKPNGGVFDAGTGINYTNMFD  242



>emb|CDY40218.1| BnaA09g35000D [Brassica napus]
Length=453

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G+K++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R+T  PFMVNP
Sbjct  145  LVRAGVKDVKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGVLAPILAYHRQTKSPFMVNP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  205  YPYFGFDPKNVNFAIFRSPYKAVRDPLTGKVYTNMYD  241



>ref|XP_009116237.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=453

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G+K++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R+T  PFMVNP
Sbjct  145  LVRAGVKDVKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGVLAPILAYHRQTKSPFMVNP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  205  YPYFGFDPHNVNFAIFRSPYKAVRDPLTGKVYTNMYD  241



>ref|XP_009384878.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 148/216 (69%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            +GVNYG   DNLPPP +VA FLK++T +DR+K+FD NPDI+RAFAGTGI + +TVPNG+I
Sbjct  29   VGVNYGAFADNLPPPAQVAAFLKDRTFVDRVKLFDANPDIIRAFAGTGISLMITVPNGDI  88

Query  306  IPLKDAGYAAQ------WVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  467
              L     +A       WVA N+ PFYPAT I++IAVGNEVL      +   LV AMRSL
Sbjct  89   PSLASRRSSAPSPAASAWVAINVAPFYPATNISLIAVGNEVLATSDRNLIAHLVPAMRSL  148

Query  468  YNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
              AL  SG  +I+VS+PHSLGI+  ++PPS GRFRPG+D  I APML F R T  PF+VN
Sbjct  149  SAALAASGFPQIRVSTPHSLGILSASEPPSTGRFRPGYDRVIFAPMLDFHRRTRTPFVVN  208

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            PYPYFGY     D ALFRPN G  D  +   Y NMF
Sbjct  209  PYPYFGYTARTLDYALFRPNPGVFDPATGVNYTNMF  244



>ref|XP_009116238.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=450

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 157/223 (70%), Gaps = 4/223 (2%)
 Frame = +3

Query  99   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  278
            F     + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI +
Sbjct  19   FTLPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISL  77

Query  279  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  458
             VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VGNE+L  G   M   L+ AM
Sbjct  78   VVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAM  137

Query  459  RSLYNALVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNG  632
            ++L  AL  +G+K+IKV++ HSL I+       PS GRFRPGWD G+LAP+L F RET  
Sbjct  138  KNLNAALFHAGVKDIKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGVLAPILAFHRETKS  197

Query  633  PFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            PF+VNPYPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  198  PFVVNPYPYFGFDPKNVNFAIFRSPYKEVRDPLTGKVYTNMYD  240



>gb|KDP35193.1| hypothetical protein JCGZ_09352 [Jatropha curcas]
Length=478

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 160/228 (70%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            ++FL S  LF     ++GVNYGTL +NLPPP +VA FL + T+I+R+K+FD N +IL+AF
Sbjct  17   IWFLESTLLFQGVEATLGVNYGTLANNLPPPAKVADFLVQSTIINRVKLFDTNTEILQAF  76

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI VTVTVP+ +I  L    ++ +W+ +NI+P+ PAT I  I VGNEVL      + 
Sbjct  77   AHTGIAVTVTVPDDQIPHLTKLNFSQEWLKSNIQPYIPATNIIRILVGNEVLSTANKLLI  136

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
              LV AM++L+ ALV   +  +IK+S+PHSLGI+  + PPS G+FR G+D+ +L P+L F
Sbjct  137  ASLVPAMQTLHTALVSMSLDSKIKISTPHSLGILSTSSPPSTGKFRQGYDIHVLRPLLNF  196

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LRETN PFM+NPYP+FG + +  D ALFRPN G VD+ ++  Y NM D
Sbjct  197  LRETNSPFMINPYPFFGCSAETLDYALFRPNSGVVDQNTKLLYTNMLD  244



>ref|XP_009103956.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=449

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 165/236 (70%), Gaps = 7/236 (3%)
 Frame = +3

Query  69   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +  ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQASIDSVKIFNVDP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGI  593
            G     + L+ AMR++ +ALV++G++++KV++ HSL I+       PS GRFRP W+  I
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGVRDVKVTTAHSLNIIAYDLHGAPSRGRFRPVWEKNI  184

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            LAP+L F R+T  PFMVNPYPYFG+ P   + A+FR P K   D F+R+ Y NM+D
Sbjct  185  LAPILAFHRQTKSPFMVNPYPYFGFDPKNVNFAIFRSPYKAVRDPFTRKIYTNMYD  240



>ref|XP_012075168.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Jatropha curcas]
Length=466

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 160/228 (70%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            ++FL S  LF     ++GVNYGTL +NLPPP +VA FL + T+I+R+K+FD N +IL+AF
Sbjct  17   IWFLESTLLFQGVEATLGVNYGTLANNLPPPAKVADFLVQSTIINRVKLFDTNTEILQAF  76

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI VTVTVP+ +I  L    ++ +W+ +NI+P+ PAT I  I VGNEVL      + 
Sbjct  77   AHTGIAVTVTVPDDQIPHLTKLNFSQEWLKSNIQPYIPATNIIRILVGNEVLSTANKLLI  136

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
              LV AM++L+ ALV   +  +IK+S+PHSLGI+  + PPS G+FR G+D+ +L P+L F
Sbjct  137  ASLVPAMQTLHTALVSMSLDSKIKISTPHSLGILSTSSPPSTGKFRQGYDIHVLRPLLNF  196

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LRETN PFM+NPYP+FG + +  D ALFRPN G VD+ ++  Y NM D
Sbjct  197  LRETNSPFMINPYPFFGCSAETLDYALFRPNSGVVDQNTKLLYTNMLD  244



>ref|XP_009419749.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 150/216 (69%), Gaps = 5/216 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYG   +NLPPP +VA FLK++T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  40   SIGVNYGAYANNLPPPAQVAAFLKDRTFIDRVKLFDANPDMIRAFAGTGISLMITVPNGD  99

Query  303  IIPLKDAGYAAQ-----WVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  467
            I  L     A       WVA+++ PFYPAT I+++AVGNEVL      +   LV AMRSL
Sbjct  100  IASLASRSSAPSPAASAWVASHVAPFYPATNISLVAVGNEVLATADRNLIAHLVPAMRSL  159

Query  468  YNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
            Y AL  +G  +I+VS+PHSLGI+  ++PPS+GRFR G+D  I APML F R T  PF+VN
Sbjct  160  YAALSAAGFHQIRVSTPHSLGILSTSEPPSIGRFRRGYDRAIFAPMLDFHRRTRTPFVVN  219

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            PYPYFGY     + ALFRPN G  D  +   Y NMF
Sbjct  220  PYPYFGYTARTLNYALFRPNSGVFDPATGVNYTNMF  255



>ref|XP_009620579.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
[Nicotiana tomentosiformis]
Length=365

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 149/211 (71%), Gaps = 0/211 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYG + DNL PPT+V  F++++T I++IKIFD NP+I+ AFA TGI +T+TVPNG I
Sbjct  28   IGVNYGXVTDNLLPPTQVTAFIRDQTTINKIKIFDANPEIIHAFANTGIWLTITVPNGNI  87

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
            + +  +  A  WV  N+ P+YP TKI+ I VGNEV+      +   LV AM++++ AL++
Sbjct  88   LSVSKSAGATTWVNENVVPYYPHTKIDRICVGNEVIATSDKNLIAHLVPAMKAIHEALLQ  147

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
            +GI +I+VS+PHSLGIM R++PPS GR R G+D  I APML+F RET  PFM+ PYPYFG
Sbjct  148  AGINDIQVSTPHSLGIMSRSEPPSSGRSRRGYDRVIFAPMLEFHRETKSPFMICPYPYFG  207

Query  666  YAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +     D ALF+PN G  D  +   Y NMFD
Sbjct  208  FNDKALDYALFKPNVGVYDEVTGMNYTNMFD  238



>emb|CDY40219.1| BnaA09g35010D [Brassica napus]
Length=450

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 156/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI + VTVPN
Sbjct  25   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISLVVTVPN  83

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WVAANI+PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  84   GDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  143

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            L  +G+K+IKV++ HSL I+       PS GRFRPGWD G+LAP+L F RET  PF+VNP
Sbjct  144  LFHAGVKDIKVTTAHSLNIIAYELNGAPSSGRFRPGWDKGVLAPILAFHRETKSPFVVNP  203

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D  + + Y NM+D
Sbjct  204  YPYFGFDPKNVNFAIFRSPYKEVRDPLTGKVYTNMYD  240



>ref|XP_004498531.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like, partial [Cicer 
arietinum]
Length=360

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 155/226 (69%), Gaps = 4/226 (2%)
 Frame = +3

Query  84   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            FL+ +F  + G   IGVNYGTLG+NLPPP++VA+FL   T I++++IFD NP+IL AFA 
Sbjct  3    FLLKSFAEVQG---IGVNYGTLGNNLPPPSQVAKFLLHSTTINQVRIFDANPEILHAFAN  59

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            TGI +T+T+PN +I  + +   A QW+  N++PF P+T I  I VGNEVL      + + 
Sbjct  60   TGIEITITIPNDQIPNITNLTLAQQWIKTNVQPFIPSTNIIRILVGNEVLSTANKLLIST  119

Query  444  LVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLR  620
            LV AM++L+ AL+ S +   IKVS+PHSLGI+  + PPS GRFR G+D  IL PML+FL+
Sbjct  120  LVPAMQTLHIALMTSSLDNLIKVSTPHSLGILSNSSPPSSGRFRQGYDTHILKPMLRFLK  179

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            + N PFMVNPYP+F  +    D  LFR N G+ D  ++  Y NMFD
Sbjct  180  DANSPFMVNPYPFFACSSSNLDYVLFRANSGFFDDNTKLLYTNMFD  225



>ref|XP_012075958.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Jatropha 
curcas]
 gb|KDP34495.1| hypothetical protein JCGZ_11045 [Jatropha curcas]
Length=494

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 149/212 (70%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ DNLP P++VA FLK KT IDRIKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   SIGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  W+AANI P++P T I  IAVGNE+L      +    + AM++L +AL 
Sbjct  86   IPSLAKLPAAKAWIAANILPYHPKTIIKYIAVGNEILATSDKSLIAHTLPAMKALKSALE  145

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I  I+VS+PHSLGI+  ++PPS GRFR G+D  I AP+L+F R+T  PFMVNPYP+F
Sbjct  146  LANITNIQVSTPHSLGILSSSEPPSTGRFRKGYDTRIFAPILEFHRQTKSPFMVNPYPFF  205

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+  +  + ALF+PN G  D  + + Y NMFD
Sbjct  206  GFKAETLNYALFKPNGGVFDAATGKNYTNMFD  237



>gb|KJB83778.1| hypothetical protein B456_013G263800 [Gossypium raimondii]
Length=510

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 156/239 (65%), Gaps = 5/239 (2%)
 Frame = +3

Query  57   LRPSPIFLFFLVSAFLFI-----HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP P +VA FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTIADNLPTPAQVANFLKTKTNIDRIK  63

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  401
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  402  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGW  581
            NE+L      +   L+ AM++L +AL  +    +KVS+PHSLGI+  ++PPS G+FR G+
Sbjct  124  NEILATSDKTLIAHLLPAMKALRSALDSANATSVKVSTPHSLGILSTSEPPSAGKFRKGY  183

Query  582  DVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            D  I AP+L+F ++T  PFMVNPYPYFG+ P   D ALF+PN G  D  +   Y NMFD
Sbjct  184  DKLIFAPILEFHKQTKSPFMVNPYPYFGFKPQTLDYALFKPNGGVFDAGTGINYTNMFD  242



>ref|XP_012075957.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Jatropha 
curcas]
Length=506

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 149/212 (70%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ DNLP P++VA FLK KT IDRIKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   SIGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  W+AANI P++P T I  IAVGNE+L      +    + AM++L +AL 
Sbjct  86   IPSLAKLPAAKAWIAANILPYHPKTIIKYIAVGNEILATSDKSLIAHTLPAMKALKSALE  145

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I  I+VS+PHSLGI+  ++PPS GRFR G+D  I AP+L+F R+T  PFMVNPYP+F
Sbjct  146  LANITNIQVSTPHSLGILSSSEPPSTGRFRKGYDTRIFAPILEFHRQTKSPFMVNPYPFF  205

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+  +  + ALF+PN G  D  + + Y NMFD
Sbjct  206  GFKAETLNYALFKPNGGVFDAATGKNYTNMFD  237



>ref|XP_011027355.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Populus euphratica]
Length=457

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 0/211 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVASFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L DA  A +WVA NI+ FYP T+I +IAVGNE+L  G  E  + LV  M+SL+ ALV
Sbjct  88   IPALVDANAAGRWVANNIEQFYPQTRIKLIAVGNEILFSGNKEWISHLVPCMKSLHQALV  147

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            ++GI ++KVS+P++LGI+  +  PS  R +P +   + APML+FLR+T  P +VNPYPYF
Sbjct  148  RAGINDVKVSTPYTLGILQTSVQPSAARIKPAYGKVVFAPMLEFLRQTKSPLLVNPYPYF  207

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
             YA    D  LF+PN G+ D  +  TY NMF
Sbjct  208  SYARSMEDYILFKPNPGFHDDNTNITYTNMF  238



>ref|XP_011654593.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Cucumis 
sativus]
Length=411

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  160

Query  423  TPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               +   LV AM+SL+ AL+++ + + I++S+PHSLGI+  + PPS  RFR G+D  ++ 
Sbjct  161  NKLLIANLVPAMQSLHTALIEASLDRRIQISTPHSLGILSNSTPPSTARFRQGYDTHVIK  220

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML FLRETN P MVNPYP+F    D  D ALFRPN G  D      Y NM D
Sbjct  221  PMLSFLRETNSPLMVNPYPFFACTADNLDYALFRPNPGVFDSDLGILYTNMLD  273



>ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=449

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 159/233 (68%), Gaps = 5/233 (2%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            PIF  F+    L  +GV     +G+NYGT+ DNLPPPT+VA F+++ T +++IKIFD NP
Sbjct  9    PIFSSFVF--LLLCNGVSGDYLLGINYGTVADNLPPPTQVAAFIRDHTTLNKIKIFDANP  66

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +I+RAFA TGI VTVTV NG+I  +     A  WV  N+ PFYP T+I+ I VGNEV+  
Sbjct  67   EIIRAFADTGIWVTVTVSNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICVGNEVVAT  126

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
            G   +   LV AMR+++ AL+ +GI +I+VS+PHSLGI+ R++PPS G FR  +D  I A
Sbjct  127  GDKNLIGHLVPAMRAIHEALLAAGINDIQVSTPHSLGILSRSEPPSSGLFRRVYDRVIFA  186

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML+F RET  PFM+ PYP+FG+     D ALF+PN G  D+ +   Y NMFD
Sbjct  187  PMLEFHRETKSPFMICPYPFFGFNDATLDYALFKPNNGVYDKATGMNYTNMFD  239



>ref|XP_009799239.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=386

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 155/235 (66%), Gaps = 8/235 (3%)
 Frame = +3

Query  78   LFFLVSAFLFI------HGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  236
            L  L+ A LF+       GV  +IG+NYGT+ DNLPPP +VARFL E T I R+++FD N
Sbjct  9    LVHLLGALLFVLTPILTQGVEGTIGINYGTVADNLPPPVQVARFLLESTFISRVRLFDAN  68

Query  237  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  416
            P+IL+AFA TGI VTV VPN  I  L    +A QWV  N+ P  PAT I  I VGNEV+ 
Sbjct  69   PEILKAFARTGIAVTVNVPNDLIPHLLKLSFARQWVEYNVLPHVPATNIVRILVGNEVIS  128

Query  417  WGTPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGI  593
                 +   LV AM +L+ A+V+  +   I++S+PHSLGI+  + PPS G+FRPG+D+ I
Sbjct  129  TANKLLIGSLVPAMETLHAAIVERSLDRLIQISTPHSLGILASSSPPSTGKFRPGYDIHI  188

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            L P+L FLR TN PFM+NPYP+FG + +  D ALFRPN G  D  +R TY NM D
Sbjct  189  LKPLLDFLRATNSPFMINPYPFFGSSENTLDYALFRPNPGVFDENTRLTYTNMLD  243



>ref|XP_006846179.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 155/232 (67%), Gaps = 5/232 (2%)
 Frame = +3

Query  78   LFFLVSAFLFIHGV----RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  245
            L  L+S F  I  +     SIGVNYGTL DNLPPP +VA FLK +T IDRIK+F  +P I
Sbjct  10   LTSLISYFCIILSLGLKASSIGVNYGTLADNLPPPAQVATFLKTQTYIDRIKLFGADPAI  69

Query  246  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  425
            L+AFA TGI V ++  N EI+PL  A  AAQWVA ++ PF PATKI  I+VGNEVL    
Sbjct  70   LQAFANTGISVVISAANDEIVPLSKAPAAAQWVADHVLPFVPATKIIAISVGNEVLATSD  129

Query  426  PEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAP  602
              +   L+ AMRSL+ ALV   +   I VSSPHSLGI+  ++PPS G+FR G+D  ++AP
Sbjct  130  KNLIAHLLPAMRSLHTALVNRNLSSSIYVSSPHSLGILRASEPPSSGQFRKGYDHVVIAP  189

Query  603  MLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +L F RET  P  +NPYPYFG+ PD  D ALF+PN G  D  + + Y NMFD
Sbjct  190  ILAFHRETRSPLFINPYPYFGFKPDTLDYALFKPNPGKFDPVTGKNYTNMFD  241



>ref|XP_002315222.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
 gb|EEF01393.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
Length=477

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 151/211 (72%), Gaps = 0/211 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVANFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L DA  A++WVA NI+ FYP T+I +IAVGNE+L  G  E  + LV  ++SL+ ALV
Sbjct  88   IPALVDANAASRWVANNIEQFYPQTRIKLIAVGNEILFTGNKEWISHLVPCIKSLHQALV  147

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            ++GI ++KVS+P++LGI+  +  PS  R +P +   + APML+FLR+T  P +VNPYPYF
Sbjct  148  RAGINDVKVSTPYTLGILQNSVQPSAARIKPAYGKVVFAPMLEFLRQTKSPLLVNPYPYF  207

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
             Y+P   D  LF+PN G  D  +  TY NMF
Sbjct  208  SYSPSMEDYILFKPNPGIHDDNTNITYTNMF  238



>ref|XP_007016412.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY34031.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 154/238 (65%), Gaps = 3/238 (1%)
 Frame = +3

Query  54   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  224
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  225  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGN  404
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVGN
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  405  EVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWD  584
            E+L      +   L+ AM++L +AL  +    IKVS+PHSLGI+  ++PPS G+FR G+D
Sbjct  123  EILATSDKSLIAHLLPAMKALRSALDMANASSIKVSTPHSLGILSTSEPPSTGKFRKGYD  182

Query  585  VGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              I AP+L+F ++T  PFMVNPYPYFG+ P   + ALF+PN G  D  +   Y NMFD
Sbjct  183  KLIFAPILEFHKQTKSPFMVNPYPYFGFKPQTLNYALFKPNAGVFDAVTGINYTNMFD  240



>ref|XP_009796709.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Nicotiana sylvestris]
Length=436

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 163/243 (67%), Gaps = 5/243 (2%)
 Frame = +3

Query  33   ILKIMEMSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVID  212
            + K+  + +  S IF FF   +     G   IGVNYGT+ DNLPPPT+VA F++++T ++
Sbjct  1    MAKLCFIHILCSFIFFFFCNGSL----GGYLIGVNYGTVADNLPPPTQVAAFIRDQTTVN  56

Query  213  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  392
            +IKI D NP+I+RAF+ TG+ VT+TVPNG+I+ +     A  WV  N+ P+YP TKI+ I
Sbjct  57   KIKIVDANPEIIRAFSNTGVWVTITVPNGDILTVSKPAGAQSWVDENVVPYYPHTKIDRI  116

Query  393  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSG-IKEIKVSSPHSLGIMLRADPPSMGRF  569
             VGNEV+      +   LV AM++++ AL++ G I +I+VS+PHSLGIM R++PPS GRF
Sbjct  117  CVGNEVIATSDKNLIAHLVPAMKAIHEALLQVGIISDIQVSTPHSLGIMSRSEPPSSGRF  176

Query  570  RPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGN  749
            R G+D  I AP+L+F  +T  PFM+ PYPYFG+     D ALF+PN G  D  +   Y N
Sbjct  177  RRGYDRVIFAPVLEFYCKTKSPFMICPYPYFGFNDKTLDYALFKPNAGVYDEVTGMNYTN  236

Query  750  MFD  758
            MFD
Sbjct  237  MFD  239



>emb|CDX76097.1| BnaA04g03610D [Brassica napus]
Length=451

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLR--ADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R T  PFM+NP
Sbjct  145  LVRAGVRDVKVTTAHSLNIIAYDLNGAPSSGRFRPGWDKGVLAPILAYHRRTKSPFMINP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+ + Y NM+D
Sbjct  205  YPYFGFDPKNVNFAIFRSPYKAVRDPFTHKIYTNMYD  241



>ref|XP_010106478.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC10654.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=489

 Score =   236 bits (603),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            S+GVNYGT+ DNLPPP++VA FLK +T IDR+KIFD NPDILRAFAGTGI VTVTV NG+
Sbjct  26   SVGVNYGTVADNLPPPSQVATFLKTRTTIDRVKIFDANPDILRAFAGTGIAVTVTVGNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L     A  WVA NI PF+P T IN IAVGNE++      +   L+ AM++L++AL 
Sbjct  86   VPSLAKLPAAQSWVANNILPFHPKTIINSIAVGNEIVATSDKSLIAHLLPAMKALHSALK  145

Query  483  KSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + +  ++VS+PHSLGI+   ++PPS GRFR G+D  + AP+L+F R+T  PFM+NPYP+
Sbjct  146  LANVTNVQVSTPHSLGILAPNSEPPSSGRFRSGYDRVVFAPILEFHRQTKSPFMINPYPF  205

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FG++    + ALF+PN G  D  +   Y NMFD
Sbjct  206  FGFSAKTLNYALFKPNGGVFDNVTGLNYTNMFD  238



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 154/238 (65%), Gaps = 3/238 (1%)
 Frame = +3

Query  54   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  224
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  225  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGN  404
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVGN
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  405  EVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWD  584
            E+L      +   L+ AM++L +AL  +    IKVS+PHSLGI+  ++PPS G+FR G+D
Sbjct  123  EILATSDKSLIAHLLPAMKALRSALDMANASSIKVSTPHSLGILSTSEPPSTGKFRKGYD  182

Query  585  VGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              I AP+L+F ++T  PFMVNPYPYFG+ P   + ALF+PN G  D  +   Y NMFD
Sbjct  183  KLIFAPILEFHKQTKSPFMVNPYPYFGFKPQTLNYALFKPNAGVFDAVTGINYTNMFD  240



>gb|KJB23726.1| hypothetical protein B456_004G111800 [Gossypium raimondii]
Length=380

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 158/241 (66%), Gaps = 4/241 (2%)
 Frame = +3

Query  42   IMEMSLRPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  218
            I  +S R   +  FFL  A   + G   +IGVNYGT+ +NLPPP +VA FL E TVI+R+
Sbjct  6    ISMLSSRLVAVISFFL--ALTLVKGFEGTIGVNYGTVANNLPPPAQVAHFLLESTVINRV  63

Query  219  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  398
            ++FD NP+ILRAFA TG+ VT++VPN +I  L    +A QWV   I+P  PAT I  I V
Sbjct  64   RLFDANPEILRAFAHTGVAVTISVPNDQIPDLTKLNFAQQWVEDYIQPHTPATNIVRILV  123

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRP  575
            GNEV+      +   LV AM +L  ALV + + + I+VS+PHSLGI+  + PPS G+FR 
Sbjct  124  GNEVISTANKLLIVSLVTAMETLQTALVAASLDRRIQVSTPHSLGILSNSSPPSTGKFRQ  183

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            G+D  ++ P+L FLR++N PFMVNPYP+F  +PD  D ALF+PN G  D  ++  Y NM 
Sbjct  184  GYDTHVIKPLLSFLRDSNSPFMVNPYPFFDCSPDTLDYALFQPNAGVFDENTQLFYTNML  243

Query  756  D  758
            D
Sbjct  244  D  244



>ref|XP_008437641.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=499

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 157/233 (67%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            P FL  ++   + I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  40   PTFLLLILPTLIQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  99

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  100  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  159

Query  423  TPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               +   LV AM+SL+ ALV++ + + I++S+PHSLGI+  + PPS GRFR G+D  ++ 
Sbjct  160  NKLLIANLVPAMQSLHTALVEASLDRRIQISTPHSLGILSNSTPPSTGRFRQGYDTHVIK  219

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML FLRETN P MVNPYP+F    +  D ALFRPN G  D      Y NM D
Sbjct  220  PMLSFLRETNSPLMVNPYPFFACTAENLDYALFRPNPGVFDSDLGILYTNMLD  272



>emb|CDY02936.1| BnaC04g25500D [Brassica napus]
Length=452

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPPTEVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R T  PFM+NP
Sbjct  145  LVRAGVRDVKVTTAHSLNIIAYDLNGAPSSGRFRPGWDKGVLAPILAYHRRTKSPFMINP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+     + A+FR P K   D F+ + Y NM+D
Sbjct  205  YPYFGFDLKNVNFAIFRSPYKAVRDPFTHKIYTNMYD  241



>ref|XP_011035318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=504

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 156/247 (63%), Gaps = 4/247 (2%)
 Frame = +3

Query  30   LILKIMEMSLRPSPIFLFFLVSAFLFIHGVRS----IGVNYGTLGDNLPPPTEVARFLKE  197
            ++L  +       P  LF L+  F +     S    +GVNYGT+ +NLP P++VA FLK 
Sbjct  1    MLLHFLSSEKMAKPRTLFLLLFTFYYHFSSSSAAYTVGVNYGTVANNLPSPSQVASFLKT  60

Query  198  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  377
            +T IDR+KIFD NPDILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T
Sbjct  61   QTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQT  120

Query  378  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPS  557
             I  IAVGNEVL      +    + AM++L +AL  + I  I V++PHSLGI+  ++PPS
Sbjct  121  SIKYIAVGNEVLATSDKVLIAHTLPAMKALTSALELANITTIHVATPHSLGILSSSEPPS  180

Query  558  MGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRR  737
             GRFR G+D  I AP L + R+T  PFMVNPYPYFG+  +  + ALF+PN G  D  +  
Sbjct  181  TGRFRKGYDQRIFAPFLDYHRKTKSPFMVNPYPYFGFKAETLNYALFKPNSGVFDAATGN  240

Query  738  TYGNMFD  758
             Y NMFD
Sbjct  241  NYTNMFD  247



>ref|XP_011654592.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Cucumis 
sativus]
 gb|KGN49838.1| hypothetical protein Csa_5G139170 [Cucumis sativus]
Length=493

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  160

Query  423  TPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               +   LV AM+SL+ AL+++ + + I++S+PHSLGI+  + PPS  RFR G+D  ++ 
Sbjct  161  NKLLIANLVPAMQSLHTALIEASLDRRIQISTPHSLGILSNSTPPSTARFRQGYDTHVIK  220

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PML FLRETN P MVNPYP+F    D  D ALFRPN G  D      Y NM D
Sbjct  221  PMLSFLRETNSPLMVNPYPFFACTADNLDYALFRPNPGVFDSDLGILYTNMLD  273



>ref|XP_007205054.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
 gb|EMJ06253.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
Length=516

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPD+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANPDMLRAFADTKIAVTVTVGNGD  91

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L     A  WV+ANI PF+P T IN IAVGNE+L     ++   L+ AM+SL+ AL 
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNEILATSDKDLIAHLLPAMKSLHEALQ  151

Query  483  KSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + I  ++V +PHSLGI+     PPS GRFR G+D  +  PML+F R+T  PF++NPYP+
Sbjct  152  LANISTVQVGTPHSLGILAPNTGPPSQGRFRTGYDRVVFTPMLEFHRQTKSPFLINPYPF  211

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FG+ P+  + ALF+PN G  D  +   Y NMFD
Sbjct  212  FGFVPETLNYALFKPNAGVFDNATGMNYTNMFD  244



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 149/212 (70%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYGT+ +NLPPP++VA FLK +T I+ IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  24   TVGVNYGTVANNLPPPSQVAAFLKSQTTINSIKIFDANPDILRAFANTGISVTVTVGNGD  83

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  W+++NI PFYP T I  IAVGNE+L      +    + AM++L +AL 
Sbjct  84   IPSLSKLDAAKSWISSNILPFYPQTLIKYIAVGNEILATADKNLIAHTLPAMKALKSALE  143

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I  +KVS+PHSLGI+  ++PPS GRFR G+D  I AP+L++ R+T  PFMVNPYPYF
Sbjct  144  IANITAVKVSTPHSLGILSSSEPPSTGRFRKGYDKRIFAPILEYHRQTKSPFMVNPYPYF  203

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+  +  + ALF+PN G  D  + + Y NMFD
Sbjct  204  GFRSETLNYALFKPNGGVFDSATGKNYTNMFD  235



>ref|XP_009139167.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=451

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 156/217 (72%), Gaps = 4/217 (2%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAG GI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGPGISVVVTVPN  84

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  477  LVKSGIKEIKVSSPHSLGIMLRA--DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            LV++G++++KV++ HSL I+       PS GRFRPGWD G+LAP+L + R T  PFM+NP
Sbjct  145  LVRAGVRDVKVTTAHSLNIIAYDLNGAPSSGRFRPGWDKGVLAPILAYHRRTKSPFMINP  204

Query  651  YPYFGYAPDKADLALFR-PNKGYVDRFSRRTYGNMFD  758
            YPYFG+ P   + A+FR P K   D F+ + Y NM+D
Sbjct  205  YPYFGFDPKNVNFAIFRSPYKAVRDPFTHKIYTNMYD  241



>ref|XP_010318035.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=378

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 150/221 (68%), Gaps = 2/221 (1%)
 Frame = +3

Query  102  LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  278
            +F+ GV  +IGVNYGT+ DNLPPP +VA FL+E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADNLPPPVQVASFLRESTFIRRVRLFDANPEILKAFANTGISV  82

Query  279  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  458
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VGNEV+      +   LV AM
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNEVISTANKLLIVSLVPAM  142

Query  459  RSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGP  635
             +L+  LV+  + + I++S+PH LGI+  + PPS G+FRPG+D+ +L P+L FLR TN P
Sbjct  143  ETLHAVLVEKSLDRHIQISTPHFLGILSNSSPPSTGKFRPGYDIHVLKPLLDFLRATNSP  202

Query  636  FMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FMVNPYP+F  + +  D ALFRPN G  D  ++ TY NM D
Sbjct  203  FMVNPYPFFDSSDNTLDYALFRPNSGVFDETTQLTYTNMLD  243



>ref|XP_011025078.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=491

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 165/249 (66%), Gaps = 4/249 (2%)
 Frame = +3

Query  15   RNKSNLILKIMEMSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLK  194
            R KS  +L     S+  +   +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL 
Sbjct  29   RKKSISVLASFSSSIVST---ILLLASAFNILGVEGSIGVNYGTVADNLPPPAQVAHFLL  85

Query  195  EKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPA  374
            E T+I+R+++FD N +I++AFA TGI +TVTVPN +I  L   G+A +WV +N++P+ PA
Sbjct  86   ESTIINRVRLFDTNTEIIQAFAHTGIAITVTVPNDQIPHLTKLGFAQEWVRSNVQPYVPA  145

Query  375  TKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADP  551
            T I  I VGNEV+          LV AM++L+ ALV + +   IK+S+PHSLGI+  + P
Sbjct  146  TNIVRILVGNEVISNENKLFVASLVPAMKALHTALVGASLDHRIKISTPHSLGILSGSSP  205

Query  552  PSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFS  731
            PS G+F  G+   IL P+L+FLR TN PFM+NPYP+FG++ D  D ALF+PN G +D  +
Sbjct  206  PSTGKFLQGYATRILKPLLRFLRATNSPFMINPYPFFGFSADTLDYALFKPNSGVLDENT  265

Query  732  RRTYGNMFD  758
            + +Y NM D
Sbjct  266  KLSYTNMLD  274



>ref|XP_009353665.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 150/226 (66%), Gaps = 1/226 (0%)
 Frame = +3

Query  84   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLR  620
            L+ AM+SL++AL  + I  I+V +P+SLGI+     PPS GRFR G+D  + APML F R
Sbjct  135  LLPAMKSLHSALELANISSIQVGTPNSLGILAPNTGPPSEGRFRTGYDRVVFAPMLDFHR  194

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +T  PF++NPYP+FG  P+  + ALF+PN G  D  +   Y NMFD
Sbjct  195  QTKSPFLINPYPFFGSVPETLNYALFKPNGGVFDNATGMNYTNMFD  240



>ref|XP_009345986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 150/226 (66%), Gaps = 1/226 (0%)
 Frame = +3

Query  84   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLR  620
            L+ AM+SL++AL  + I  I+V +P+SLGI+     PPS GRFR G+D  + APML F R
Sbjct  135  LLPAMKSLHSALELANISSIQVGTPNSLGILAPNTGPPSEGRFRTGYDRVVFAPMLDFHR  194

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +T  PF++NPYP+FG  P+  + ALF+PN G  D  +   Y NMFD
Sbjct  195  QTKSPFLINPYPFFGSVPETLNYALFKPNGGVFDNATGMNYTNMFD  240



>ref|XP_009345982.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 150/226 (66%), Gaps = 1/226 (0%)
 Frame = +3

Query  84   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  444  LVAAMRSLYNALVKSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLR  620
            L+ AM+SL++AL  + I  I+V +P+SLGI+     PPS GRFR G+D  + APML F R
Sbjct  135  LLPAMKSLHSALELANISSIQVGTPNSLGILAPNTGPPSEGRFRTGYDRVVFAPMLDFHR  194

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +T  PF++NPYP+FG  P+  + ALF+PN G  D  +   Y NMFD
Sbjct  195  QTKSPFLINPYPFFGSVPETLNYALFKPNGGVFDNATGMNYTNMFD  240



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD NP IL++FA TGI VTVT+PN +
Sbjct  11   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRIRLFDANPQILQSFANTGIAVTVTIPNNQ  70

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +  ++ QW++ +I P +P+T I  I VGNEV+  G   +   L+ AM+SL+ ALV
Sbjct  71   IPLLTNLTFSQQWISHHINPHFPSTNIIRILVGNEVISTGNHLLIRSLIPAMQSLHTALV  130

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+  + PPS  +F+ G+D  +L P+L FLR TN PF+VNPYP+
Sbjct  131  SASLHRRIQISTPHSLGILTDSTPPSSAKFKRGYDTHVLKPLLSFLRSTNSPFVVNPYPF  190

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+ +  D ALFRPN G  D+ S+  Y NMFD
Sbjct  191  FGYSIETLDFALFRPNHGLYDQQSKILYTNMFD  223



>ref|XP_007220925.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
 gb|EMJ22124.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
Length=470

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 159/228 (70%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +GNEVL        
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNEVLSTTNKLFI  135

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             GLV AM++L+ ALV + + ++IKVS+PHSLGI+  + PPS G+FR G+DV +L P+L F
Sbjct  136  AGLVPAMQTLHAALVDASLDRKIKVSTPHSLGILSSSSPPSSGKFRQGYDVHVLKPLLSF  195

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            L+ TN PFMVNPYPYFG++ D  D ALFRPN G  D  ++  Y NM D
Sbjct  196  LKATNSPFMVNPYPYFGFSADTLDYALFRPNSGVFDDKTKLLYTNMLD  243



>ref|XP_010048931.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW89128.1| hypothetical protein EUGRSUZ_A01445 [Eucalyptus grandis]
Length=476

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 155/229 (68%), Gaps = 2/229 (1%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            +F L+ +  F+ G R+ IGVNYGT+ DNLPPP +VA FL E T IDRI++FD +PDIL+A
Sbjct  21   VFLLLCSSFFMEGARAGIGVNYGTVADNLPPPAQVAHFLLESTTIDRIRLFDADPDILKA  80

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI +TVTVPN  I  L     A  WV  N++P+ PAT I  I VGNEVL      +
Sbjct  81   FANTGIAITVTVPNDLIPQLAKLSNAQDWVRTNVEPYVPATDIVRILVGNEVLATANRLL  140

Query  435  QNGLVAAMRSLYNALVKSGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
               LV +MR L+ AL  + +   IKVS+PHSLGI+  + PPS G+FR G+DV IL P+L 
Sbjct  141  LGNLVMSMRMLHAALANASLDGRIKVSTPHSLGILSSSSPPSSGKFRQGYDVHILRPLLN  200

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FLRET  PF+VNPYP+FG++ D  D ALFRPN G +D  S+  Y NM D
Sbjct  201  FLRETGSPFLVNPYPFFGFSKDTLDYALFRPNAGVMDENSKLVYTNMLD  249



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 157/234 (67%), Gaps = 7/234 (3%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVR------SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  239
            L  ++SA L +  V       ++GVNYGT+ DNLPPP EVA FL E T+I+R+++FD NP
Sbjct  5    LVHVISALLLVASVNIQGIEGTVGVNYGTVADNLPPPAEVAHFLLENTIINRVRLFDANP  64

Query  240  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  419
            +IL AFA TGI +T+TVPN EI  L +  +A QWV ANI P +PAT I  I VGNEV+  
Sbjct  65   EILEAFAHTGIAITLTVPNNEIPQLTNLSFAQQWVTANITPHFPATNIVRILVGNEVISS  124

Query  420  GTPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGIL  596
             +  +   LV AM++L+ ALV   +   IKVS+PHSLGI+  + PPS G FR G+D  +L
Sbjct  125  ASKLLITSLVPAMQTLHTALVAESLDHRIKVSTPHSLGILSSSSPPSSGEFRQGYDTHVL  184

Query  597  APMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             P+L FLR T+ PF+VNPYP+FG + +  D ALFRPN G  D  ++ TY NM D
Sbjct  185  KPLLSFLRATDSPFLVNPYPFFGCSAETLDYALFRPNSGAFDDDTKFTYTNMLD  238



>ref|XP_008234701.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Prunus mume]
Length=468

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 159/228 (70%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +GNEVL        
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNEVLSTTNKLFI  135

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             GLV AM++L+ ALV + + ++IKVS+PHSLGI+  + PPS G+FR G+DV +L P+L F
Sbjct  136  AGLVPAMQTLHAALVDASLDRKIKVSTPHSLGILSSSSPPSSGKFRQGYDVHVLKPLLSF  195

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            L+ TN PFMVNPYPYFG++ D  D ALFRPN G  D  ++  Y NM D
Sbjct  196  LKATNSPFMVNPYPYFGFSADTLDYALFRPNSGVFDDKTKLLYTNMLD  243



>ref|XP_002298356.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE83161.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=457

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 145/212 (68%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYGT+ +NLP P++VA FLK +T IDR+KIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   TVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGD  85

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  W+AANI PF+P T I  IAVGNEVL      +    + AM++L +AL 
Sbjct  86   IPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNEVLATSDKVLIAHTLPAMKALTSALE  145

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + I  I V++PHSLGI+  ++PPS GRFR G+D  I AP L + R+T  PFMVNPYPYF
Sbjct  146  LANITTIHVATPHSLGILSSSEPPSTGRFRKGYDQRIFAPFLDYHRKTKSPFMVNPYPYF  205

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+  +  + ALF+PN G  D  +   Y NMFD
Sbjct  206  GFKAETLNYALFKPNSGVFDAATGNNYTNMFD  237



>ref|XP_010519454.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Tarenaya 
hassleriana]
Length=486

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 153/220 (70%), Gaps = 2/220 (1%)
 Frame = +3

Query  105  FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  281
            F+ GV  SIGVNYGTL +NL PP +VA FL   TVI+R+++FD +P ILR+F+GTGI  +
Sbjct  29   FVSGVEASIGVNYGTLANNLQPPRQVAEFLLRSTVINRVRLFDTDPQILRSFSGTGIATS  88

Query  282  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  461
            VTVPN  I  L +  +A QW++ +I+PF+P+T I  I VGNEVL  G   +   LV AM+
Sbjct  89   VTVPNDLIPNLTNLSFAQQWLSLSIQPFFPSTNIVRILVGNEVLSTGNRLLIGNLVPAMQ  148

Query  462  SLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPF  638
            SL+ AL    + + I++S+PHSLGI+  + PPS G+FR G+D  +L P+L FL+ T+ PF
Sbjct  149  SLHTALASVSLHRRIQISTPHSLGILSNSSPPSSGKFRQGYDTHVLKPLLSFLKATDSPF  208

Query  639  MVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            MVNPYP+FG + D  DLALFRPN G  D  S+  Y NM D
Sbjct  209  MVNPYPFFGCSSDTLDLALFRPNPGLFDEDSKLLYTNMLD  248



>emb|CDX87130.1| BnaC09g04450D [Brassica napus]
Length=465

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TG+ VTVTV N +
Sbjct  33   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFDADPQILQAFAHTGVAVTVTVSNDQ  92

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+  G   +   LV AM+SL+ ALV
Sbjct  93   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTGNHLLIRNLVPAMQSLHTALV  152

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+    PPS  RFR G+D  +L P+L FLR    PF+VNPYP+
Sbjct  153  SASLHRRIQISTPHSLGILSHTTPPSSARFRQGYDTHVLKPLLSFLRTIASPFVVNPYPF  212

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+P+  D ALFRPN G  D+ ++  Y NMFD
Sbjct  213  FGYSPETLDFALFRPNPGLFDQDTKLHYTNMFD  245



>ref|XP_008223598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=517

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 147/213 (69%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD N D+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANADMLRAFADTKIAVTVTVGNGD  91

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L     A  WV+ANI PF+P T IN IAVGNE+L     ++   L+ +M+SL+ AL 
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNEILATSDKDLIAHLLPSMKSLHEALQ  151

Query  483  KSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + I  ++V +PHSLGI+     PPS GRFR G+D  +  PML+F R+T  PF++NPYP+
Sbjct  152  LANISTVQVGTPHSLGILAPNTGPPSQGRFRTGYDRVVFTPMLEFHRQTKSPFLINPYPF  211

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FG+ P+  + ALF+PN G  D  +   Y NMFD
Sbjct  212  FGFVPETLNYALFKPNAGVFDNATGMNYTNMFD  244



>ref|XP_006441150.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
 gb|ESR54390.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
Length=460

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 163/242 (67%), Gaps = 4/242 (2%)
 Frame = +3

Query  45   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  215
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  216  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  395
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIL  120

Query  396  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFR  572
            VGNE+L   +  +   LV AM++L+ ALV + + + I+VS+PHSLGI+  + PPS G+F 
Sbjct  121  VGNEILSTASKLLIASLVPAMQTLHTALVGASLDRRIQVSTPHSLGILSSSSPPSSGKFH  180

Query  573  PGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNM  752
             G+D+ +L P+L FLR T  PF++NPYP+FG +P+  D ALFRPN G  D  ++  Y NM
Sbjct  181  QGYDIHVLKPLLSFLRATKSPFLINPYPFFGCSPETLDYALFRPNSGVFDENTKIVYTNM  240

Query  753  FD  758
             D
Sbjct  241  LD  242



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 161/243 (66%), Gaps = 5/243 (2%)
 Frame = +3

Query  45   MEMSLRP---SPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVID  212
            ME ++R    S +    L+ A   + GV+ +IGVNYGT+ +NLPPP EVA FL E+T I+
Sbjct  1    MERTIRHAANSAVSGLLLLIAATLVGGVQGTIGVNYGTIANNLPPPAEVAHFLLEETTIN  60

Query  213  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  392
            R+++FD NP IL+AFA TGI VT+TVPN +I  L    +A  WV +N+ P+ P+T I  I
Sbjct  61   RVRLFDANPAILQAFAHTGIAVTITVPNQQIPDLTKLSFAQHWVKSNVLPYTPSTNIIRI  120

Query  393  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRF  569
             VGNEVL      +   LV AM++L+ ALV   + + I+VS+PHSLGI+  + PPS G+F
Sbjct  121  LVGNEVLSTANKLLIASLVPAMQNLHTALVGVSLDRRIQVSTPHSLGILSTSSPPSTGKF  180

Query  570  RPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGN  749
            R G+D  +L P+L FL+ TN PFM+NPYP+FG +    D ALFRPN G +D  +R  Y N
Sbjct  181  RRGYDTVVLKPLLSFLKATNSPFMINPYPFFGCSEGTLDYALFRPNSGVLDDNTRLVYTN  240

Query  750  MFD  758
            M D
Sbjct  241  MLD  243



>ref|XP_003588492.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES58743.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=363

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 152/226 (67%), Gaps = 4/226 (2%)
 Frame = +3

Query  84   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  263
            FL+ +F  + G   IGVNYGT+ +NLPPP++VA+FL   T+I++++IFD N +IL+AF  
Sbjct  5    FLLQSFTEVQG---IGVNYGTIANNLPPPSQVAKFLLHSTIINKVRIFDANQEILQAFEN  61

Query  264  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  443
            T I +T+T+PN +I  + +   A QWV  N++PF P+  I  I VGNEVL          
Sbjct  62   TRIEITITIPNDQIPNITNLTLAQQWVKTNVQPFIPSINIIRILVGNEVLSTANKLFITN  121

Query  444  LVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLR  620
            LV AM++L+ AL+ + +   IKVS+PHSLGI+  + PPS GRFR G+D+ I+ PML+FL+
Sbjct  122  LVPAMQTLHTALITTSLDNLIKVSTPHSLGILSNSSPPSSGRFREGYDIHIIKPMLRFLK  181

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +TN PFMVNPYP+F       D ALFR N G +D  ++  Y NMFD
Sbjct  182  DTNSPFMVNPYPFFACTSSNLDYALFRANSGVLDDNTKLHYTNMFD  227



>ref|XP_011015294.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=496

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 151/237 (64%), Gaps = 4/237 (2%)
 Frame = +3

Query  60   RPSPIFLFFLVSAFLFIH----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  227
            +P  +FL      + F         ++GVNYGT+ +NLP P++VA FLK +T IDR+KIF
Sbjct  3    KPRTLFLLLFTFYYHFSSSSSSAAYTVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIF  62

Query  228  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNE  407
            D N DILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T I  IAVGNE
Sbjct  63   DTNQDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNE  122

Query  408  VLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDV  587
            VL      +    + AM++L +AL  + I  I V++PHSLGI+  ++PPS GRFR G+D 
Sbjct  123  VLATSDKVLIAHTLPAMKALTSALELANITTIHVATPHSLGILSSSEPPSTGRFRKGYDQ  182

Query  588  GILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             I AP L + R+T  PFMVNPYPYFG+  +  + ALF+PN G  D  +   Y NMFD
Sbjct  183  RIFAPFLDYHRKTKSPFMVNPYPYFGFKAETLNYALFKPNSGVFDAATGNNYTNMFD  239



>ref|XP_006350517.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=382

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 151/221 (68%), Gaps = 2/221 (1%)
 Frame = +3

Query  102  LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  278
            +F+ GV  +IGVNYGT+ D+LPPP +VA FL++ T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADDLPPPVQVASFLRDSTFIRRVRLFDANPEILKAFARTGISV  82

Query  279  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  458
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VGNEV+      +   LV AM
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNEVISTANKLLIVSLVPAM  142

Query  459  RSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGP  635
             +L  ALV+  + + I++S+PH LGI+  + PPS G+FRPG+D+ +L P+L+FLR TN P
Sbjct  143  ETLQAALVEKSLDRHIRISTPHFLGILSNSSPPSTGKFRPGYDIHVLKPLLEFLRATNSP  202

Query  636  FMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FM+NPYP+F  + +  D ALFRPN G  D  ++ TY NM D
Sbjct  203  FMINPYPFFDSSDNTLDYALFRPNPGVFDETTQLTYTNMLD  243



>ref|XP_007013798.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY31417.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
Length=459

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 158/231 (68%), Gaps = 6/231 (3%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G+EVL     + 
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSEVLFSNITDW  160

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             N LV AMRSL+ ALVK+GI++IKV++ H+L I  R   PS+ RF  G+D+   AP+L+F
Sbjct  161  INNLVPAMRSLHYALVKAGIQDIKVTTSHALNIFRRETLPSLTRFMVGYDLSFFAPILQF  220

Query  615  LRETNGPFMVNPYPYFGYAPD---KADLALFRPNKGYVDRFSRRTYGNMFD  758
             R T  PFMVNPYPYF  +PD   + + ALF+PN+G  D+++ +TY NMFD
Sbjct  221  HRRTKSPFMVNPYPYF--SPDLSRRLNYALFKPNRGVYDKYTGKTYTNMFD  269



>ref|XP_010519453.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Tarenaya 
hassleriana]
Length=532

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 165/250 (66%), Gaps = 6/250 (2%)
 Frame = +3

Query  27   NLILKIMEMSLRPSPIFLFFLVSAFL---FI-HGVR-SIGVNYGTLGDNLPPPTEVARFL  191
            +  +K + +    S  F F+++  F    FI  GV  SIGVNYGTL +NL PP +VA FL
Sbjct  45   SCFIKTLGLYCYLSNSFTFYVIYDFCNFPFIGTGVEASIGVNYGTLANNLQPPRQVAEFL  104

Query  192  KEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYP  371
               TVI+R+++FD +P ILR+F+GTGI  +VTVPN  I  L +  +A QW++ +I+PF+P
Sbjct  105  LRSTVINRVRLFDTDPQILRSFSGTGIATSVTVPNDLIPNLTNLSFAQQWLSLSIQPFFP  164

Query  372  ATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRAD  548
            +T I  I VGNEVL  G   +   LV AM+SL+ AL    + + I++S+PHSLGI+  + 
Sbjct  165  STNIVRILVGNEVLSTGNRLLIGNLVPAMQSLHTALASVSLHRRIQISTPHSLGILSNSS  224

Query  549  PPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRF  728
            PPS G+FR G+D  +L P+L FL+ T+ PFMVNPYP+FG + D  DLALFRPN G  D  
Sbjct  225  PPSSGKFRQGYDTHVLKPLLSFLKATDSPFMVNPYPFFGCSSDTLDLALFRPNPGLFDED  284

Query  729  SRRTYGNMFD  758
            S+  Y NM D
Sbjct  285  SKLLYTNMLD  294



>emb|CBI16129.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
             V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV 
Sbjct  20   AVYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVV  79

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            N +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ 
Sbjct  80   NLDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHA  139

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            AL  +GI +IKV++PH   IM  + PPS G+F   ++  +L PML+F RETN PFMVNPY
Sbjct  140  ALQAAGINDIKVTTPHPFSIMASSSPPSSGKFAMEFEQSLLIPMLQFHRETNSPFMVNPY  199

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYF Y+ D  +  LF  N+G  D+ +  TY NMFD
Sbjct  200  PYFAYSGDLRNFLLFGENEGAHDQATGLTYTNMFD  234



>ref|XP_003561280.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brachypodium 
distachyon]
Length=475

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 155/230 (67%), Gaps = 2/230 (1%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            I++F  + A  F     +IGVNYGT GDNL PP+ VA FL  +T IDR+K+FD NPD+LR
Sbjct  18   IYVFLAIVAQPFTT-TTAIGVNYGTKGDNLAPPSTVAAFLANRTRIDRVKLFDTNPDMLR  76

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFAGTGI V VT  NG+I  L     AA WVA+N+ PFYPAT+I+++AVGNE++    P 
Sbjct  77   AFAGTGISVMVTAANGDIPILATTQGAAAWVASNVAPFYPATEISLVAVGNEIMDTHDPS  136

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            + + LV AMR+L  AL  +  + I+VS+P+SLGI++ + PPS  RFR GWDV +  PML+
Sbjct  137  LIDSLVPAMRTLKAALAAAAFRRIRVSTPNSLGILVDSSPPSAARFRDGWDVAVFTPMLQ  196

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNK-GYVDRFSRRTYGNMFD  758
            FL+ +  P +VN YPYFGY  D    AL RPN  G  D  +  TY +MF+
Sbjct  197  FLQRSKSPLVVNAYPYFGYNGDTLPYALARPNNPGVADAGTGITYTSMFE  246



>ref|XP_007013797.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31416.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
Length=483

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 158/231 (68%), Gaps = 6/231 (3%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G+EVL     + 
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSEVLFSNITDW  160

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             N LV AMRSL+ ALVK+GI++IKV++ H+L I  R   PS+ RF  G+D+   AP+L+F
Sbjct  161  INNLVPAMRSLHYALVKAGIQDIKVTTSHALNIFRRETLPSLTRFMVGYDLSFFAPILQF  220

Query  615  LRETNGPFMVNPYPYFGYAPD---KADLALFRPNKGYVDRFSRRTYGNMFD  758
             R T  PFMVNPYPYF  +PD   + + ALF+PN+G  D+++ +TY NMFD
Sbjct  221  HRRTKSPFMVNPYPYF--SPDLSRRLNYALFKPNRGVYDKYTGKTYTNMFD  269



>ref|NP_001119271.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93291.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=452

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 149/213 (70%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A QW++ +I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLIPAMQSLHTALV  148

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLG +  + PPS  +FR G+D  +L P+L FLR T+ PF+VNPYP+
Sbjct  149  SASLHRRIQISTPHSLGTLTNSTPPSSAKFRRGYDAQVLKPLLSFLRSTSSPFVVNPYPF  208

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+ +  D ALFRPN G  D+ ++  Y NM D
Sbjct  209  FGYSIETLDFALFRPNPGLFDQHTKLLYTNMLD  241



>ref|NP_001151227.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
 gb|ACG42046.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
Length=498

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 147/212 (69%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI V VT  NG+
Sbjct  29   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIAVMVTAGNGD  88

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVAAN+ P+YP+T I++++VGNE++      + + LV AMR+L  ALV
Sbjct  89   IPKLATKDGAGAWVAANVAPYYPSTDISLVSVGNEIMDTADKALISNLVPAMRALKAALV  148

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             +G  +I+VS+PHSLGI+  ++PPS  RFR G+D  + APML F R++  PFMVNPYPYF
Sbjct  149  AAGYPKIRVSTPHSLGILSVSEPPSASRFRDGFDRAVFAPMLAFHRQSRSPFMVNPYPYF  208

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            GY       AL RPN G  D  +  TY +MF+
Sbjct  209  GYNGVTLPYALARPNPGVPDPGTGITYTSMFE  240



>ref|XP_004295910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 153/223 (69%), Gaps = 2/223 (1%)
 Frame = +3

Query  93   SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGI  272
            SAF  I    +IGVNYGT+ +NLPPP++VA FLK KT IDR+KIF+ +P +LRAFA TGI
Sbjct  14   SAFHVIL-TSAIGVNYGTVANNLPPPSQVATFLKTKTTIDRVKIFNTDPAVLRAFANTGI  72

Query  273  LVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVA  452
             VTVTV NG + PL     A  WVA NI PFYP T IN IAVGNE+L     ++   L+ 
Sbjct  73   AVTVTVGNGNVPPLAKLPAAQSWVADNILPFYPRTNINRIAVGNEILATSDKDLIAHLLP  132

Query  453  AMRSLYNALVKSGIKEIKVSSPHSLGIML-RADPPSMGRFRPGWDVGILAPMLKFLRETN  629
            AM++L++AL  + +  I+VS+PHSLGI+     PPS+G+FR G+D  I  P+L++ R+T 
Sbjct  133  AMKALHSALNLANVTSIQVSTPHSLGILAPNTGPPSLGQFRSGYDKVIFQPILEYHRQTK  192

Query  630  GPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             PF+VNPYP+FG +PD  + A FRPN G  D  +   Y NMFD
Sbjct  193  SPFLVNPYPFFGLSPDTLNYATFRPNAGVFDPATGVNYTNMFD  235



>gb|ERM95173.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
Length=468

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 156/232 (67%), Gaps = 2/232 (1%)
 Frame = +3

Query  66   SPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  245
            S + L F V+  +    + +IGVNYGT+ +NLPPPT+VA+FLKE T+I+ +K+F ++  I
Sbjct  14   SSLLLLFSVNCIMDTEAI-NIGVNYGTVANNLPPPTQVAKFLKENTLINHVKLFGIDHAI  72

Query  246  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  425
            ++AFA TGI +TV +PN +I  L+    A QW+  NI P+   TKI  I VGNEVLH   
Sbjct  73   IQAFANTGIALTVAIPNDQIPSLRRLAIARQWIQINILPYVYTTKIIRILVGNEVLHTND  132

Query  426  PEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAP  602
              +   L+ AM++L+  L+ + +  +IKVS+PHSLGI+  + PPS GRFR G+   +L P
Sbjct  133  ILLAANLIPAMQNLHAVLIGASLDHQIKVSTPHSLGILSISTPPSAGRFRRGYTTLVLKP  192

Query  603  MLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +L FLR TN PFM+NPYPYFG+ P+  D ALFRPNKG  D  +  TY NM D
Sbjct  193  LLSFLRATNAPFMINPYPYFGFTPNTLDFALFRPNKGVFDVNTHLTYTNMLD  244



>ref|XP_002874188.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50447.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=443

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 147/213 (69%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI +TVTVPN +
Sbjct  15   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPHILQAFANTGIAITVTVPNDQ  74

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A QW++  I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  75   IPHLTNLSSAKQWISDQIQPHFPSTNIIRILVGNEVISTANHLLIRTLIPAMQSLHTALV  134

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+    PPS  +FR G+D  +L P+L FLR T+ PF+VNPYP+
Sbjct  135  STSLHRRIQISTPHSLGILTNTTPPSSAKFRRGYDTNVLKPLLSFLRSTSSPFVVNPYPF  194

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+ +  D ALFRPN G  D+  +  Y NM D
Sbjct  195  FGYSIETLDFALFRPNPGLFDQHPKLLYTNMLD  227



>ref|XP_006827757.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Amborella trichopoda]
Length=461

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 156/232 (67%), Gaps = 2/232 (1%)
 Frame = +3

Query  66   SPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  245
            S + L F V+  +    + +IGVNYGT+ +NLPPPT+VA+FLKE T+I+ +K+F ++  I
Sbjct  12   SSLLLLFSVNCIMDTEAI-NIGVNYGTVANNLPPPTQVAKFLKENTLINHVKLFGIDHAI  70

Query  246  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  425
            ++AFA TGI +TV +PN +I  L+    A QW+  NI P+   TKI  I VGNEVLH   
Sbjct  71   IQAFANTGIALTVAIPNDQIPSLRRLAIARQWIQINILPYVYTTKIIRILVGNEVLHTND  130

Query  426  PEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAP  602
              +   L+ AM++L+  L+ + +  +IKVS+PHSLGI+  + PPS GRFR G+   +L P
Sbjct  131  ILLAANLIPAMQNLHAVLIGASLDHQIKVSTPHSLGILSISTPPSAGRFRRGYTTLVLKP  190

Query  603  MLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +L FLR TN PFM+NPYPYFG+ P+  D ALFRPNKG  D  +  TY NM D
Sbjct  191  LLSFLRATNAPFMINPYPYFGFTPNTLDFALFRPNKGVFDVNTHLTYTNMLD  242



>ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93290.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=458

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 149/213 (70%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A QW++ +I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLIPAMQSLHTALV  148

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLG +  + PPS  +FR G+D  +L P+L FLR T+ PF+VNPYP+
Sbjct  149  SASLHRRIQISTPHSLGTLTNSTPPSSAKFRRGYDAQVLKPLLSFLRSTSSPFVVNPYPF  208

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+ +  D ALFRPN G  D+ ++  Y NM D
Sbjct  209  FGYSIETLDFALFRPNPGLFDQHTKLLYTNMLD  241



>gb|KJB19861.1| hypothetical protein B456_003G121900 [Gossypium raimondii]
Length=367

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 148/219 (68%), Gaps = 2/219 (1%)
 Frame = +3

Query  81   FFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            FFL S FL   GV  +IGVNYGT+  NLPPP +VA FL E T+I R+++FD + +IL+AF
Sbjct  16   FFLASKFLLFPGVEGTIGVNYGTVASNLPPPAQVAHFLVESTIISRVRLFDADSNILKAF  75

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI ++VTVPN EI  L    +A QWV  NI+P+ P T I  I VGNEVL      + 
Sbjct  76   AHTGIAISVTVPNDEIPRLTKLNFAQQWVENNIQPYTPNTNIVRILVGNEVLSTANKLLI  135

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
              +V AM++L++AL ++ + + I+VS+PHSLGI+  + PPS   FR G+D  +L P+L F
Sbjct  136  GSVVPAMQNLHSALFEASLDRRIQVSTPHSLGIISNSSPPSTAMFRQGYDTYVLKPLLSF  195

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFS  731
            LR TN PFMVNPYP+FG + D  D ALFRPN G    FS
Sbjct  196  LRATNSPFMVNPYPFFGCSLDTLDFALFRPNAGLDSVFS  234



>ref|XP_006491986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
 gb|KDO59627.1| hypothetical protein CISIN_1g043079mg [Citrus sinensis]
Length=460

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 162/242 (67%), Gaps = 4/242 (2%)
 Frame = +3

Query  45   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  215
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  216  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  395
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIF  120

Query  396  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFR  572
            VGNE+L   +  +   LV AM++L+ ALV   + + I+VS+PHSLGI+  + PPS G+F 
Sbjct  121  VGNEILSTASKLLIASLVPAMQTLHTALVGVSLDRRIQVSTPHSLGILSSSSPPSSGKFH  180

Query  573  PGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNM  752
             G+D+ +L P+L FLR T  PF++NPYP+FG +P+  D ALFRPN G  D  ++  Y NM
Sbjct  181  QGYDIHVLKPLLSFLRATKSPFLINPYPFFGCSPETLDYALFRPNSGVFDENTKIVYTNM  240

Query  753  FD  758
             D
Sbjct  241  LD  242



>ref|XP_007157802.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
 gb|ESW29796.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
Length=507

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 147/222 (66%), Gaps = 3/222 (1%)
 Frame = +3

Query  102  LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  281
            L+      IGVNYGT+ DNLPPP+ VA F+K +T IDR+K+FD NPD+LRAFAGTGI +T
Sbjct  24   LYASYTTKIGVNYGTVADNLPPPSTVAAFIKSQTTIDRVKLFDANPDMLRAFAGTGISIT  83

Query  282  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  461
            VTVPN  I  L     A  W++ NI PF P T +  IAVGNEVL      +   ++  M+
Sbjct  84   VTVPNAAIPSLSTLPAAQAWLSENILPFLPQTAVTRIAVGNEVLATSDKTLIAHILPTMK  143

Query  462  SLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFM  641
            SL++AL  + +  ++VS+PHSLGI+  ++PPS   FR G+D  I AP+L+F R T  PFM
Sbjct  144  SLHDALSLANLTAVQVSTPHSLGILASSEPPSAASFRRGYDKAIFAPILEFHRRTKSPFM  203

Query  642  VNPYPYFGYAPDKAD---LALFRPNKGYVDRFSRRTYGNMFD  758
            VNPYP+FG+ P +A+    ALF+PN G  D  +   Y NMFD
Sbjct  204  VNPYPFFGFDPSRAESLNYALFKPNGGVWDAATSVNYTNMFD  245



>ref|XP_011044676.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044677.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044678.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
Length=398

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 157/227 (69%), Gaps = 2/227 (1%)
 Frame = +3

Query  84   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  441  GLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFL  617
             LV AM++L+ ALV + +   IK+SSPHSLGI+  + PPS G+FR G+D  +L P+L FL
Sbjct  151  SLVPAMQTLHTALVGASLDSRIKISSPHSLGILSSSSPPSGGKFRQGYDTHVLKPLLSFL  210

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            R TN PFM+NPYP+FG +P+  D ALFRP  G  D  ++ +Y NM D
Sbjct  211  RATNSPFMINPYPFFGSSPETLDYALFRPGSGVFDENTKLSYTNMLD  257



>ref|XP_011044679.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Populus 
euphratica]
Length=393

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 157/227 (69%), Gaps = 2/227 (1%)
 Frame = +3

Query  84   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  441  GLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFL  617
             LV AM++L+ ALV + +   IK+SSPHSLGI+  + PPS G+FR G+D  +L P+L FL
Sbjct  151  SLVPAMQTLHTALVGASLDSRIKISSPHSLGILSSSSPPSGGKFRQGYDTHVLKPLLSFL  210

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            R TN PFM+NPYP+FG +P+  D ALFRP  G  D  ++ +Y NM D
Sbjct  211  RATNSPFMINPYPFFGSSPETLDYALFRPGSGVFDENTKLSYTNMLD  257



>ref|XP_007137073.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
 gb|ESW09067.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
Length=380

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 148/218 (68%), Gaps = 2/218 (1%)
 Frame = +3

Query  111  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  290
                 IGVNYGT+  NLPPP++VA+FL + T I+R++IFD NP+IL AFA TGI VT+TV
Sbjct  27   EATAKIGVNYGTVASNLPPPSKVAKFLSKSTTINRVRIFDANPEILHAFANTGIEVTITV  86

Query  291  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            PN +I  + +  +A QWV  N++PF PATK+  I VGNEVL      + + LV AM++L+
Sbjct  87   PNDQIPQITNLTFAQQWVKTNVQPFLPATKLIRILVGNEVLSTANKLLISNLVPAMQTLH  146

Query  471  NALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             ALV + +   +KVS+PHSLG++  + PPS  +FR G+D  ++ PML FL+ +N PFMVN
Sbjct  147  VALVTASLDNNVKVSTPHSLGVLSNSSPPSTAKFRQGYDTHVIKPMLSFLKASNAPFMVN  206

Query  648  PYPYFGYAPDKADLALFRPNKGYV-DRFSRRTYGNMFD  758
            PYP+FG +    D ALFR + G V D  ++  Y NM D
Sbjct  207  PYPFFGTSVSNLDYALFRSDSGVVFDDNTKLRYTNMLD  244



>ref|XP_002281025.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Vitis vinifera]
Length=444

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
             V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV 
Sbjct  20   AVYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVV  79

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            N +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ 
Sbjct  80   NLDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHA  139

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            AL  +GI +IKV++PH   IM  + PPS G+F   ++  +L PML+F RETN PFMVNPY
Sbjct  140  ALQAAGINDIKVTTPHPFSIMASSSPPSSGKFAMEFEQSLLIPMLQFHRETNSPFMVNPY  199

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYF Y+ D  +  LF  N+G  D+ +  TY NMFD
Sbjct  200  PYFAYSGDLRNFLLFGENEGAHDQATGLTYTNMFD  234



>ref|XP_010109237.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC21417.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=478

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 151/228 (66%), Gaps = 1/228 (0%)
 Frame = +3

Query  78   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  257
            L  LV +     G  +IGVNYGT+ DNLPPP+EVA FL E T I+R+++FD +PDILRAF
Sbjct  20   LSLLVISTFLQGGHGAIGVNYGTVADNLPPPSEVAHFLVESTTINRVRLFDADPDILRAF  79

Query  258  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            A TGI VTVTVPN +I  L     A +W+  N++P  PAT I  I VGNEVL      + 
Sbjct  80   AHTGITVTVTVPNDQIPRLTKLPAAHEWLKTNVQPHVPATNIVRILVGNEVLSTANKLLI  139

Query  438  NGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
              LV A+++L  +LV  G+ + IK+++PHSLGI+  + PPS G+FR G+D  +L P+L F
Sbjct  140  ASLVPALQALQASLVDLGLDRRIKLTTPHSLGILSSSTPPSTGKFRQGYDTHVLKPLLGF  199

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            LR TN PFMVNPYP+FG + +  D ALFRPN G  D  +   Y NM D
Sbjct  200  LRATNSPFMVNPYPFFGSSAETLDYALFRPNPGVFDDNTELKYTNMLD  247



>gb|ABK24695.1| unknown [Picea sitchensis]
Length=485

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 150/224 (67%), Gaps = 2/224 (1%)
 Frame = +3

Query  87   LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  266
            LV          +IGVNYG +GDNLPPP+EVA+FL + T ID++K+FD +P +L+AFA T
Sbjct  14   LVLVLCIFFTAEAIGVNYGRMGDNLPPPSEVAKFL-QTTNIDKVKLFDADPSVLQAFADT  72

Query  267  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  446
             I V V V N EI  L     A  WV  N+ P+ PAT I  I+VGNE+L  G   + + L
Sbjct  73   NITVVVAVANDEIPALNKLPAAQDWVKKNVAPYVPATNIIAISVGNEILSTGNKVLISQL  132

Query  447  VAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRE  623
            + AM++L+ ALV + + K+IKVS+PHSLGI+  ++PPS+GRFR G+D  IL P+L FLR 
Sbjct  133  IPAMQNLHTALVGASLDKQIKVSTPHSLGILAASEPPSIGRFRRGYDRVILKPLLNFLRT  192

Query  624  TNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
            T  PFM+NPYPYFGY     D ALF+PN G  D+ +  TY NMF
Sbjct  193  TGAPFMINPYPYFGYTDKTLDYALFKPNAGVFDKNTGITYANMF  236



>emb|CAN72975.1| hypothetical protein VITISV_019488 [Vitis vinifera]
Length=443

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  293
             V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV 
Sbjct  20   AVYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVV  79

Query  294  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
            N +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ 
Sbjct  80   NLDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHA  139

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPY  653
            AL  +GI +IKV++PH   IM  + PPS G+F   ++  +L PML+F RETN PFMVNPY
Sbjct  140  ALQAAGINDIKVTTPHPFSIMASSSPPSSGKFAMEFEQSLLIPMLQFHRETNSPFMVNPY  199

Query  654  PYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYF Y+ D  +  LF  N+G  D+ +  TY NMFD
Sbjct  200  PYFAYSGDLRNFLLFGENEGAHDQATGLTYTNMFD  234



>ref|XP_010421258.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 161/248 (65%), Gaps = 4/248 (2%)
 Frame = +3

Query  27   NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  197
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGAEASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  198  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  377
             TVI+R+++FD +P IL+AFA TGI VTVTVPN ++  L +   A +W++  I+P YP+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQVPHLTNLTSAQKWISDQIQPHYPST  121

Query  378  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPP  554
             I  I VGNEV+      +   LV AM+SL+ ALV + + + I++S+PHSLGI+  + PP
Sbjct  122  NIIRILVGNEVISTANHLLIRTLVPAMQSLHTALVSASLHRRIQISTPHSLGILSGSTPP  181

Query  555  SMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSR  734
            S  +FR G++  +L P+L FLR T+ PF+VNPYP+FGY+ +  D AL RPN G +DR ++
Sbjct  182  SSAKFRRGYNTQVLKPLLSFLRATSSPFVVNPYPFFGYSIETLDFALARPNPGLIDRHTK  241

Query  735  RTYGNMFD  758
              Y NM D
Sbjct  242  LLYTNMLD  249



>gb|KHN16491.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=360

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 5/220 (2%)
 Frame = +3

Query  111  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  290
            HG+  IGVNYGT+ +NLPPP  VA+FL + T I ++++FD NP+ILRAF  TGI VT+TV
Sbjct  28   HGI-GIGVNYGTVANNLPPPAMVAKFLSKSTTIKKVRLFDANPEILRAFGNTGIEVTITV  86

Query  291  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            PN +I  + +  YA QWV  N++PF PATK+  I VGNEVL      + + LV AM++L+
Sbjct  87   PNDQIPDITNLTYAQQWVKTNVQPFIPATKLIRILVGNEVLSTANKLLVSTLVPAMQTLH  146

Query  471  NALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             ALV + + + IK+S+PHSLGI+  + PPS  +FR G+D  ++ PML FL++ N PFMVN
Sbjct  147  VALVAASLDDNIKISTPHSLGILSNSSPPSAAKFRQGYDTHVIKPMLNFLKDANAPFMVN  206

Query  648  PYPYFGYAPDKA-DLALFRPNKG--YVDRFSRRTYGNMFD  758
            PYP+FG       D ALFR N G   VD  ++  Y NM D
Sbjct  207  PYPFFGCTSSSTLDYALFRSNSGVFVVDDNTKLRYTNMLD  246



>ref|XP_009586622.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=385

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 146/221 (66%), Gaps = 2/221 (1%)
 Frame = +3

Query  102  LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  278
            + I GV  +IG++YGT+ D+LPPP +VARFL E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   ILIQGVEGTIGIDYGTVADDLPPPVQVARFLLESTFIRRVRLFDANPEILKAFAHTGIAV  82

Query  279  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  458
            TV  PN  I  L    +A QWV  N+ P  PAT I  I VGNEV+      +   LV A 
Sbjct  83   TVNFPNDLIPHLTKLSFARQWVEINVLPHIPATNIVRILVGNEVISTANKLLIGNLVPAT  142

Query  459  RSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGP  635
             +L+ ALV+  + + I++S+PHSLGI+  + PPS G+FR G+D  +L P+L FLR T  P
Sbjct  143  ETLHAALVERSLDRHIQISTPHSLGILASSSPPSTGKFRQGYDTHVLKPLLSFLRATKSP  202

Query  636  FMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FM+NPYP+FG + +  D ALFRPN G  D  +R TY NM D
Sbjct  203  FMINPYPFFGSSENTLDYALFRPNPGVFDENTRLTYMNMLD  243



>dbj|BAK07810.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 151/229 (66%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            I +F  V+ F        IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPD++R
Sbjct  18   ICIFLAVAPF-----STPIGVNYGTKGDNLPSPAKVAAFLVTRTNIDRVKLFDTNPDVVR  72

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVGNE++      
Sbjct  73   AFAGTGISVMVTAGNGDIPGLATQNGADAWVATNIAPYYPATDISLVAVGNEIMDTADKN  132

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            + + LV+AM++L  ALV +G  +I+VS+P SLGI++ + PPS  RFR  WDV I  PML+
Sbjct  133  LISNLVSAMQTLKAALVTAGYGKIRVSTPSSLGILVDSQPPSAARFRDVWDVAIFTPMLQ  192

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FL++T  P +VN YPYFGY  D    AL RPN G +D  +  TY +M +
Sbjct  193  FLQKTKSPLIVNTYPYFGYNGDTLPYALARPNPGVLDAGTGITYTSMLE  241



>ref|XP_004959111.1| PREDICTED: uncharacterized protein LOC101782084 [Setaria italica]
Length=1022

 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 156/227 (69%), Gaps = 3/227 (1%)
 Frame = +3

Query  87   LVSAFLFIHG--VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
            ++SAFL +      +IGVNYGT GDNLPPP +VA FL  +T IDR+K+FD N D++RAFA
Sbjct  14   VLSAFLLVIAPYAAAIGVNYGTKGDNLPPPAKVASFLANRTRIDRVKLFDTNADMVRAFA  73

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
            GTGI +TVT  NG+I  L     AA WV+AN+ P+YPAT I+++AVGNE++      + N
Sbjct  74   GTGIALTVTAANGDIPKLATKDGAAAWVSANVAPYYPATDISLVAVGNEIMATADKTLIN  133

Query  441  GLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLR  620
             LV AMR+L  ALV +G  +I+VS+PHSLG++  ++PPS  RFR G+D  + APML+F R
Sbjct  134  SLVPAMRALKAALVAAGFPKIRVSTPHSLGVLSVSEPPSASRFRDGFDRAVFAPMLEFHR  193

Query  621  ETNGPFMVNPYPYFGYAPDKADLALFRPNK-GYVDRFSRRTYGNMFD  758
            +T  PFMVNPYPYFGY       AL RP   G  D  +  TY +MF+
Sbjct  194  QTGSPFMVNPYPYFGYNGGTLAYALARPGAVGVADPGTGITYTSMFE  240



>ref|XP_011046747.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
 ref|XP_011046748.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
Length=398

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 156/227 (69%), Gaps = 2/227 (1%)
 Frame = +3

Query  84   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  441  GLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFL  617
             LV AM++L+ ALV + +   IK+SSPHSLGI+  + PPS G+FR G+D  +L P+L FL
Sbjct  151  SLVPAMQTLHTALVGASLDSRIKISSPHSLGILSSSSPPSGGKFRQGYDTHVLKPLLSFL  210

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            R TN PFM+NPYP+FG +P+  D ALFRP  G  D  ++ +Y NM D
Sbjct  211  RATNSPFMINPYPFFGSSPETLDYALFRPGSGVFDENTKLSYTNMLD  257



>ref|XP_011046750.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Populus 
euphratica]
Length=393

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 156/227 (69%), Gaps = 2/227 (1%)
 Frame = +3

Query  84   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  441  GLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFL  617
             LV AM++L+ ALV + +   IK+SSPHSLGI+  + PPS G+FR G+D  +L P+L FL
Sbjct  151  SLVPAMQTLHTALVGASLDSRIKISSPHSLGILSSSSPPSGGKFRQGYDTHVLKPLLSFL  210

Query  618  RETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            R TN PFM+NPYP+FG +P+  D ALFRP  G  D  ++ +Y NM D
Sbjct  211  RATNSPFMINPYPFFGSSPETLDYALFRPGSGVFDENTKLSYTNMLD  257



>ref|XP_010421259.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 149/213 (70%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+R+++FD +P IL+AFA TGI VTVTVPN +
Sbjct  19   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRVRLFDADPQILQAFANTGIAVTVTVPNDQ  78

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            +  L +   A +W++  I+P YP+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  79   VPHLTNLTSAQKWISDQIQPHYPSTNIIRILVGNEVISTANHLLIRTLVPAMQSLHTALV  138

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+  + PPS  +FR G++  +L P+L FLR T+ PF+VNPYP+
Sbjct  139  SASLHRRIQISTPHSLGILSGSTPPSSAKFRRGYNTQVLKPLLSFLRATSSPFVVNPYPF  198

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+ +  D AL RPN G +DR ++  Y NM D
Sbjct  199  FGYSIETLDFALARPNPGLIDRHTKLLYTNMLD  231



>ref|XP_006287713.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
 gb|EOA20611.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
Length=459

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   T+I+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  9    SIGVNYGTLANNLPPPQQVAEFLLRSTLINRIRLFDADPLILKAFANTGITVTVTVPNDQ  68

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +   A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  69   IPHLTNLTSAQKWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLVPAMQSLHTALV  128

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+  + PPS  +FR G++  +L P+L FLR T+ PF+VNPYP+
Sbjct  129  SASLHRRIQISTPHSLGILSDSTPPSSAKFRRGYNTQVLKPLLSFLRTTSSPFVVNPYPF  188

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+P+  D ALFRPN G  D  ++  Y NM D
Sbjct  189  FGYSPETLDFALFRPNPGLFDHHTKLLYTNMLD  221



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 152/231 (66%), Gaps = 6/231 (3%)
 Frame = +3

Query  78   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            +F L+   L       SIGVNYG   DNLPPP+ VA FL+ +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTSIGVNYGMTADNLPPPSVVANFLRTQTIFDSVKLFDANPDVLRA  63

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI V+VTV NG+I  L +   A +WVA +I PF+P TKI  I VG EVL     + 
Sbjct  64   FANTGISVSVTVGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTEVLFSKNDDW  123

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             N LV AMRSL+ AL K+G ++IKV+S H+L I  R   PS+ RF  G+D    AP+L+F
Sbjct  124  INNLVPAMRSLHYALNKAGFQDIKVTSAHALNIFRRDTIPSLMRFMVGYDQSFFAPLLQF  183

Query  615  LRETNGPFMVNPYPYFGYAPD---KADLALFRPNKGYVDRFSRRTYGNMFD  758
             + T  PFMVNPYPYF  +PD   + + ALF+PN G  D++S++ Y NMFD
Sbjct  184  HQRTKSPFMVNPYPYF--SPDITRRLNYALFKPNSGIYDKYSKKNYTNMFD  232



>ref|XP_004505325.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Cicer 
arietinum]
Length=492

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L     A  W+  NI P++P T  N IAVGNE++      +   L+ AM +L  A
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNEIIATSDKNLIAHLLPAMEALQKA  140

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L  S +  I+VS+PHSLGI+  ++PPS G FR G+DV I AP+L F R T  PFMVNPYP
Sbjct  141  LTLSNLTHIQVSTPHSLGILSSSEPPSAGAFRRGYDVTIFAPILDFHRRTKSPFMVNPYP  200

Query  657  YFGYAPDKADL---ALFRPNKGYVDRFSRRTYGNMFD  758
            +FG+ P + +    ALF+PN G  D+ +   Y NMFD
Sbjct  201  FFGFDPTRPETLNYALFKPNGGVFDKMTGLNYTNMFD  237



>ref|XP_004505326.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Cicer 
arietinum]
Length=495

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +3

Query  117  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  296
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  297  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  476
            G+I  L     A  W+  NI P++P T  N IAVGNE++      +   L+ AM +L  A
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNEIIATSDKNLIAHLLPAMEALQKA  140

Query  477  LVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYP  656
            L  S +  I+VS+PHSLGI+  ++PPS G FR G+DV I AP+L F R T  PFMVNPYP
Sbjct  141  LTLSNLTHIQVSTPHSLGILSSSEPPSAGAFRRGYDVTIFAPILDFHRRTKSPFMVNPYP  200

Query  657  YFGYAPDKADL---ALFRPNKGYVDRFSRRTYGNMFD  758
            +FG+ P + +    ALF+PN G  D+ +   Y NMFD
Sbjct  201  FFGFDPTRPETLNYALFKPNGGVFDKMTGLNYTNMFD  237



>emb|CBI31680.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVGNE++      +
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNEIMATADKNL  130

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
               LV AM++L+NALV + I +IKVS+PHSLGI+  ++PPS+GRFR G+D  I APML+F
Sbjct  131  IGHLVPAMKALHNALVLAKITDIKVSTPHSLGILSMSEPPSVGRFRRGYDKVIFAPMLEF  190

Query  615  LRETNGPFMVN  647
             R+T  PFM++
Sbjct  191  HRQTKSPFMMD  201



>ref|XP_011075984.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Sesamum indicum]
Length=396

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 150/220 (68%), Gaps = 2/220 (1%)
 Frame = +3

Query  105  FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  281
            F+ GV+ SIGVNYGT  DNLPPP++VARFL + TVI R+++FD + + LRAFAGTGI +T
Sbjct  32   FLFGVKGSIGVNYGTEADNLPPPSKVARFLLDSTVIRRVRVFDADREKLRAFAGTGIAIT  91

Query  282  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  461
            +T+PN +I  L +  +A +WV   + P   AT I  I VGNEVL      + + LV AM 
Sbjct  92   ITIPNDQIPHLTNLTFAQEWVKDILLPHTRATNIVRILVGNEVLSTANKLLISNLVPAML  151

Query  462  SLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPF  638
            +L++AL    + ++IK+S+PHSLGI+  + PPSMG+FR G+D  IL P+L FL+ TN PF
Sbjct  152  TLHDALTSESLDRDIKISTPHSLGILSNSSPPSMGKFRQGYDAYILKPLLNFLKATNSPF  211

Query  639  MVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            ++NPYP+F    D  D ALFRP  G VD  +  TY N+ D
Sbjct  212  LINPYPFFASLDDNLDYALFRPTLGVVDENTNLTYTNLLD  251



>emb|CDY19838.1| BnaA09g04910D [Brassica napus]
Length=467

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  35   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  94

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  95   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTANHLLIRNLVPAMQSLHTALV  154

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+    PPS  RFR G+D  +L P+L FLR    PF+VNPYP+
Sbjct  155  SASLHRRIQISTPHSLGILSHTTPPSSARFRQGYDTHVLKPLLSFLRTIASPFVVNPYPF  214

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+P+  D ALFR N G  D+ ++  Y NMFD
Sbjct  215  FGYSPETLDFALFRTNPGLFDQDTKLHYTNMFD  247



>ref|XP_009111627.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=470

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  38   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  97

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  98   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTANHLLIRNLVPAMQSLHTALV  157

Query  483  KSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + + + I++S+PHSLGI+    PPS  RFR G+D  +L P+L FLR    PF+VNPYP+
Sbjct  158  SASLHRRIQISTPHSLGILSHTTPPSSARFRQGYDTHVLKPLLSFLRTIASPFVVNPYPF  217

Query  660  FGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FGY+P+  D ALFR N G  D+ ++  Y NMFD
Sbjct  218  FGYSPETLDFALFRTNPGLFDQDTKLHYTNMFD  250



>ref|XP_010493578.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Camelina sativa]
Length=457

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 159/248 (64%), Gaps = 4/248 (2%)
 Frame = +3

Query  27   NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  197
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGADASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  198  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  377
             TVI+R+++FD +P IL+AFA TGI VTVTVPN +I  L +   A +W++  I+P +P+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQIPHLTNLTSAQKWISDQIQPHFPST  121

Query  378  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPP  554
             I  I VGNEV+      +   LV AM+SL+ ALV   + + I++S+PHSLGI+  + PP
Sbjct  122  NIIRILVGNEVISTANHLLIRTLVPAMQSLHTALVSVSLHRRIQISTPHSLGILSGSTPP  181

Query  555  SMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSR  734
            S  +FR G++  +  P+L FLR T+ PF+VNPYP+FGY+ +  D AL RPN G +DR ++
Sbjct  182  SSAKFRRGYNTQVFKPLLSFLRATSSPFVVNPYPFFGYSTETLDFALARPNPGLIDRHTK  241

Query  735  RTYGNMFD  758
              Y NM D
Sbjct  242  LLYTNMLD  249



>gb|EMT11580.1| Glucan endo-1,3-beta-glucosidase [Aegilops tauschii]
Length=552

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 150/229 (66%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            +   FLV A L      +IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPDI+R
Sbjct  16   VMCIFLVIAPLST----AIGVNYGTKGDNLPSPAKVA-FLVTRTNIDRVKLFDTNPDIVR  70

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVGNE++      
Sbjct  71   AFAGTGISVMVTAGNGDIPGLATQTGADSWVATNIAPYYPATDISLVAVGNEIMDTADKN  130

Query  432  MQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
            +   LV AM++L  ALV +G  +I+VS+P SLGI++ A PPS  RFR  WDV I  PML+
Sbjct  131  LIGNLVPAMQTLKAALVTAGYGKIRVSTPSSLGILVDAQPPSAARFRDVWDVAIFTPMLQ  190

Query  612  FLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            FLR+T  P +VN YPYFGY  D    AL RPN G +D  +  TY +M +
Sbjct  191  FLRKTKSPLIVNTYPYFGYNGDTLPYALARPNPGVLDTGTGITYTSMLE  239



>ref|XP_010535497.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=372

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 143/212 (67%), Gaps = 1/212 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            +GVNYGT+ DNLPPP +VA FLK KT I+ +KIFD +P+ILRAFAGTGI VTVTV N +I
Sbjct  29   VGVNYGTVADNLPPPQQVAGFLKTKTNINHVKIFDADPNILRAFAGTGISVTVTVANSDI  88

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L     AA+W++ ++ PF P+  +  IAVGNEVL      +   L+ AM SL +AL  
Sbjct  89   PSLCKLSAAARWLSDHVLPFLPSVSLRYIAVGNEVLATSDKNLVAHLLPAMESLTSALEF  148

Query  486  SGIKEIKVSSPHSLGIMLRA-DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + +  + VS+PHSLGI+  A +PPS GRFR G+D  I AP+L F   T  PFMVNPYPYF
Sbjct  149  ANVTGVSVSTPHSLGILSGASEPPSSGRFRRGYDRAIFAPILDFHNRTKSPFMVNPYPYF  208

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P+  + ALF PN G  D  ++  Y NMFD
Sbjct  209  GFRPETLNYALFEPNAGVFDPVTKMHYTNMFD  240



>ref|XP_004309121.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 160/235 (68%), Gaps = 3/235 (1%)
 Frame = +3

Query  60   RPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  236
            R S I L FL S F  + GV+ SIGVNYGT+ ++LPPP++VA FL + T+I+R+++FD N
Sbjct  57   RGSTIVLLFLASIF-NVQGVQGSIGVNYGTVANDLPPPSQVAHFLLQSTIINRVRLFDTN  115

Query  237  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  416
            P IL+AFA +GI +T+TVPN +I       +A  W+  N+ P+ PAT I  I +GNEVL 
Sbjct  116  PQILQAFAHSGIPLTITVPNDQIPHFTKLRFAQNWLNTNVIPYTPATNIVRILLGNEVLS  175

Query  417  WGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGI  593
                     LV AM++L+ ALV + + ++IKVS+PHSLGI+  + PPS G+FR G+D  +
Sbjct  176  TTNKLFIGNLVPAMQTLHMALVDASLDRQIKVSTPHSLGILSSSSPPSSGKFRQGYDTHV  235

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            L P+L FLR T  PFMVNPYPYFGY+ D  D ALFRPN G VD  ++  Y NM D
Sbjct  236  LKPLLTFLRVTKAPFMVNPYPYFGYSGDTLDYALFRPNAGVVDPNTKLLYTNMLD  290



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 150/231 (65%), Gaps = 6/231 (3%)
 Frame = +3

Query  78   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            +F L+   L        IGVNYG   DNLPPP+ VA FLK +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTGIGVNYGMTADNLPPPSVVANFLKTQTIFDSVKLFDANPDVLRA  63

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA TGI V+VT+ NG+I  L +   A +WVA +I PF+P TKI  I VG EVL       
Sbjct  64   FANTGISVSVTIGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTEVLFSKNDVW  123

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             N LV AMRSL+ AL K+G ++IKV+S H+L I  R   PS+ RF  G+D    AP+L+F
Sbjct  124  INNLVPAMRSLHYALNKAGFQDIKVTSAHALNIFRRDTIPSLMRFMVGYDQSFFAPLLQF  183

Query  615  LRETNGPFMVNPYPYFGYAPD---KADLALFRPNKGYVDRFSRRTYGNMFD  758
             + T  PFMVNPYPYF  +PD   + + ALF+PN G  D+++++ Y NMFD
Sbjct  184  HQRTKSPFMVNPYPYF--SPDITRRLNYALFKPNSGIYDKYTKKNYTNMFD  232



>gb|KDO72847.1| hypothetical protein CISIN_1g0375832mg, partial [Citrus sinensis]
Length=458

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 142/212 (67%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL 
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSALD  150

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + +  ++VS+PHSLGI+  ++PPS GRFR G+D  I A +L+F R+T  PFMVNPYPYF
Sbjct  151  AANLSSVQVSTPHSLGILSTSEPPSTGRFRKGYDRLIFARILEFHRQTKSPFMVNPYPYF  210

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P   + ALF+PN G  D  + + Y NMFD
Sbjct  211  GFKPQTLNYALFKPNAGVFDPATGKNYTNMFD  242



>ref|XP_006488330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Citrus 
sinensis]
Length=502

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 142/212 (67%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL 
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSALD  150

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + +  ++VS+PHSLGI+  ++PPS GRFR G+D  I A +L+F R+T  PFMVNPYPYF
Sbjct  151  AANLSSVQVSTPHSLGILSTSEPPSTGRFRKGYDRLIFARILEFHRQTKSPFMVNPYPYF  210

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P   + ALF+PN G  D  + + Y NMFD
Sbjct  211  GFKPQTLNYALFKPNAGVFDPATGKNYTNMFD  242



>ref|XP_006424832.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
 ref|XP_006488329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Citrus 
sinensis]
 gb|ESR38072.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
Length=504

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 142/212 (67%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL 
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSALD  150

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
             + +  ++VS+PHSLGI+  ++PPS GRFR G+D  I A +L+F R+T  PFMVNPYPYF
Sbjct  151  AANLSSVQVSTPHSLGILSTSEPPSTGRFRKGYDRLIFARILEFHRQTKSPFMVNPYPYF  210

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P   + ALF+PN G  D  + + Y NMFD
Sbjct  211  GFKPQTLNYALFKPNAGVFDPATGKNYTNMFD  242



>ref|XP_010043552.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=462

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 159/241 (66%), Gaps = 6/241 (2%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+GNE+
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL  + +  ++V++P+SLGI+  + PPS G+FR G+D  
Sbjct  123  LATSDKTLIASLLPAMKALHSALQFANVTNVQVTTPNSLGILASSYPPSTGQFRSGFDRT  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPD----KADLALFRP-NKGYVDRFSRRTYGNMF  755
            I AP+L+F R+TN  FMVNPYP+FG + +      + ALF+P      D  + + Y NMF
Sbjct  183  IFAPILEFHRQTNSSFMVNPYPFFGISAETLNYTLNYALFKPIPYSTFDNATGKNYTNMF  242

Query  756  D  758
            D
Sbjct  243  D  243



>gb|KCW85567.1| hypothetical protein EUGRSUZ_B02364 [Eucalyptus grandis]
Length=489

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 159/241 (66%), Gaps = 6/241 (2%)
 Frame = +3

Query  54   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  230
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  231  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+GNE+
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNEI  122

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVG  590
            L      +   L+ AM++L++AL  + +  ++V++P+SLGI+  + PPS G+FR G+D  
Sbjct  123  LATSDKTLIASLLPAMKALHSALQFANVTNVQVTTPNSLGILASSYPPSTGQFRSGFDRT  182

Query  591  ILAPMLKFLRETNGPFMVNPYPYFGYAPD----KADLALFRP-NKGYVDRFSRRTYGNMF  755
            I AP+L+F R+TN  FMVNPYP+FG + +      + ALF+P      D  + + Y NMF
Sbjct  183  IFAPILEFHRQTNSSFMVNPYPFFGISAETLNYTLNYALFKPIPYSTFDNATGKNYTNMF  242

Query  756  D  758
            D
Sbjct  243  D  243



>ref|XP_010940752.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=462

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 147/230 (64%), Gaps = 2/230 (1%)
 Frame = +3

Query  72   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  251
            +++ F VS    + G   IGVNYG L  NLPPP +VA+FL   TVIDR+K+FD +P  L+
Sbjct  17   LWILFTVSISEAVGG-SGIGVNYGRLASNLPPPAQVAQFLARNTVIDRVKLFDTDPSTLQ  75

Query  252  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  431
            AF  TG+ + VT+    I  L +  +A  W+ ANI P+  AT +  I VGNEVL      
Sbjct  76   AFDSTGVAIDVTISTDLISNLTNLSFAKYWIQANILPYIAATNVTRILVGNEVLSTAGKS  135

Query  432  MQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
            + +GLV AM++L+ ALV   +  +IKVSSPHSL I+  +DPPS+GRF  G+D  I+ P+L
Sbjct  136  LISGLVPAMQNLHTALVGVSLHHKIKVSSPHSLAILSASDPPSLGRFPDGYDTAIMKPLL  195

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
             FLR TN PFMVN YP+FG+  D  D ALFR N G VD  +  TY NM D
Sbjct  196  NFLRATNSPFMVNAYPFFGFTHDTLDYALFRLNSGVVDDNTGLTYTNMLD  245



>ref|XP_002321390.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
 gb|EEF05517.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
Length=355

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 150/217 (69%), Gaps = 1/217 (0%)
 Frame = +3

Query  111  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  290
            + + +IGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA TGI VTVTV
Sbjct  3    NALATIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFAHTGIAVTVTV  62

Query  291  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
             N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +   LV AM++L+
Sbjct  63   TNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIASLVPAMQALH  122

Query  471  NALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             ALV + +   IK+S+PHSLGI+  + PPS G+FR G+D  +L P+L FLR TN PFM+N
Sbjct  123  AALVDASLDSRIKISTPHSLGILSSSSPPSGGKFRQGYDTHVLKPVLSFLRATNSPFMIN  182

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYP+FG +P+  D ALFR + G  D  ++ +Y NM D
Sbjct  183  PYPFFGSSPETLDYALFRTSSGVFDENTKLSYTNMLD  219



>gb|KJB73920.1| hypothetical protein B456_011G261000 [Gossypium raimondii]
Length=366

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 148/239 (62%), Gaps = 4/239 (2%)
 Frame = +3

Query  54   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  233
            SL    +FLF   + F       +IGVNYG + DNLP PTEVA F+K KT+ D +KIFD 
Sbjct  3    SLTSLQLFLFLSTTVFNLFSSTAAIGVNYGMVADNLPSPTEVANFIKTKTIFDSVKIFDT  62

Query  234  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  413
            NP++LRAF  TGI +TVT+PNGEI  L + G A+ WV ANI+PF+P T+I  I++GNEV+
Sbjct  63   NPNVLRAFTNTGITMTVTIPNGEIPNLANEGAASAWVNANIQPFHPQTRIKYISIGNEVV  122

Query  414  HWGTPEMQNGLVAAMRSLYNALVKSG--IKEIKVSSPHSLGIMLRADPPSMGRFRPGWDV  587
                P   +GLV AM++L  AL K+G   ++IKV+S H+L +      PS+ RFR     
Sbjct  123  LLDNPVHIHGLVPAMKALTEALRKAGPQFQDIKVTSAHALNLFQGLPVPSLARFRIDLTE  182

Query  588  GILAPMLKFLRETNGPFMVNPYPYF--GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
                P+L+F ++   PFM+NPYPYF      D  D A+FR   G  D  S++TY N  D
Sbjct  183  TFFKPLLQFHQQNKSPFMINPYPYFELNVMSDNIDYAVFRKTPGVFDPTSKKTYSNALD  241



>ref|XP_007009341.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOY18151.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=440

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 147/228 (64%), Gaps = 3/228 (1%)
 Frame = +3

Query  84   FLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
             L++ FL  +    ++GVNYG + DNLP P EVA F+K KT+ D +KIFD NPD+LRAFA
Sbjct  4    LLLATFLHLVTSATALGVNYGMIADNLPSPYEVANFIKTKTIFDSVKIFDTNPDVLRAFA  63

Query  261  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  440
             T I VTVTV NG+I  L +   A +WV  +I+PFYP TKI  I+VGNE+L +   +  N
Sbjct  64   NTDISVTVTVANGQIPSLTNVRAARRWVNNHIRPFYPQTKIKYISVGNEILLFNVQDQIN  123

Query  441  GLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLR  620
             LV AM+SL+ AL K+GI+ IKV++ H+L I      PS+ RFR  +     AP+L FLR
Sbjct  124  NLVPAMKSLHLALAKAGIRGIKVTTAHALNIFNGDSVPSLARFRQDYAKSFFAPLLLFLR  183

Query  621  ETNGPFMVNPYPYFGYAP--DKADLALFRPNKGYVDRFSRRTYGNMFD  758
             T  PFM+NPYPYF      +K D ALF+ N G  D+ S +TY N  D
Sbjct  184  RTKSPFMINPYPYFELNAMGNKLDYALFKRNPGLFDKHSGKTYTNALD  231



>ref|XP_008778544.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=455

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 151/235 (64%), Gaps = 3/235 (1%)
 Frame = +3

Query  63   PSPIFLFFLVSAFLFIHGV--RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  236
            P+ I   +++S    +  V    IGVNYG LG+NLPPP +VA+FL   TVIDR+K+FD +
Sbjct  12   PAAIRTLWILSTVSILEAVGGSGIGVNYGKLGNNLPPPAQVAQFLARNTVIDRVKLFDTD  71

Query  237  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  416
            P  L+AF  T + + VT+ N  I  L +  +A  W+ ANI P+  AT I  I VGNEV+ 
Sbjct  72   PATLQAFDNTDLAIDVTISNDLIPNLTNLSFAKYWIQANILPYIAATNITRILVGNEVVS  131

Query  417  WGTPEMQNGLVAAMRSLYNALVKSGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGI  593
                 +   LV AM++L+ ALV + ++ +IKVSSPHSLGI+  + PPS+GRF+ G+D  +
Sbjct  132  AADKSLIASLVPAMQNLHTALVGASLQHKIKVSSPHSLGILAASVPPSVGRFQDGYDTAV  191

Query  594  LAPMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            + P+L FLR T+ PFMVNPYP+FG   D  D ALFR N G VD  +  TY NM D
Sbjct  192  MKPLLTFLRATDSPFMVNPYPFFGSTRDTLDYALFRLNSGVVDDNTGLTYTNMLD  246



>ref|XP_010671896.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Beta vulgaris subsp. 
vulgaris]
Length=359

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 146/221 (66%), Gaps = 4/221 (2%)
 Frame = +3

Query  108  IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  284
            + G+ S IGVNYG   DNLPPP EVA+FL + T+I+ I++FD NPD L+AFA TGI +TV
Sbjct  5    VKGIESNIGVNYGMQADNLPPPNEVAKFLLDSTIINHIRLFDANPDTLQAFAHTGIAITV  64

Query  285  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  464
            T+PN  I    +  +A +W+  NI     +T I  I VGNEVL      +   LV  M++
Sbjct  65   TIPNDLIPQFTNFTFAQEWIKTNISSHVHSTNIKRILVGNEVLATTNKLLITNLVPTMQT  124

Query  465  LYNALVKSGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFM  641
            LY+ALV+  ++ ++++S+PHSLGI+  ++PPS GRFRPG+D  IL P+L FLR+   PF+
Sbjct  125  LYSALVEESLEHKVQISTPHSLGILSSSNPPSTGRFRPGYDDHILRPLLSFLRDIGSPFL  184

Query  642  VNPYPYFGYAPDKADL--ALFRPNKGYVDRFSRRTYGNMFD  758
            VNPYP+F    +  +L  ALFR N G  D ++   Y NMFD
Sbjct  185  VNPYPFFNIGSNDTNLNYALFRSNSGVFDEYTGMNYTNMFD  225



>ref|XP_002459582.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
 gb|EER96103.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
Length=545

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 3/215 (1%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI + VT  NG+
Sbjct  33   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIALMVTAGNGD  92

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I  L     AA WV+AN+ P+YP T I+++ VGNE++  G   + + LV AMR+L  ALV
Sbjct  93   IPKLATKDGAAAWVSANVAPYYPKTDISLVLVGNEIMDTGDASLISNLVPAMRALRAALV  152

Query  483  KSGIKEIKVSSPHSLGIMLRA-DPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             +G ++I+VS+PHSLGI+  A +PPS  RFR GWD  + APML F R++  PFMVNPYPY
Sbjct  153  AAGFRKIRVSTPHSLGILAGASEPPSASRFRDGWDRAVFAPMLAFHRQSRSPFMVNPYPY  212

Query  660  FGYAPDKADLALFRPNK--GYVDRFSRRTYGNMFD  758
            FGY       AL RP+   G  D  +  TY +MF+
Sbjct  213  FGYNGATLPYALARPDNKLGVTDPGTGITYTSMFE  247



>ref|XP_006846181.2| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
[Amborella trichopoda]
Length=542

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 138/212 (65%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            SIGVNYGTLGDNLPPP +VA FLK +T ID + IF  NP IL AF GT I VT+T  N E
Sbjct  123  SIGVNYGTLGDNLPPPDQVANFLKTRTHIDSVSIFSANPVILHAFVGTRISVTITAANNE  182

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I+ L    +A+ W+A ++ PF PATKI  I +GNEVL  G   +    V AM++L  AL 
Sbjct  183  IVRLSKPSFASXWMAKHVLPFTPATKIARILIGNEVLVTGDKMLIAHFVPAMKTLKYALN  242

Query  483  KSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
               +  I+VS+PH+L ++  ++PPS G+FR G D  +L PM+ FLR+T  PFM+NPYPYF
Sbjct  243  ARNLTHIQVSTPHALAMLFVSNPPSAGQFRQGLDKVVLTPMIAFLRQTRTPFMINPYPYF  302

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+ P     ALF+ N    D  S + Y NMFD
Sbjct  303  GFGPKTLGWALFKRNSIEFDHISGKYYTNMFD  334



>gb|EAZ03332.1| hypothetical protein OsI_25474 [Oryza sativa Indica Group]
Length=501

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 150/220 (68%), Gaps = 1/220 (0%)
 Frame = +3

Query  102  LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  281
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  282  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  461
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVGNE+++     +  GLV AMR
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNALIGGLVPAMR  140

Query  462  SLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFM  641
            +L  ALV +G + I+VS+PHSLGI+  + PPS  RF    D    APML+FLR+T  PF+
Sbjct  141  TLRAALVAAGFRRIRVSTPHSLGILSVSSPPSASRFLDVLDRTFFAPMLEFLRKTKSPFV  200

Query  642  VNPYPYFGYAPDKADLALF-RPNKGYVDRFSRRTYGNMFD  758
            VNPYPYFGY  D    AL  RPN G +D  +  TY +M +
Sbjct  201  VNPYPYFGYNGDTIPYALARRPNPGVLDPGTGITYTSMLE  240



>ref|NP_001059262.1| Os07g0240200 [Oryza sativa Japonica Group]
 dbj|BAC83528.1| putative glucan endo-1,3-beta-glucosidase precursor [Oryza sativa 
Japonica Group]
 dbj|BAF21176.1| Os07g0240200 [Oryza sativa Japonica Group]
 gb|EAZ39236.1| hypothetical protein OsJ_23659 [Oryza sativa Japonica Group]
 dbj|BAG91193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=501

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 150/220 (68%), Gaps = 1/220 (0%)
 Frame = +3

Query  102  LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  281
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  282  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  461
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVGNE+++     +  GLV AMR
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNALIGGLVPAMR  140

Query  462  SLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFM  641
            +L  ALV +G + I+VS+PHSLGI+  + PPS  RF    D    APML+FLR+T  PF+
Sbjct  141  TLRAALVAAGFRRIRVSTPHSLGILSVSSPPSASRFLDVLDRTFFAPMLEFLRKTKSPFV  200

Query  642  VNPYPYFGYAPDKADLALF-RPNKGYVDRFSRRTYGNMFD  758
            VNPYPYFGY  D    AL  RPN G +D  +  TY +M +
Sbjct  201  VNPYPYFGYNGDTIPYALARRPNPGVLDPGTGITYTSMLE  240



>ref|XP_006658422.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=471

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 148/212 (70%), Gaps = 1/212 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPDI++AFAGTGI V VT  NG+I
Sbjct  34   IGVNYGTKGDNLPPPATVAAFLANRTRIDRVKLFDTNPDIVKAFAGTGITVMVTAGNGDI  93

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L     AA WVAANI P+YPAT I+++AVGNE+++     + +GLV AMR+L  ALV 
Sbjct  94   PTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNGLISGLVPAMRTLRAALVA  153

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
            +G + I+VS+PHSLGI+    PPS  RF    D  + APML+FLR+T  PF+VNPYPYFG
Sbjct  154  AGYRRIRVSTPHSLGILAVPAPPSASRFLDVLDRAMFAPMLEFLRKTRSPFIVNPYPYFG  213

Query  666  YAPDKADLALF-RPNKGYVDRFSRRTYGNMFD  758
            Y  D    AL  RPN G +D  +  TY +MF+
Sbjct  214  YNGDTIPYALARRPNPGVLDPGTGITYTSMFE  245



>ref|XP_003607845.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=512

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 140/221 (63%), Gaps = 3/221 (1%)
 Frame = +3

Query  105  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  284
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  18   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  77

Query  285  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  464
            TV N +I  L     A +W+  NI PF+P T  N IAVGNE+L      +   ++ AM +
Sbjct  78   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNEILATSDKTLIAHILPAMNA  137

Query  465  LYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
            L+ AL  S +  I++ SP+SLGI+  + PPS   FR G+DV I  P+LKF RET  PFM+
Sbjct  138  LHQALTLSNLTHIQIVSPNSLGILSSSSPPSSAAFRRGYDVTIFTPILKFHRETKSPFMI  197

Query  645  NPYPYFGYA---PDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            NPYP+FG +   PD  + ALF+PN G  D+ +   Y NMFD
Sbjct  198  NPYPFFGISSNQPDALNYALFKPNGGVFDKATGINYTNMFD  238



>gb|AES90042.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=531

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 140/221 (63%), Gaps = 3/221 (1%)
 Frame = +3

Query  105  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  284
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  37   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  96

Query  285  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  464
            TV N +I  L     A +W+  NI PF+P T  N IAVGNE+L      +   ++ AM +
Sbjct  97   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNEILATSDKTLIAHILPAMNA  156

Query  465  LYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
            L+ AL  S +  I++ SP+SLGI+  + PPS   FR G+DV I  P+LKF RET  PFM+
Sbjct  157  LHQALTLSNLTHIQIVSPNSLGILSSSSPPSSAAFRRGYDVTIFTPILKFHRETKSPFMI  216

Query  645  NPYPYFGYA---PDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            NPYP+FG +   PD  + ALF+PN G  D+ +   Y NMFD
Sbjct  217  NPYPFFGISSNQPDALNYALFKPNGGVFDKATGINYTNMFD  257



>ref|XP_010685761.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=454

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 137/211 (65%), Gaps = 0/211 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IG NYG + DNLPPP+ VA+FL  +T +  +K+FD +P IL+AFA TGI +TV +PN ++
Sbjct  29   IGANYGRVADNLPPPSSVAKFLTSQTTLTSVKLFDCDPQILQAFANTGISLTVNIPNSDV  88

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
            IPL D   A  WVA +I P++P T I  IAVGNE+   G  ++ +  V +M+SL+ AL  
Sbjct  89   IPLSDPTNAQSWVATHILPYHPQTIIRYIAVGNEIHFSGDKQLISNAVNSMKSLHQALKS  148

Query  486  SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFG  665
            + + +IKV++PHSL I+     PS G F   ++     P+L+F R+T   FMVNPYPYFG
Sbjct  149  ANLTDIKVTTPHSLAILPPLMSPSSGHFHKDYNRVFFKPLLEFHRQTKSSFMVNPYPYFG  208

Query  666  YAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +     + A+F+ N G +D+ + + Y NMFD
Sbjct  209  FNASMIEFAIFKKNDGVLDKGTGKMYYNMFD  239



>ref|XP_002448791.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
 gb|EES13119.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
Length=464

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 142/227 (63%), Gaps = 4/227 (2%)
 Frame = +3

Query  90   VSAFLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  266
            VSA  F       IGVNYGT G  LP PT+VARFL   T++DR+++ D +P +L+AFAGT
Sbjct  18   VSAITFTGADAGGIGVNYGTRGTTLPAPTDVARFLARDTIVDRVRLLDADPVLLQAFAGT  77

Query  267  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  446
            G+ V VTVPNG +  L    +A +WV  N+ P+  AT I+ + VG+EV       +   L
Sbjct  78   GLAVDVTVPNGVVPRLVSLAFARRWVRDNVAPYAGATNISRLLVGDEVTTEANRTLLLAL  137

Query  447  VAAMRSLYNALVKSGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRE  623
            V AM++L+ ALV + +   +KVS+ HSLG++   + PS  RFR G+D  I+ PML+FLR 
Sbjct  138  VPAMQNLHTALVAASLHGRVKVSTTHSLGVLTTTEQPSSARFRDGYDTAIVRPMLRFLRA  197

Query  624  TNGPFMVNPYPYFGYAPD--KADLALFRPNKGYVDRFSRRTYGNMFD  758
            T  PFMVN YP++G   D    D ALFR N G +DR S   YGNM D
Sbjct  198  TGAPFMVNAYPFYGLTNDTISLDFALFRVNDGVMDRGSGLVYGNMLD  244



>ref|XP_009143300.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=448

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 140/230 (61%), Gaps = 2/230 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  248
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  249  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  428
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  429  EMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
             + + L+ AM+SL  AL  SG+ ++KV++PH+  ++   D PS  RF       I A +L
Sbjct  130  NLISNLIPAMQSLLEALKVSGLPDMKVTTPHAFTVVYNQDAPSESRFNDEQKY-IFAKIL  188

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +F R+   PFM++ YPYF   P+  + A+F P+    D  + +TY NMFD
Sbjct  189  EFNRQAKSPFMISAYPYFMVDPNNVNYAIFGPSNAITDTKTGKTYNNMFD  238



>emb|CDY53600.1| BnaA05g34730D [Brassica napus]
Length=450

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 141/230 (61%), Gaps = 2/230 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  248
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVMIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  249  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  428
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  429  EMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
             + + L+ AM+SL  AL  SG+ ++KV++P++  ++   D PS  RF       I A +L
Sbjct  130  NLISNLIPAMQSLLEALKVSGLPDMKVTTPNAFTVVYNQDAPSESRFNDE-QKDIFAKIL  188

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +F R+   PFM++ YPYF   P+  + A+F P+K   D  + +TY NMFD
Sbjct  189  EFNRQAKSPFMISAYPYFMVDPNNVNYAIFGPSKAITDTKTGKTYNNMFD  238



>emb|CDY20461.1| BnaC04g05830D [Brassica napus]
Length=450

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 141/230 (61%), Gaps = 2/230 (1%)
 Frame = +3

Query  69   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  248
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVDFIKTKTIIDSVKIYDANPDIL  69

Query  249  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  428
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  429  EMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPML  608
             + + L+ AM+SL+ AL  SG+ ++KV++PH+  ++   + PS  RF       I A +L
Sbjct  130  NLISNLIPAMQSLHEALKVSGLPDMKVTTPHAFTVVYNQNAPSESRFNDE-QKDIFAKIL  188

Query  609  KFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            +F R+   PFM++ YPYF   P+  + A+F P+    D  + +TY NMFD
Sbjct  189  EFNRQAKSPFMISAYPYFMVDPNNVNYAIFGPSNAITDTKTGKTYNNMFD  238



>gb|EMS57155.1| Glucan endo-1,3-beta-glucosidase [Triticum urartu]
Length=492

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 139/233 (60%), Gaps = 19/233 (8%)
 Frame = +3

Query  57   LRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  236
            LR   +   FLV A   +    +IGVNYGT GDNLP P                K+FD  
Sbjct  11   LRAEVVICIFLVIAPFSM----AIGVNYGTKGDNLPSPA---------------KLFDTK  51

Query  237  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  416
            PDI+RAFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVGNE++ 
Sbjct  52   PDIIRAFAGTGISVMVTASNGDIPGLATQNGADAWVATNIAPYYPATDISLVAVGNEIMD  111

Query  417  WGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGIL  596
                 +   LV AM++L  ALV +G  +I+VS+P SLGI++ A PPS  RFR  WDV I 
Sbjct  112  TADKNLIGNLVPAMQTLKAALVTAGYSKIRVSTPSSLGILVDAQPPSAARFRDVWDVAIF  171

Query  597  APMLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMF  755
             PML+FL++T  P +VN YPYFGY  D    AL R N G +D  +  TY +MF
Sbjct  172  TPMLQFLQKTKSPLIVNTYPYFGYNGDTLPYALARSNPGVLDTGTGITYTSMF  224



>ref|XP_006663687.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=459

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA TGI + V++PN  
Sbjct  23   AVGVNYGANADNLPPPKDVATFLAAHTTIDRVKLFDANPAFISAFANTGISLAVSLPNSA  82

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ PF PAT ++++  GNE+L    P +   L+ AMR L 
Sbjct  83   LPSLADKTTGLDAARSWVRANLSPFVPATNVSLLLAGNEILLSPDPNLVVSLLPAMRRLA  142

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRP +D  +  PML+F R+T  PFMVN
Sbjct  143  QALTLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPAYDTKLFPPMLQFHRDTGSPFMVN  202

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     + ALFRPN+G  D  ++  Y +MFD
Sbjct  203  PYPYFSYNNQTLNYALFRPNRGVYDPNTKLNYTSMFD  239



>tpg|DAA35302.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=450

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 138/213 (65%), Gaps = 2/213 (1%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYGT G  LP P +VARFL   T+ DR+++ D +P +LRAFAGTG+ V VTVPNG +
Sbjct  29   IGVNYGTRGTTLPAPADVARFLARDTIFDRVRLLDADPVLLRAFAGTGLAVDVTVPNGVV  88

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L +  +A +WV  N+ P+  AT I+ + VG+EV       +   LV AM++L+ ALV 
Sbjct  89   PHLLNLTFARRWVRDNVTPYAGATNISRLLVGDEVTTEANRTLLLALVPAMQNLHTALVA  148

Query  486  SGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + +   +KVS+ HSLG++   + PS  RFR G+D  I+ P+L+FLR T  PFMVN YP++
Sbjct  149  ASLHGRVKVSTTHSLGVLTTTEQPSAARFRDGYDAAIVRPLLRFLRATGAPFMVNAYPFY  208

Query  663  GYAPDKA-DLALFRPNKGYVDRFSRRTYGNMFD  758
              A D + D ALFR N G +D+ +   YGNM D
Sbjct  209  ALANDSSLDFALFRVNDGVMDQGTGLVYGNMLD  241



>ref|NP_001151529.1| LOC100285163 precursor [Zea mays]
 gb|ACG43184.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
Length=450

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 138/213 (65%), Gaps = 2/213 (1%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYGT G  LP P +VARFL   T+ DR+++ D +P +LRAFAGTG+ V VTVPNG +
Sbjct  29   IGVNYGTRGTTLPAPADVARFLARDTIFDRVRLLDADPVLLRAFAGTGLAVXVTVPNGVV  88

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L +  +A +WV  N+ P+  AT I+ + VG+EV       +   LV AM++L+ ALV 
Sbjct  89   PRLLNLTFARRWVRDNVTPYAGATNISRLLVGDEVTTEANRTLLLALVPAMQNLHTALVA  148

Query  486  SGIK-EIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
            + +   +KVS+ HSLG++   + PS  RFR G+D  I+ P+L+FLR T  PFMVN YP++
Sbjct  149  ASLHGRVKVSTTHSLGVLTTTEQPSAARFRDGYDAAIVRPLLRFLRATGAPFMVNAYPFY  208

Query  663  GYAPDKA-DLALFRPNKGYVDRFSRRTYGNMFD  758
              A D + D ALFR N G +D+ +   YGNM D
Sbjct  209  ALANDSSLDFALFRVNDGVMDQGTGLVYGNMLD  241



>gb|EEC68648.1| hypothetical protein OsI_37085 [Oryza sativa Indica Group]
Length=472

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA T I + V++PN +
Sbjct  35   AVGVNYGANADNLPPPKDVAAFLAAHTTIDRVKLFDANPAFISAFANTPISLAVSLPNSD  94

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L 
Sbjct  95   LPSLADKQTGLDTARAWVRANLSPYVPATNVTLLLAGNEILLSPDPNLVLSLLPAMRHLA  154

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRPG+D  +  PML+F R+T  PFMVN
Sbjct  155  QALRLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPGYDTKLFPPMLQFHRDTGSPFMVN  214

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     D ALFRPN+G  D  ++  Y +MFD
Sbjct  215  PYPYFSYNNQTLDYALFRPNRGVYDPNTKLNYTSMFD  251



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 154/245 (63%), Gaps = 9/245 (4%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I RI+
Sbjct  1    MASSLSHLPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRIR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  398
            +F  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LFGSDPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRP  575
            GNEVL      + + L+ AMR++ +AL  + +  +++VS+ HS+ ++ ++DPPS GRF P
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVQSALSAASLGGKVRVSTVHSMAVLSQSDPPSSGRFNP  179

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTY  743
            G+   +L  +L F R+   PF VNPYP+F Y     P+     LF+PN G VD  S  TY
Sbjct  180  GFQ-DVLKGLLAFQRDNGSPFAVNPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGSGVTY  238

Query  744  GNMFD  758
             NMFD
Sbjct  239  MNMFD  243



>ref|NP_001068545.2| Os11g0704600 [Oryza sativa Japonica Group]
 gb|AAX95270.1| glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan 
endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) 
[Oryza sativa Japonica Group]
 gb|ABA95507.2| Glucan endo-1,3-beta-glucosidase precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG86935.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28908.2| Os11g0704600 [Oryza sativa Japonica Group]
Length=472

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA T I + V++PN +
Sbjct  35   AVGVNYGANADNLPPPKDVAAFLAAHTTIDRVKLFDANPAFISAFANTPISLAVSLPNSD  94

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L 
Sbjct  95   LPSLADKQTGLDTARAWVRANLSPYVPATNVTLLLAGNEILLSPDPNLVLSLLPAMRRLA  154

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRPG+D  +  PML+F R+T  PFMVN
Sbjct  155  QALRLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPGYDTKLFPPMLQFHRDTGSPFMVN  214

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     D ALFRPN+G  D  ++  Y +MFD
Sbjct  215  PYPYFSYNNQTLDYALFRPNRGVYDPNTKLNYTSMFD  251



>gb|AAX95357.1| glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1->3)-beta-glucan 
endohydrolase) ((1->3)-beta-glucanase) (beta-1,3-endoglucanase) 
[Oryza sativa Japonica Group]
Length=510

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA T I + V++PN +
Sbjct  27   AVGVNYGANADNLPPPKDVAAFLAAHTTIDRVKLFDANPAFISAFANTPISLAVSLPNSD  86

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L 
Sbjct  87   LPSLADKQTGLDTARAWVRANLSPYVPATNVTLLLAGNEILLSPDPNLVLSLLPAMRRLA  146

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRPG+D  +  PML+F R+T  PFMVN
Sbjct  147  QALRLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPGYDTKLFPPMLQFHRDTGSPFMVN  206

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     D ALFRPN+G  D  ++  Y +MFD
Sbjct  207  PYPYFSYNNQTLDYALFRPNRGVYDPNTKLNYTSMFD  243



>ref|NP_190241.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAB62327.1| glucosidase-like protein [Arabidopsis thaliana]
 gb|AEE78173.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=356

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 144/229 (63%), Gaps = 3/229 (1%)
 Frame = +3

Query  81   FFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  260
            F +++  L       +GVNYGT+ +NLPPP +V  F+K KT+I+ +KIFD N DIL AF+
Sbjct  12   FLILTLILPFSAAYQVGVNYGTVANNLPPPHQVVNFIKTKTIINHVKIFDTNHDILAAFS  71

Query  261  G-TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  437
            G TGI +TVTVPN +II L     A  W++ N+ PF   T I  IAVGNEV+      + 
Sbjct  72   GITGISLTVTVPNSDIISLSKLSNARSWLSDNLLPFLLTTSIRYIAVGNEVVATSDKTLI  131

Query  438  NGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIM-LRADPPSMGRFRPGWDVGILAPMLKF  614
              L+ AM +L  AL  + +  I VS+PHSLGI+   ++PPS G+FR G+D  I +P+L F
Sbjct  132  THLLPAMETLTLALHLANVSRILVSTPHSLGILSGSSEPPSSGKFRKGYDKAIFSPILDF  191

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNK-GYVDRFSRRTYGNMFD  758
               T  PFMVNPYPYFG+ P+  + ALF  N   YVD  ++  Y NMFD
Sbjct  192  HNRTKSPFMVNPYPYFGFGPETLNYALFNTNDVVYVDPVTKLNYTNMFD  240



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 152/245 (62%), Gaps = 9/245 (4%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M  SL   PI L FL  +AFL       IGVNYG + DNLPPP+E A+ L + T I R++
Sbjct  1    MASSLSHFPILLLFLSFTAFLSADSQSFIGVNYGQVADNLPPPSETAKLL-QSTAIKRVR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P I++A AG+GI + +   NG+I  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGASNGDIPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRP  575
            GNEVL      + + L+ AMR++ +AL  + +  +++VS+ HS+ ++ ++DPPS G+F P
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVLSALSAASLGGKVRVSTVHSMAVLAQSDPPSSGQFNP  179

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTY  743
            G+   +L  +L F R+   PF VNPYP+F Y     P+     LF+PN G VD  S   Y
Sbjct  180  GFQ-DVLKGLLAFQRDNGSPFAVNPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGSGIKY  238

Query  744  GNMFD  758
             NMFD
Sbjct  239  MNMFD  243



>gb|EEE52578.1| hypothetical protein OsJ_34867 [Oryza sativa Japonica Group]
Length=842

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA T I + V++PN +
Sbjct  35   AVGVNYGANADNLPPPKDVAAFLAAHTTIDRVKLFDANPAFISAFANTPISLAVSLPNSD  94

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L 
Sbjct  95   LPSLADKQTGLDTARAWVRANLSPYVPATNVTLLLAGNEILLSPDPNLVLSLLPAMRRLA  154

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRPG+D  +  PML+F R+T  PFMVN
Sbjct  155  QALRLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPGYDTKLFPPMLQFHRDTGSPFMVN  214

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     D ALFRPN+G  D  ++  Y +MFD
Sbjct  215  PYPYFSYNNQTLDYALFRPNRGVYDPNTKLNYTSMFD  251


 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  123  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  302
            ++GVNYG   DNLPPP +VA FL   T IDR+K+FD NP  + AFA T I + V++PN +
Sbjct  405  AVGVNYGANADNLPPPKDVAAFLAAHTTIDRVKLFDANPAFISAFANTPISLAVSLPNSD  464

Query  303  IIPLKDA----GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  470
            +  L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L 
Sbjct  465  LPSLADKQTGLDTARAWVRANLSPYVPATNVTLLLAGNEILLSPDPNLVLSLLPAMRRLA  524

Query  471  NALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVN  647
             AL   G+  ++V++PH LGI+  +D  PS  RFRPG+D  +  PML+F R+T  PFMVN
Sbjct  525  QALRLEGLTGVRVTTPHYLGILAPSDGIPSNARFRPGYDTKLFPPMLQFHRDTGSPFMVN  584

Query  648  PYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            PYPYF Y     D ALFRPN+G  D  ++  Y +MFD
Sbjct  585  PYPYFSYNNQTLDYALFRPNRGVYDPNTKLNYTSMFD  621



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 152/245 (62%), Gaps = 9/245 (4%)
 Frame = +3

Query  45   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I R++
Sbjct  1    MASSLSHFPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRVR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRP  575
            GNEVL      + + L+ AMR++ +AL  + +  +++VS+ HS+ ++ ++DPPS G F P
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVQSALSAASLGGKVRVSTVHSMAVLAQSDPPSSGLFNP  179

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTY  743
            G+   +L  +L F R+   PF VNPYP+F Y     P+     LF+PN G VD  S   Y
Sbjct  180  GFQ-DVLKGLLAFQRDNGSPFAVNPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGSGVKY  238

Query  744  GNMFD  758
             NMFD
Sbjct  239  MNMFD  243



>ref|XP_006411190.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
 gb|ESQ52643.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
Length=553

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 143/229 (62%), Gaps = 6/229 (3%)
 Frame = +3

Query  81   FFLVSAFLF-IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
              LVSA +F +  V S +G+NYGTLG NLPPP +V  F+K KT+ D +KIFD NPDILRA
Sbjct  13   LLLVSAVIFQLSAVTSAVGINYGTLG-NLPPPQQVVDFIKTKTIFDSVKIFDANPDILRA  71

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
             AG+GI VT+TVPNG I  L +   A QWVAAN+ PF+  T I  I VGNE+L      +
Sbjct  72   LAGSGIHVTITVPNGNIPALANLENARQWVAANVLPFH-QTTIKYICVGNEILLTKDMNL  130

Query  435  QNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKF  614
             + LV AM+SL  AL  SG+ + KV++PH+  +    + PS  RF         A +L+F
Sbjct  131  ISNLVPAMQSLTEALKASGLTDTKVTTPHAFTVGYNQNAPSESRFNDD-QKDFFAKVLEF  189

Query  615  LRETNGPFMVNPYPYFGYAPDKADLALFRPNK-GYVDRFSRRTYGNMFD  758
             R+   PFM++ YPYF   P+  + A+F P+  G +D  ++ TY NMFD
Sbjct  190  HRQAKSPFMISAYPYFMVDPNNVNFAIFGPSSHGLMDTHTQHTYNNMFD  238



>ref|XP_004960035.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Setaria italica]
Length=471

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 146/251 (58%), Gaps = 11/251 (4%)
 Frame = +3

Query  36   LKIMEMSLRPSPIFLFFLVSAFLFIHGV------RSIGVNYGTLGDNLPPPTEVARFLKE  197
            +K+  M L P+ +    L+   L+I  V        +GVNYGT G  LP P +VARFL  
Sbjct  1    MKLATMRL-PTVLVQILLLPMLLWISAVIKGADAGGVGVNYGTRGTTLPAPADVARFLVR  59

Query  198  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFY-PA  374
            +TV+DR+++ D +P +LRA AGTG+ V VTVPNG +  L    +A +WV  N+ P    A
Sbjct  60   ETVVDRVRLLDADPAVLRALAGTGLAVDVTVPNGVVPRLVSLAFARRWVRENVVPHARAA  119

Query  375  TKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK-EIKVSSPHSLGIMLRADP  551
            T I+ + VG+EV       +   LV AM++L+ AL    +   +KVS+ HSLG++   + 
Sbjct  120  TNISRVLVGDEVTTEANRTLLLALVPAMQNLHTALAAESLHGRVKVSTTHSLGVLTSTER  179

Query  552  PSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYFGYA--PDKADLALFRPNKGYVDR  725
            PS  RFR G+D  I+ P+L+FLR T  PFMVN YP++G     D  D ALFR N G VD 
Sbjct  180  PSAARFRDGYDAAIVKPLLRFLRATAAPFMVNAYPFYGLTNENDTLDFALFRVNSGVVDE  239

Query  726  FSRRTYGNMFD  758
             S   Y NM D
Sbjct  240  GSGLVYSNMLD  250



>ref|XP_008783886.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Phoenix dactylifera]
Length=384

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 142/236 (60%), Gaps = 9/236 (4%)
 Frame = +3

Query  69   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PAT+I+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLVVTVPNEVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNEVFTSD  131

Query  423  TPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               + + LV AM SL+ ALV+ G+   + +S+ +SLG++  + PPS G FRP     +L 
Sbjct  132  DTALASNLVPAMHSLHAALVQLGLDSYVHISTANSLGVLQNSYPPSFGSFRPEL-ANLLL  190

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKA----DLALFRPNKGYVDRFSRRTYGNMF  755
            P L+FL ETN PF +N YPYF Y  D      D  L  PN+G VD +++  Y NM 
Sbjct  191  PFLQFLAETNSPFWINAYPYFAYKGDPDGVPLDYVLLNPNQGMVDPYTKLHYDNML  246



>ref|XP_003577202.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brachypodium 
distachyon]
Length=474

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 129/216 (60%), Gaps = 5/216 (2%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYG   DNLP PT VA FL  KT I+R+K+FD NP  + AFA T I V +T+PN  +
Sbjct  39   IGVNYGANADNLPAPTAVAAFLASKTTINRVKLFDYNPTFISAFANTSISVAITLPNSLL  98

Query  306  IPLKDAG----YAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
              L D       A  WV AN+ P+ PAT + ++  GNE+L    P +   L+ AMR L  
Sbjct  99   PSLADKSTGLTTAVSWVRANLAPYVPATNVTLLLAGNEILLSPDPNLILALLPAMRRLAQ  158

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            AL   G   I+VS+PH LGI+  +D  PS   FR G++  +   ML+F R+T  PFMVNP
Sbjct  159  ALKSEGFPSIRVSTPHYLGILAPSDGIPSNATFRAGYNTKLFPSMLQFHRDTKSPFMVNP  218

Query  651  YPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YPYF Y P   + ALFRPN G  D  ++  Y +MF+
Sbjct  219  YPYFSYNPQTLNYALFRPNAGIYDPATKLNYTSMFE  254



>ref|XP_008783885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Phoenix dactylifera]
Length=397

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 142/236 (60%), Gaps = 9/236 (4%)
 Frame = +3

Query  69   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PAT+I+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLVVTVPNEVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNEVFTSD  131

Query  423  TPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               + + LV AM SL+ ALV+ G+   + +S+ +SLG++  + PPS G FRP     +L 
Sbjct  132  DTALASNLVPAMHSLHAALVQLGLDSYVHISTANSLGVLQNSYPPSFGSFRPEL-ANLLL  190

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPDKA----DLALFRPNKGYVDRFSRRTYGNMF  755
            P L+FL ETN PF +N YPYF Y  D      D  L  PN+G VD +++  Y NM 
Sbjct  191  PFLQFLAETNSPFWINAYPYFAYKGDPDGVPLDYVLLNPNQGMVDPYTKLHYDNML  246



>gb|KDO69312.1| hypothetical protein CISIN_1g0384522mg, partial [Citrus sinensis]
Length=382

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 122/172 (71%), Gaps = 0/172 (0%)
 Frame = +3

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            ILRAFA T I VTV+V NG+I  L     A  WVAANI PFYP+TKI  + VGNE++   
Sbjct  1    ILRAFANTNISVTVSVGNGDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNEIMQSA  60

Query  423  TPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAP  602
              +    LV AM+S+ NAL+++GIK+IK+S+P++LG +  ++PPS G+FR G+D  I+AP
Sbjct  61   NKDWIYNLVPAMKSINNALIEAGIKDIKISTPNTLGFLGVSEPPSAGKFREGYDKDIIAP  120

Query  603  MLKFLRETNGPFMVNPYPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            ML+FLRET   FM+NPYPYF YA   +D  LF+PNKG  D  +R TY NMFD
Sbjct  121  MLEFLRETKSAFMINPYPYFNYADSISDYILFKPNKGVYDPNTRITYSNMFD  172



>ref|XP_009392256.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 130/212 (61%), Gaps = 1/212 (0%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IG++YG    NLPPP +VA+FL   T  D +K+FD +P  ++AFA T + V VTVPN  +
Sbjct  25   IGISYGRAASNLPPPVQVAQFLAHGTTFDCVKLFDADPATVQAFANTDLAVDVTVPNDLV  84

Query  306  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  485
              L D  +A +WV  NI P    T I  I VGNEV+      + + LV AM++L+  L  
Sbjct  85   ANLTDLRFAHKWVRTNIVPRVDDTNIARILVGNEVISTANRSLVSSLVPAMQNLHTVLTS  144

Query  486  SGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPYF  662
              ++  IKV+SP SLG++  ++PPS G+FR G    ++ P+L FLR T  PFMVN YP+F
Sbjct  145  LSLQHRIKVASPQSLGVLSTSNPPSTGKFREGRVAEVMRPLLSFLRATGSPFMVNAYPFF  204

Query  663  GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            G+A D  D ALFRPN G  D+ +   Y NM D
Sbjct  205  GFAVDTIDYALFRPNPGVEDQNTGLVYSNMLD  236



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 148/241 (61%), Gaps = 8/241 (3%)
 Frame = +3

Query  54   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  233
            SL   PIFLF L +AF        IGVNYG + DNLPPP   A+ L + T I R++++  
Sbjct  3    SLSHLPIFLFLLFTAFYSAASQSFIGVNYGQVADNLPPPAATAKLL-QSTSIKRVRLYGA  61

Query  234  NPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEV  410
            +P I++A AGTGI + +   NG+I  L  D   AAQWV +N+  FYPA+ I++I VGNEV
Sbjct  62   DPAIIKALAGTGIAIAIGASNGDIPALASDPNAAAQWVNSNVLAFYPASNIDLINVGNEV  121

Query  411  LHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDV  587
            L      + + L+ AMR++ +AL  + +  +++VS+ H++ ++ ++DPPS GRF+PG+  
Sbjct  122  LFSNDQGLISQLLPAMRNVQSALSAASLGGKVRVSTVHAMTLLAQSDPPSSGRFKPGFQ-  180

Query  588  GILAPMLKFLRETNGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTYGNMF  755
             +L  +L F R+   PF VNPYP+F Y     P+     LF+PN G VD  +   Y NMF
Sbjct  181  DVLKGLLAFQRDNGSPFAVNPYPFFAYQSDPRPETLAFCLFQPNAGRVDAGTGIKYMNMF  240

Query  756  D  758
            D
Sbjct  241  D  241



>sp|P52409.1|E13B_WHEAT RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Triticum 
aestivum]
 gb|AAA90953.1| beta 1,3-glucanase [Triticum aestivum]
Length=461

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 5/216 (2%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            IGVNYG   DNLP PT VA FL  KT IDR+K+FD NP  + AFAGT I + V++PN  +
Sbjct  26   IGVNYGANADNLPSPTSVATFLATKTTIDRVKLFDANPTFISAFAGTPISLAVSLPNSAL  85

Query  306  IPLKDAGY----AAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  473
              L D       A  W+ AN+ P+ PAT + ++  GNE+L      +   L+ AMR L  
Sbjct  86   PALADKATGLDAARSWIRANLSPYVPATNVTLLLAGNEILLSTDTNLILSLLPAMRRLAQ  145

Query  474  ALVKSGIKEIKVSSPHSLGIMLRADP-PSMGRFRPGWDVGILAPMLKFLRETNGPFMVNP  650
            AL   G+  ++V++PH LGI+  +D  PS   FR G++  +   ML+F R+T  PFMVNP
Sbjct  146  ALKAEGLTGVRVTTPHYLGILAPSDGIPSNASFRAGYNTKLFPAMLQFHRDTGSPFMVNP  205

Query  651  YPYFGYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            YPYF Y P+  + ALFRPN G  D  ++  Y +M D
Sbjct  206  YPYFSYRPETLNYALFRPNSGIYDPATKLNYTSMLD  241



>gb|EPS68882.1| hypothetical protein M569_05882 [Genlisea aurea]
Length=377

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 141/232 (61%), Gaps = 10/232 (4%)
 Frame = +3

Query  75   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  254
            FLFF     LF  G   +G+NYG +G+NLP P EV + L+    I + +I+D NP IL+A
Sbjct  4    FLFFSGYGGLFAEG---LGINYGQVGNNLPAPEEVLQLLRSLK-ISKARIYDTNPQILKA  59

Query  255  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  434
            FA +G+ +TVTVPN  +  L D   A QWV  N+  ++PAT+I  IAVGNEV   G  E+
Sbjct  60   FADSGVEITVTVPNELLYALVDPVQALQWVKTNVGAYFPATRIAGIAVGNEVFSGGGTEL  119

Query  435  QNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLK  611
             + LV AM S++ ALV+SG+ + IKVS+P+SL ++  + PPS GRFR     G++  +LK
Sbjct  120  LSHLVPAMMSIHGALVESGLDQLIKVSTPNSLAVLEESYPPSAGRFR-AEVAGVMGELLK  178

Query  612  FLRETNGPFMVNPYPYFGYAPD----KADLALFRPNKGYVDRFSRRTYGNMF  755
            FL  T  PF +N YPYF Y  +      D  LF PN G +D  +   Y NM 
Sbjct  179  FLASTKAPFWINSYPYFAYKDNPQQISLDYVLFNPNAGMLDPTTNHLYDNML  230



>ref|XP_002877494.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53753.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 138/214 (64%), Gaps = 3/214 (1%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  302
            +GVNYGT+ +NLPPP +V  F+K KT I+ +KIFD NPDIL AF+G T I +TVT+PN +
Sbjct  27   VGVNYGTVANNLPPPHQVVNFIKTKTNINHVKIFDTNPDILAAFSGSTEISLTVTIPNSD  86

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I+ L     A  W++ ++ PF P T I+ IAVGNEV+      +   L+ AM SL  AL 
Sbjct  87   ILSLSKLPNARSWLSNHLLPFLPTTSISYIAVGNEVIATSDKTLITHLLPAMESLTLALH  146

Query  483  KSGIKEIKVSSPHSLGIM-LRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + +  I VS+PHSLGI+   ++PPS G+FR G+D  I  P+L F   T  PFMVNPYPY
Sbjct  147  LANVTGILVSTPHSLGILSGSSEPPSSGKFRNGYDKAIFTPILDFHNRTKSPFMVNPYPY  206

Query  660  FGYAPDKADLALFRPNKG-YVDRFSRRTYGNMFD  758
            FG  P+  + ALF  N   +VD  ++  Y NMFD
Sbjct  207  FGSGPETLNYALFNSNDYVFVDPVTKMNYTNMFD  240



>ref|XP_009407686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 146/245 (60%), Gaps = 12/245 (5%)
 Frame = +3

Query  51   MSLRPSPIFLFFLVSAFL---FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            MS R S  FL  +   FL   F      +GVNYG + DNLPPP   AR LK  T I +I+
Sbjct  1    MSYR-SRFFLLVISPLFLILPFAESQSFVGVNYGEVADNLPPPEATARLLK-STTISKIR  58

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P ILRA AGT I V +   +G+I  L  D   A +WV+AN+ PF PAT I+I++V
Sbjct  59   LYGTDPPILRALAGTNISVIIGAADGDIPSLASDPSAARRWVSANVLPFLPATAISIVSV  118

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRP  575
            GNEVL  G   +   L+ AMR+L++AL ++     IKVS+ HS+ ++  ++PPS G FR 
Sbjct  119  GNEVLAPGDASLGPQLLPAMRNLHSALSEAAPSAGIKVSTVHSMAVLASSEPPSAGVFRA  178

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTY  743
                  LA +L FLRET  PFM+NPYPYF Y     P+     LFRPN G  D  S+ TY
Sbjct  179  DL-TSNLAGVLGFLRETGAPFMINPYPYFAYQSDPRPETLAFCLFRPNPGRFDGGSKLTY  237

Query  744  GNMFD  758
             NMFD
Sbjct  238  TNMFD  242



>gb|EEC78268.1| hypothetical protein OsI_17962 [Oryza sativa Indica Group]
Length=912

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 98/219 (45%), Positives = 133/219 (61%), Gaps = 8/219 (4%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            +GV YG  G N+PPP +VARFL   T+ DR+++ D +P  LRAFAGTG+ V VTVPN ++
Sbjct  474  VGVTYGMRGTNMPPPADVARFLSRDTIFDRVRLLDADPRALRAFAGTGLAVDVTVPNADV  533

Query  306  IPLKDA-GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
              L  +   A +WV A++ P+  AT ++ + VG+EV+      +   LV AMR+L+ AL 
Sbjct  534  PRLAASRASARRWVRASVAPYAEATNVSRVLVGDEVISQANRTLLLSLVPAMRNLHAALA  593

Query  483  K------SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
                      + IKVS+PHSLGI+  + PPS GRF  G+D  ++ P+L FLR T  PFMV
Sbjct  594  AVLPPSPRRREIIKVSTPHSLGILAASTPPSAGRFHDGYDTAVVKPLLGFLRATGAPFMV  653

Query  645  NPYPYF-GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            N YP++ G   D  D ALFR N G  D  +   Y NM D
Sbjct  654  NAYPFYGGLTNDTLDYALFRVNDGVTDDATGLLYANMLD  692



>emb|CAJ86292.1| H0124B04.9 [Oryza sativa Indica Group]
Length=1216

 Score =   193 bits (491),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 98/219 (45%), Positives = 133/219 (61%), Gaps = 8/219 (4%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  305
            +GV YG  G N+PPP +VARFL   T+ DR+++ D +P  LRAFAGTG+ V VTVPN ++
Sbjct  778  VGVTYGMRGTNMPPPADVARFLSRDTIFDRVRLLDADPRALRAFAGTGLAVDVTVPNADV  837

Query  306  IPLKDA-GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
              L  +   A +WV A++ P+  AT ++ + VG+EV+      +   LV AMR+L+ AL 
Sbjct  838  PRLAASRASARRWVRASVAPYAEATNVSRVLVGDEVISQANRTLLLSLVPAMRNLHAALA  897

Query  483  K------SGIKEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
                      + IKVS+PHSLGI+  + PPS GRF  G+D  ++ P+L FLR T  PFMV
Sbjct  898  AVLPPSPRRREIIKVSTPHSLGILAASTPPSAGRFHDGYDTAVVKPLLGFLRATGAPFMV  957

Query  645  NPYPYF-GYAPDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            N YP++ G   D  D ALFR N G  D  +   Y NM D
Sbjct  958  NAYPFYGGLTNDTLDYALFRVNDGVTDDATGLLYANMLD  996



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 145/245 (59%), Gaps = 11/245 (4%)
 Frame = +3

Query  51   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M+LR S   +    S FL +   +S   IGVNYG + DNLPPP E AR LK  T I +++
Sbjct  1    MALRNSLSIVIAAWSLFLAVPFAKSQSFIGVNYGQVADNLPPPEETARLLK-STTISKVR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P ILRA AGT I V +   NG+I  L  D   A  WV+AN+ PF PAT I+++AV
Sbjct  60   LYGADPAILRALAGTDISVVIGAANGDIASLASDPSAATNWVSANVLPFVPATSISVVAV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRP  575
            GNE L  G   + + L+ AM+++YNAL  +     IKVS+ H + I+ ++DPPS G F  
Sbjct  120  GNEALTSGDATLASQLLPAMQNMYNALSAAAPSAGIKVSTVHIMTILAQSDPPSSGAFHA  179

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGY----APDKADLALFRPNKGYVDRFSRRTY  743
               V  L  +L FL++T  PFM+NPYPYF Y     P+     LF+PN G  D  S  TY
Sbjct  180  DL-VPALKGVLAFLQKTGAPFMINPYPYFAYRSDPRPETLAFCLFQPNAGRHDAGSGVTY  238

Query  744  GNMFD  758
             NMFD
Sbjct  239  MNMFD  243



>ref|XP_010925705.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Elaeis guineensis]
Length=398

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 142/236 (60%), Gaps = 9/236 (4%)
 Frame = +3

Query  69   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNEVFTSD  131

Query  423  TPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               + + LV AM S++ ALV+ G+   I +S+ +SL ++  + PPS G F+P     +L 
Sbjct  132  DMALMSNLVPAMVSIHAALVQLGLDSYIHLSTANSLAVLENSYPPSSGSFKPEL-ASLLV  190

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPD----KADLALFRPNKGYVDRFSRRTYGNMF  755
            P L+FL+ETN PF +N YPYF +  D      D  LF PN+G  D +++  Y NM 
Sbjct  191  PFLQFLQETNSPFWINAYPYFAFKGDPNRVSLDYVLFNPNQGIADPYTKLHYDNML  246



>ref|XP_010925707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Elaeis guineensis]
Length=385

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 142/236 (60%), Gaps = 9/236 (4%)
 Frame = +3

Query  69   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  242
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  243  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  422
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNEVFTSD  131

Query  423  TPEMQNGLVAAMRSLYNALVKSGIKE-IKVSSPHSLGIMLRADPPSMGRFRPGWDVGILA  599
               + + LV AM S++ ALV+ G+   I +S+ +SL ++  + PPS G F+P     +L 
Sbjct  132  DMALMSNLVPAMVSIHAALVQLGLDSYIHLSTANSLAVLENSYPPSSGSFKPEL-ASLLV  190

Query  600  PMLKFLRETNGPFMVNPYPYFGYAPD----KADLALFRPNKGYVDRFSRRTYGNMF  755
            P L+FL+ETN PF +N YPYF +  D      D  LF PN+G  D +++  Y NM 
Sbjct  191  PFLQFLQETNSPFWINAYPYFAFKGDPNRVSLDYVLFNPNQGIADPYTKLHYDNML  246



>ref|XP_006292633.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
 gb|EOA25531.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
Length=348

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 137/214 (64%), Gaps = 3/214 (1%)
 Frame = +3

Query  126  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  302
            IGVNYGT+ +NLPPP +V  F+K KT I+ +KIFD NPDIL AF+G TGI +TVT+PN +
Sbjct  28   IGVNYGTVANNLPPPHQVVNFIKTKTNINHVKIFDANPDILAAFSGITGISLTVTIPNSD  87

Query  303  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  482
            I+ L     A  W++ ++ PF PAT I  IAVGNE++      +   L+  M SL  AL 
Sbjct  88   IVSLSKLPNARSWLSNHLLPFLPATSIRYIAVGNEIIATSDKTLIAHLLPTMESLTLALH  147

Query  483  KSGIKEIKVSSPHSLGIM-LRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMVNPYPY  659
             + +  I VS+PHSLGI+   ++PPS G FR G+   I AP+L F   T  PFMVNPYPY
Sbjct  148  LANVTGILVSTPHSLGILSGSSEPPSSGTFRRGYVKTIFAPILDFHNRTKSPFMVNPYPY  207

Query  660  FGYAPDKADLALFRPNKGYV-DRFSRRTYGNMFD  758
            FG+ P+  + ALF  +   V D  ++  Y NMFD
Sbjct  208  FGFGPETLNYALFNSSDVVVFDPVTKMNYTNMFD  241



>ref|XP_010447074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 140/228 (61%), Gaps = 8/228 (4%)
 Frame = +3

Query  93   SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGI  272
            S F   H    IGVNYG + DNLPPP+E A+ L + T I +++++  +P I++A AGTG+
Sbjct  17   SHFPSSHAESFIGVNYGQVADNLPPPSETAKLL-QSTSIQKVRLYGADPAIIKALAGTGV  75

Query  273  LVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLV  449
             + +   NG++  L  D   A QW+ +N+ PFYPA+KI +I VGNEVL    P + N L+
Sbjct  76   GIVIGAANGDVPSLASDPNVAGQWINSNVLPFYPASKIILITVGNEVLLSNDPNLVNQLL  135

Query  450  AAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRET  626
             AM++L  AL    +  +IKVS+ H++ ++  +DPPS G F PG+  G L  +L+FL +T
Sbjct  136  PAMQNLQKALEAVSLGGKIKVSTVHAMTVLGSSDPPSAGSFAPGYQTG-LKGILQFLSDT  194

Query  627  NGPFMVNPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTYGNMFD  758
              PF +NPYP+F Y     P+     LF+PN G VD  +   Y NMFD
Sbjct  195  GSPFAINPYPFFAYQSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFD  242



>ref|XP_002867117.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43376.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 137/222 (62%), Gaps = 8/222 (4%)
 Frame = +3

Query  111  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  290
            H    IGVNYG + DNLPPP+E A+ L + T I +++++  +P I++A AGTG+ + +  
Sbjct  21   HAEPFIGVNYGQVADNLPPPSETAKLL-QSTSIQKVRLYGADPAIIKALAGTGVGIVIGA  79

Query  291  PNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  467
             NG++     D   A QW+ +N+ PFYPA+KI +I VGNE+L    P + N L+ AM+++
Sbjct  80   ANGDVPSFASDPNAATQWINSNVLPFYPASKIILITVGNEILMSNDPNLVNQLLPAMQNV  139

Query  468  YNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFRPGWDVGILAPMLKFLRETNGPFMV  644
              AL    +  +IKVS+ HS+ ++  +DPPS G F PG+  G L  +L+FL +T  PF +
Sbjct  140  QKALEAVSLGGKIKVSTVHSMTVLGSSDPPSTGSFAPGYQTG-LKGILQFLSDTGSPFAI  198

Query  645  NPYPYFGYA----PDKADLALFRPNKGYVDRFSRRTYGNMFD  758
            NPYP+F Y     P+     LF+PN G VD  +   Y NMFD
Sbjct  199  NPYPFFAYQSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFD  240



>ref|XP_010478378.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Camelina sativa]
 ref|XP_010478379.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Camelina sativa]
Length=410

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 146/245 (60%), Gaps = 10/245 (4%)
 Frame = +3

Query  45   MEMSLRPSPIFLFF---LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  215
            M M++  S + L F    +   L    V S+G+NYG +GDNLPPP +V + L     I++
Sbjct  7    MTMTMTNSIVLLLFSLTFLECGLLFQRVSSLGINYGQVGDNLPPPDKVLQLLSSLH-INK  65

Query  216  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  395
             +I+D NP +L +FA + I + VTV N  +  L D   A QWV   IKP++PATKI  IA
Sbjct  66   TRIYDTNPRVLTSFANSNIELFVTVENEMLSSLVDPQQALQWVTTRIKPYFPATKIGGIA  125

Query  396  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI-KEIKVSSPHSLGIMLRADPPSMGRFR  572
            VGNE+       +   LV AM S+++ALV++G+ K I+VS+P+SL ++  + PPS G FR
Sbjct  126  VGNELYTDDDSSLIGYLVPAMMSIHSALVQTGLDKYIQVSTPNSLSVLQESYPPSAGCFR  185

Query  573  PGWDVGILAPMLKFLRETNGPFMVNPYPYFGY--APDKA--DLALFRPNKGYVDRFSRRT  740
            P    G++  +L FLR T  PF +N YPYF Y  +P K   D  LF PN G VD F++  
Sbjct  186  PEV-AGVMTQLLTFLRNTKSPFWINAYPYFAYKDSPTKIPLDYVLFNPNPGMVDPFTKYH  244

Query  741  YGNMF  755
            Y NM 
Sbjct  245  YDNML  249



>ref|XP_006307574.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
 gb|EOA40472.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
Length=431

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 142/244 (58%), Gaps = 9/244 (4%)
 Frame = +3

Query  45   MEMSL--RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  218
            ME+++  R SPI    L   F+F   + SIGVNYG +GDNLPPP+EV   +K      ++
Sbjct  1    MELNIFHRSSPILFLLLSVTFIFPTAITSIGVNYGQIGDNLPPPSEVIPLIKSIGAT-KV  59

Query  219  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  398
            K++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +
Sbjct  60   KLYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITI  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK-EIKVSSPHSLGIMLRADPPSMGRFRP  575
            GNE+L      +   L+ AM+ +++AL  +G+  +I V++ HSL I+  + PPS G F+P
Sbjct  120  GNEILALNDSSLTVNLLPAMQGVHSALTTAGLSGQISVTTAHSLSILKTSFPPSAGEFQP  179

Query  576  GWDVGILAPMLKFLRETNGPFMVNPYPYFGYAPDKA----DLALFRPNKGYVDRFSRRTY  743
               V  L P+L F R+T  PF++N YP+F Y  +      D  LF+PN+G VD  +   Y
Sbjct  180  DL-VDALTPILDFHRKTESPFLINAYPFFAYKGNPKEVPLDFVLFQPNQGVVDPTTGFHY  238

Query  744  GNMF  755
             NM 
Sbjct  239  DNML  242



>ref|XP_004147788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis sativus]
 gb|KGN59949.1| hypothetical protein Csa_3G855430 [Cucumis sativus]
Length=478

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 149/244 (61%), Gaps = 8/244 (3%)
 Frame = +3

Query  45   MEMSLRPSPIFLFF-LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M  ++ PS IF+FF  + A   ++    IG+NYG + DNLPPP+  A+ L + T I++++
Sbjct  1    MASTILPSTIFVFFTFLLATEIVYSQSFIGINYGQVADNLPPPSATAKLL-QSTSIEKVR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLK-DAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P I++A A TGI + +   NG+I  L  D  +A  WV AN+ PF+PA+KI +I V
Sbjct  60   LYGADPAIIKALANTGIGIVIGAANGDIPALAADPNFAKNWVNANVAPFHPASKIILITV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPG  578
            GNEV+      + N LV A++++ NAL    + +IKVS+ HS+ ++ +++PPS G F P 
Sbjct  120  GNEVITSNQDNLMNQLVPAIQNIQNALNSMSLGDIKVSTVHSMAVLRQSEPPSSGMFHPN  179

Query  579  WDVGILAPMLKFLRETNGPFMVNPYPYFGY----APDKADLALFRPNKGYVDRFSRRTYG  746
            + + +L  +L+F   T  PF +NPYPYF Y     P+     LF+PN G +D  +   Y 
Sbjct  180  Y-MTVLKELLEFNNATGSPFTINPYPYFAYRSDPRPETLAFCLFQPNAGRLDTNTNIKYM  238

Query  747  NMFD  758
            NMFD
Sbjct  239  NMFD  242



>ref|XP_008466580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis melo]
Length=478

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 149/244 (61%), Gaps = 8/244 (3%)
 Frame = +3

Query  45   MEMSLRPSPIFLFF-LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  221
            M  +L PS +F+FF  + A   ++    IG+NYG + DNLPPP+  A+ L + T I++++
Sbjct  1    MASTLLPSTVFVFFSFLLATDIVYSQSFIGINYGQVADNLPPPSATAKLL-QSTSIEKVR  59

Query  222  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLK-DAGYAAQWVAANIKPFYPATKINIIAV  398
            ++  +P I++A A TGI + +   NG+I  L  D  +A  WV AN+ PF+PA+KI +I V
Sbjct  60   LYGADPAIIKALANTGIGIVIGAANGDIPALAADPNFAKNWVNANVAPFHPASKIILITV  119

Query  399  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIKEIKVSSPHSLGIMLRADPPSMGRFRPG  578
            GNEV+      + N LV A++++ NAL    + +IKVS+ HS+ ++ +++PPS G F P 
Sbjct  120  GNEVITSNQENLMNQLVPAIQNIQNALNSMSLGDIKVSTVHSMAVLRQSEPPSSGMFHPN  179

Query  579  WDVGILAPMLKFLRETNGPFMVNPYPYFGY----APDKADLALFRPNKGYVDRFSRRTYG  746
            + + +L  +L+F   T  PF +NPYPYF Y     P+     LF+PN G +D  +   Y 
Sbjct  180  Y-MTVLKELLEFNNATGSPFTINPYPYFAYRSDPRPETLAFCLFQPNAGRLDTNTNIKYM  238

Query  747  NMFD  758
            NMFD
Sbjct  239  NMFD  242



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1469386858550