BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4561

Length=655
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076924.1|  PREDICTED: hippocampus abundant transcript-l...    300   2e-96   Sesamum indicum [beniseed]
ref|XP_009773274.1|  PREDICTED: hippocampus abundant transcript-l...    298   9e-96   Nicotiana sylvestris
ref|XP_002266084.1|  PREDICTED: hippocampus abundant transcript-l...    293   6e-94   Vitis vinifera
gb|EYU19784.1|  hypothetical protein MIMGU_mgv1a006484mg                291   4e-93   Erythranthe guttata [common monkey flower]
ref|XP_002311018.2|  hypothetical protein POPTR_0008s02280g             291   5e-93   
ref|XP_006436628.1|  hypothetical protein CICLE_v10031562mg             291   6e-93   Citrus clementina [clementine]
ref|XP_011032839.1|  PREDICTED: hippocampus abundant transcript-l...    290   1e-92   Populus euphratica
ref|XP_010681370.1|  PREDICTED: hippocampus abundant transcript-l...    290   2e-92   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010312533.1|  PREDICTED: hippocampus abundant transcript-l...    290   2e-92   
ref|XP_006361454.1|  PREDICTED: hippocampus abundant transcript-l...    288   9e-92   Solanum tuberosum [potatoes]
gb|KEH43443.1|  hippocampus abundant transcript-like protein            284   9e-91   Medicago truncatula
ref|XP_010088768.1|  Hippocampus abundant transcript-like protein 1     294   1e-90   
gb|KEH43442.1|  hippocampus abundant transcript-like protein            284   4e-90   Medicago truncatula
ref|XP_010244469.1|  PREDICTED: hippocampus abundant transcript-l...    284   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010067148.1|  PREDICTED: hippocampus abundant transcript-l...    284   4e-90   Eucalyptus grandis [rose gum]
ref|XP_003591772.1|  Hippocampus abundant transcript-like protein       283   7e-90   Medicago truncatula
ref|XP_012074634.1|  PREDICTED: hippocampus abundant transcript-l...    283   8e-90   Jatropha curcas
ref|XP_009594349.1|  PREDICTED: hippocampus abundant transcript-l...    282   1e-89   Nicotiana tomentosiformis
gb|AFK42472.1|  unknown                                                 274   2e-89   Lotus japonicus
ref|XP_002524989.1|  Hippocampus abundant transcript 1 protein, p...    280   1e-88   Ricinus communis
ref|XP_004308556.1|  PREDICTED: hippocampus abundant transcript-l...    277   1e-87   Fragaria vesca subsp. vesca
ref|XP_007214409.1|  hypothetical protein PRUPE_ppa026350mg             277   2e-87   
ref|XP_008232010.1|  PREDICTED: hippocampus abundant transcript-l...    276   2e-87   Prunus mume [ume]
ref|XP_010681372.1|  PREDICTED: hippocampus abundant transcript-l...    276   4e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP35841.1|  hypothetical protein JCGZ_10322                         270   7e-87   Jatropha curcas
ref|XP_007010348.1|  Major facilitator superfamily protein isoform 2    274   2e-86   
ref|XP_012074632.1|  PREDICTED: hippocampus abundant transcript-l...    273   5e-86   Jatropha curcas
ref|XP_007010347.1|  Major facilitator superfamily protein isoform 1    275   1e-85   
emb|CDP20482.1|  unnamed protein product                                271   2e-85   Coffea canephora [robusta coffee]
gb|ERN13076.1|  hypothetical protein AMTR_s00040p00148020               271   3e-85   Amborella trichopoda
ref|XP_006851495.2|  PREDICTED: hippocampus abundant transcript-l...    271   3e-85   Amborella trichopoda
ref|XP_002524988.1|  Hippocampus abundant transcript 1 protein, p...    271   3e-85   
emb|CAN74055.1|  hypothetical protein VITISV_026070                     272   3e-85   Vitis vinifera
ref|XP_007143809.1|  hypothetical protein PHAVU_007G103300g             271   4e-85   Phaseolus vulgaris [French bean]
ref|XP_003591771.1|  Hippocampus abundant transcript-like protein       270   1e-84   Medicago truncatula
gb|AFK40263.1|  unknown                                                 268   3e-84   Medicago truncatula
gb|KGN46030.1|  hypothetical protein Csa_6G045090                       267   8e-84   Cucumis sativus [cucumbers]
gb|KHN37831.1|  Hippocampus abundant transcript-like protein 1          267   2e-83   Glycine soja [wild soybean]
ref|XP_003535506.2|  PREDICTED: hippocampus abundant transcript-l...    267   2e-83   Glycine max [soybeans]
ref|XP_007143808.1|  hypothetical protein PHAVU_007G103300g             266   4e-83   Phaseolus vulgaris [French bean]
ref|XP_004140989.1|  PREDICTED: hippocampus abundant transcript-l...    266   5e-83   Cucumis sativus [cucumbers]
ref|XP_009407349.1|  PREDICTED: hippocampus abundant transcript-l...    266   5e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010681371.1|  PREDICTED: hippocampus abundant transcript-l...    265   1e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009416863.1|  PREDICTED: hippocampus abundant transcript-l...    264   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456592.1|  PREDICTED: hippocampus abundant transcript-l...    263   3e-82   Cucumis melo [Oriental melon]
ref|XP_002315443.2|  hypothetical protein POPTR_0010s24380g             266   4e-81   
ref|XP_011024228.1|  PREDICTED: hippocampus abundant transcript-l...    260   7e-81   Populus euphratica
gb|EPS69092.1|  hypothetical protein M569_05672                         258   2e-80   Genlisea aurea
ref|XP_010032090.1|  PREDICTED: hippocampus abundant transcript-l...    258   3e-80   Eucalyptus grandis [rose gum]
gb|KCW51480.1|  hypothetical protein EUGRSUZ_J00999                     258   2e-79   Eucalyptus grandis [rose gum]
ref|XP_010681373.1|  PREDICTED: hippocampus abundant transcript-l...    251   2e-77   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO99891.1|  unnamed protein product                                241   7e-77   Coffea canephora [robusta coffee]
ref|XP_006361453.1|  PREDICTED: hippocampus abundant transcript-l...    249   8e-77   Solanum tuberosum [potatoes]
gb|EPS69924.1|  hypothetical protein M569_04837                         246   1e-76   Genlisea aurea
ref|XP_010032084.1|  PREDICTED: hippocampus abundant transcript-l...    246   7e-76   
gb|KCW51477.1|  hypothetical protein EUGRSUZ_J00997                     247   9e-76   Eucalyptus grandis [rose gum]
ref|XP_010032083.1|  PREDICTED: hippocampus abundant transcript-l...    246   1e-75   Eucalyptus grandis [rose gum]
ref|XP_004250476.1|  PREDICTED: hippocampus abundant transcript-l...    246   1e-75   Solanum lycopersicum
ref|XP_008788273.1|  PREDICTED: hippocampus abundant transcript-l...    234   1e-71   
ref|XP_008788264.1|  PREDICTED: hippocampus abundant transcript-l...    233   3e-71   
ref|XP_008788255.1|  PREDICTED: hippocampus abundant transcript-l...    234   6e-71   Phoenix dactylifera
ref|XP_009773275.1|  PREDICTED: hippocampus abundant transcript-l...    232   1e-70   Nicotiana sylvestris
ref|XP_010907145.1|  PREDICTED: hippocampus abundant transcript-l...    232   5e-70   Elaeis guineensis
emb|CDO99893.1|  unnamed protein product                                220   8e-69   Coffea canephora [robusta coffee]
ref|XP_011076925.1|  PREDICTED: hippocampus abundant transcript-l...    224   7e-68   
ref|XP_006485218.1|  PREDICTED: hippocampus abundant transcript-l...    218   2e-65   Citrus sinensis [apfelsine]
ref|XP_011032840.1|  PREDICTED: hippocampus abundant transcript-l...    216   1e-64   Populus euphratica
ref|XP_010682914.1|  PREDICTED: hippocampus abundant transcript-l...    212   3e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO42035.1|  hypothetical protein CISIN_1g0164182mg                  206   3e-62   Citrus sinensis [apfelsine]
ref|XP_011469316.1|  PREDICTED: hippocampus abundant transcript-l...    207   3e-61   Fragaria vesca subsp. vesca
ref|XP_007010349.1|  Major facilitator superfamily protein isoform 3    206   1e-60   
ref|XP_003577048.1|  PREDICTED: uncharacterized protein LOC100833620    206   4e-60   Brachypodium distachyon [annual false brome]
ref|XP_010681374.1|  PREDICTED: hippocampus abundant transcript-l...    204   6e-60   Beta vulgaris subsp. vulgaris [field beet]
emb|CBX25325.1|  hypothetical_protein                                   203   1e-59   Oryza brachyantha
ref|XP_004978692.1|  PREDICTED: hippocampus abundant transcript-l...    205   2e-59   Setaria italica
ref|XP_006662736.1|  PREDICTED: hippocampus abundant transcript-l...    203   8e-59   Oryza brachyantha
gb|EEC67684.1|  hypothetical protein OsI_35133                          200   6e-58   Oryza sativa Indica Group [Indian rice]
gb|EEE51661.1|  hypothetical protein OsJ_32986                          200   6e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450280.1|  hypothetical protein SORBIDRAFT_05g003130          200   7e-58   
ref|NP_001065767.2|  Os11g0151500                                       200   9e-58   
ref|NP_001140664.1|  uncharacterized protein LOC100272739 precursor     200   1e-57   Zea mays [maize]
ref|XP_010032091.1|  PREDICTED: hippocampus abundant transcript-l...    194   4e-56   Eucalyptus grandis [rose gum]
emb|CDP20480.1|  unnamed protein product                                193   8e-56   Coffea canephora [robusta coffee]
ref|XP_006589383.1|  PREDICTED: hippocampus abundant transcript-l...    192   3e-55   Glycine max [soybeans]
gb|AAX94836.1|  Major Facilitator Superfamily, putative                 200   4e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EMS64155.1|  Hippocampus abundant transcript-like protein 1          192   8e-55   Triticum urartu
ref|XP_011024229.1|  PREDICTED: hippocampus abundant transcript-l...    187   2e-53   Populus euphratica
ref|XP_003577047.1|  PREDICTED: uncharacterized protein LOC100833312    186   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_010032085.1|  PREDICTED: hippocampus abundant transcript-l...    184   3e-52   
gb|KHN37832.1|  hypothetical protein glysoja_016956                     182   5e-51   Glycine soja [wild soybean]
gb|EMT19766.1|  Hippocampus abundant transcript-like protein 1          187   6e-51   
ref|XP_010312534.1|  PREDICTED: hippocampus abundant transcript-l...    180   7e-51   Solanum lycopersicum
gb|AFK48179.1|  unknown                                                 173   8e-51   Medicago truncatula
gb|KHN00908.1|  Glycine-rich RNA-binding protein 2, mitochondrial       183   5e-50   Glycine soja [wild soybean]
ref|XP_002968361.1|  hypothetical protein SELMODRAFT_169638             152   1e-39   
ref|XP_002965935.1|  hypothetical protein SELMODRAFT_167756             152   2e-39   
gb|KDO84973.1|  hypothetical protein CISIN_1g013411mg                   149   8e-39   Citrus sinensis [apfelsine]
ref|XP_010100117.1|  Hippocampus abundant transcript 1 protein          149   1e-38   
ref|XP_006435264.1|  hypothetical protein CICLE_v10001166mg             149   1e-38   Citrus clementina [clementine]
ref|XP_010032089.1|  PREDICTED: hippocampus abundant transcript-l...    149   1e-38   
gb|KJB14351.1|  hypothetical protein B456_002G120900                    149   2e-38   Gossypium raimondii
gb|KJB14354.1|  hypothetical protein B456_002G120900                    149   3e-38   Gossypium raimondii
ref|XP_009767684.1|  PREDICTED: uncharacterized protein LOC104218795    147   4e-38   Nicotiana sylvestris
ref|XP_004983780.1|  PREDICTED: hippocampus abundant transcript 1...    146   4e-38   
ref|XP_008791950.1|  PREDICTED: hippocampus abundant transcript-l...    147   4e-38   Phoenix dactylifera
ref|XP_002465000.1|  hypothetical protein SORBIDRAFT_01g030220          147   7e-38   Sorghum bicolor [broomcorn]
gb|KJB58030.1|  hypothetical protein B456_009G190900                    145   1e-37   Gossypium raimondii
ref|XP_006386158.1|  hypothetical protein POPTR_0002s01760g             147   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004983779.1|  PREDICTED: hippocampus abundant transcript 1...    146   1e-37   Setaria italica
gb|KDO68188.1|  hypothetical protein CISIN_1g011514mg                   143   1e-37   Citrus sinensis [apfelsine]
gb|EMT05362.1|  Hippocampus abundant transcript 1 protein               146   1e-37   
gb|KHG11074.1|  Hippocampus abundant transcript 1                       146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_004238394.1|  PREDICTED: uncharacterized protein LOC101248671    146   2e-37   Solanum lycopersicum
ref|XP_010061116.1|  PREDICTED: hippocampus abundant transcript-l...    146   2e-37   Eucalyptus grandis [rose gum]
gb|KJB58029.1|  hypothetical protein B456_009G190900                    146   2e-37   Gossypium raimondii
ref|XP_008236069.1|  PREDICTED: hippocampus abundant transcript-l...    145   3e-37   Prunus mume [ume]
ref|XP_011034951.1|  PREDICTED: uncharacterized protein LOC105132...    145   3e-37   Populus euphratica
ref|XP_006342087.1|  PREDICTED: hippocampus abundant transcript-l...    145   3e-37   Solanum tuberosum [potatoes]
ref|XP_011034952.1|  PREDICTED: uncharacterized protein LOC105132...    145   5e-37   Populus euphratica
ref|XP_010266910.1|  PREDICTED: hippocampus abundant transcript 1...    145   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002510601.1|  tetracycline transporter, putative                 144   6e-37   Ricinus communis
gb|KDO68187.1|  hypothetical protein CISIN_1g011514mg                   143   7e-37   Citrus sinensis [apfelsine]
ref|XP_002280708.1|  PREDICTED: hippocampus abundant transcript-l...    144   7e-37   Vitis vinifera
ref|XP_007201037.1|  hypothetical protein PRUPE_ppa005784mg             144   7e-37   Prunus persica
ref|XP_011046630.1|  PREDICTED: hippocampus abundant transcript-l...    144   8e-37   Populus euphratica
ref|XP_010032087.1|  PREDICTED: hippocampus abundant transcript-l...    143   8e-37   
ref|XP_009620054.1|  PREDICTED: uncharacterized protein LOC104111941    144   8e-37   Nicotiana tomentosiformis
ref|XP_010690317.1|  PREDICTED: hippocampus abundant transcript 1...    144   1e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37985.1|  hypothetical protein MIMGU_mgv1a006613mg                144   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_006486682.1|  PREDICTED: hippocampus abundant transcript 1...    143   1e-36   
ref|XP_007017915.1|  Major facilitator superfamily protein isoform 1    144   2e-36   
tpg|DAA46149.1|  TPA: hypothetical protein ZEAMMB73_581598              142   2e-36   
ref|XP_002313691.1|  hypothetical protein POPTR_0009s14090g             143   2e-36   Populus trichocarpa [western balsam poplar]
gb|EYU37986.1|  hypothetical protein MIMGU_mgv1a006358mg                143   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_006486681.1|  PREDICTED: hippocampus abundant transcript 1...    143   2e-36   Citrus sinensis [apfelsine]
ref|XP_010086842.1|  Hippocampus abundant transcript 1 protein          143   2e-36   
ref|XP_006655183.1|  PREDICTED: hippocampus abundant transcript 1...    143   2e-36   
ref|XP_009802649.1|  PREDICTED: hippocampus abundant transcript-l...    143   2e-36   Nicotiana sylvestris
ref|XP_002306959.1|  hypothetical protein POPTR_0005s26720g             142   3e-36   Populus trichocarpa [western balsam poplar]
gb|KDO68186.1|  hypothetical protein CISIN_1g011514mg                   142   3e-36   Citrus sinensis [apfelsine]
gb|KDO68183.1|  hypothetical protein CISIN_1g011514mg                   143   4e-36   Citrus sinensis [apfelsine]
gb|KDP36870.1|  hypothetical protein JCGZ_08161                         142   4e-36   Jatropha curcas
ref|XP_006422528.1|  hypothetical protein CICLE_v10028321mg             142   4e-36   Citrus clementina [clementine]
ref|NP_001130498.1|  tetracycline transporter protein                   142   4e-36   Zea mays [maize]
ref|XP_007017916.1|  Major facilitator superfamily protein isoform 2    142   4e-36   Theobroma cacao [chocolate]
ref|XP_007017917.1|  Major facilitator superfamily protein isoform 3    142   4e-36   
ref|XP_012073718.1|  PREDICTED: hippocampus abundant transcript-l...    142   5e-36   Jatropha curcas
ref|XP_011088646.1|  PREDICTED: hippocampus abundant transcript 1...    142   5e-36   Sesamum indicum [beniseed]
ref|XP_012077708.1|  PREDICTED: hippocampus abundant transcript-l...    142   5e-36   
gb|KJB32680.1|  hypothetical protein B456_005G255500                    142   6e-36   Gossypium raimondii
ref|XP_006422527.1|  hypothetical protein CICLE_v10028321mg             142   7e-36   
emb|CAN64703.1|  hypothetical protein VITISV_038996                     141   7e-36   Vitis vinifera
tpg|DAA46150.1|  TPA: hypothetical protein ZEAMMB73_581598              141   7e-36   
gb|KCW51478.1|  hypothetical protein EUGRSUZ_J00997                     140   8e-36   Eucalyptus grandis [rose gum]
ref|XP_002284761.1|  PREDICTED: hippocampus abundant transcript 1...    141   8e-36   Vitis vinifera
ref|XP_012077706.1|  PREDICTED: hippocampus abundant transcript-l...    141   9e-36   Jatropha curcas
gb|KHG18467.1|  Hippocampus abundant transcript 1                       141   9e-36   Gossypium arboreum [tree cotton]
ref|XP_011045660.1|  PREDICTED: hippocampus abundant transcript-l...    141   1e-35   Populus euphratica
ref|XP_011045668.1|  PREDICTED: hippocampus abundant transcript-l...    140   1e-35   Populus euphratica
ref|XP_004290751.1|  PREDICTED: uncharacterized protein LOC101295...    141   1e-35   Fragaria vesca subsp. vesca
ref|XP_010943478.1|  PREDICTED: hippocampus abundant transcript 1...    140   2e-35   Elaeis guineensis
ref|XP_010028772.1|  PREDICTED: uncharacterized protein LOC104418982    140   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007136127.1|  hypothetical protein PHAVU_009G020100g             140   2e-35   Phaseolus vulgaris [French bean]
gb|EYU40457.1|  hypothetical protein MIMGU_mgv1a021568mg                140   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_009776326.1|  PREDICTED: solute carrier family 46 member 3...    140   2e-35   Nicotiana sylvestris
ref|XP_009775454.1|  PREDICTED: hippocampus abundant transcript 1...    140   2e-35   Nicotiana sylvestris
ref|XP_009624104.1|  PREDICTED: solute carrier family 46 member 3...    140   2e-35   Nicotiana tomentosiformis
ref|XP_008382447.1|  PREDICTED: hippocampus abundant transcript 1...    140   3e-35   
ref|XP_004248636.1|  PREDICTED: hippocampus abundant transcript-l...    140   3e-35   Solanum lycopersicum
ref|XP_009588093.1|  PREDICTED: hippocampus abundant transcript-l...    140   3e-35   Nicotiana tomentosiformis
gb|KJB15873.1|  hypothetical protein B456_002G200900                    140   4e-35   Gossypium raimondii
ref|XP_009588092.1|  PREDICTED: hippocampus abundant transcript-l...    139   4e-35   
ref|XP_009355593.1|  PREDICTED: hippocampus abundant transcript 1...    139   4e-35   Pyrus x bretschneideri [bai li]
gb|KCW55587.1|  hypothetical protein EUGRSUZ_I01458                     140   4e-35   Eucalyptus grandis [rose gum]
ref|XP_009124111.1|  PREDICTED: hippocampus abundant transcript-l...    139   5e-35   Brassica rapa
gb|KHN20137.1|  Hippocampus abundant transcript-like protein 1          139   5e-35   Glycine soja [wild soybean]
ref|XP_006342707.1|  PREDICTED: hippocampus abundant transcript-l...    139   6e-35   Solanum tuberosum [potatoes]
ref|XP_009124113.1|  PREDICTED: hippocampus abundant transcript-l...    139   6e-35   Brassica rapa
emb|CDY02382.1|  BnaA02g22910D                                          139   6e-35   
ref|XP_003527649.1|  PREDICTED: hippocampus abundant transcript-l...    139   6e-35   Glycine max [soybeans]
gb|KDO68185.1|  hypothetical protein CISIN_1g011514mg                   139   7e-35   Citrus sinensis [apfelsine]
ref|XP_004500910.1|  PREDICTED: hippocampus abundant transcript-l...    138   7e-35   
ref|XP_010061115.1|  PREDICTED: hippocampus abundant transcript-l...    139   8e-35   Eucalyptus grandis [rose gum]
emb|CDP07341.1|  unnamed protein product                                138   1e-34   Coffea canephora [robusta coffee]
ref|XP_009400334.1|  PREDICTED: hippocampus abundant transcript-l...    138   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012077712.1|  PREDICTED: hippocampus abundant transcript-l...    138   1e-34   
ref|XP_012077711.1|  PREDICTED: hippocampus abundant transcript-l...    138   1e-34   Jatropha curcas
ref|XP_012077709.1|  PREDICTED: hippocampus abundant transcript-l...    138   2e-34   
ref|XP_004500908.1|  PREDICTED: hippocampus abundant transcript-l...    138   2e-34   
ref|XP_011458698.1|  PREDICTED: uncharacterized protein LOC101306...    137   2e-34   Fragaria vesca subsp. vesca
ref|XP_004500906.1|  PREDICTED: hippocampus abundant transcript-l...    138   2e-34   
ref|XP_004291324.1|  PREDICTED: uncharacterized protein LOC101296167    137   2e-34   Fragaria vesca subsp. vesca
ref|XP_011458697.1|  PREDICTED: uncharacterized protein LOC101306...    137   2e-34   Fragaria vesca subsp. vesca
ref|XP_009783818.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-34   Nicotiana sylvestris
gb|KJB32681.1|  hypothetical protein B456_005G255500                    137   3e-34   Gossypium raimondii
ref|XP_004292638.2|  PREDICTED: uncharacterized protein LOC101306...    137   3e-34   Fragaria vesca subsp. vesca
ref|XP_011088647.1|  PREDICTED: hippocampus abundant transcript 1...    137   3e-34   Sesamum indicum [beniseed]
ref|XP_011003093.1|  PREDICTED: uncharacterized protein LOC105109921    137   4e-34   Populus euphratica
gb|AES74091.2|  MFS transporter                                         136   5e-34   Medicago truncatula
ref|XP_006360887.1|  PREDICTED: hippocampus abundant transcript-l...    136   5e-34   Solanum tuberosum [potatoes]
emb|CAN70291.1|  hypothetical protein VITISV_019346                     137   5e-34   Vitis vinifera
ref|XP_009783817.1|  PREDICTED: hippocampus abundant transcript 1...    135   5e-34   Nicotiana sylvestris
ref|XP_004253206.1|  PREDICTED: uncharacterized protein LOC101250386    136   6e-34   Solanum lycopersicum
ref|XP_010539088.1|  PREDICTED: hippocampus abundant transcript-l...    135   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010539087.1|  PREDICTED: hippocampus abundant transcript-l...    135   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010327393.1|  PREDICTED: uncharacterized protein LOC101267...    135   1e-33   
ref|XP_009783816.1|  PREDICTED: hippocampus abundant transcript-l...    135   1e-33   Nicotiana sylvestris
gb|EEE63183.1|  hypothetical protein OsJ_17992                          135   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009783815.1|  PREDICTED: hippocampus abundant transcript 1...    135   1e-33   Nicotiana sylvestris
gb|EEC78948.1|  hypothetical protein OsI_19397                          134   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_003523261.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   Glycine max [soybeans]
ref|XP_010494158.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   
ref|XP_010315398.1|  PREDICTED: hippocampus abundant transcript-l...    134   2e-33   Solanum lycopersicum
ref|XP_010494156.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   
ref|XP_010494157.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010494154.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010315397.1|  PREDICTED: hippocampus abundant transcript-l...    134   2e-33   
ref|XP_002301947.2|  hypothetical protein POPTR_0002s01760g             135   2e-33   
ref|XP_010315396.1|  PREDICTED: hippocampus abundant transcript-l...    134   2e-33   
gb|KGN62272.1|  hypothetical protein Csa_2G347110                       134   3e-33   Cucumis sativus [cucumbers]
ref|XP_003535759.1|  PREDICTED: hippocampus abundant transcript 1...    134   3e-33   Glycine max [soybeans]
ref|XP_003555206.1|  PREDICTED: hippocampus abundant transcript 1...    134   3e-33   Glycine max [soybeans]
ref|XP_004231065.1|  PREDICTED: hippocampus abundant transcript-l...    133   3e-33   Solanum lycopersicum
ref|XP_011649471.1|  PREDICTED: hippocampus abundant transcript 1...    134   3e-33   Cucumis sativus [cucumbers]
gb|EYU37987.1|  hypothetical protein MIMGU_mgv1a019548mg                134   4e-33   Erythranthe guttata [common monkey flower]
gb|KFK32943.1|  hypothetical protein AALP_AA6G309500                    134   4e-33   Arabis alpina [alpine rockcress]
ref|XP_011649470.1|  PREDICTED: hippocampus abundant transcript 1...    134   4e-33   Cucumis sativus [cucumbers]
ref|XP_008445314.1|  PREDICTED: hippocampus abundant transcript-l...    134   5e-33   Cucumis melo [Oriental melon]
gb|KEH44396.1|  MFS transporter                                         132   6e-33   Medicago truncatula
ref|XP_006280482.1|  hypothetical protein CARUB_v10026419mg             133   6e-33   Capsella rubella
ref|XP_009617454.1|  PREDICTED: hippocampus abundant transcript 1...    132   7e-33   
ref|XP_007142795.1|  hypothetical protein PHAVU_007G017500g             133   9e-33   Phaseolus vulgaris [French bean]
ref|XP_003570066.1|  PREDICTED: hippocampus abundant transcript 1...    132   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_004497200.1|  PREDICTED: hippocampus abundant transcript 1...    132   1e-32   Cicer arietinum [garbanzo]
dbj|BAF00568.1|  hypothetical protein                                   127   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617453.1|  PREDICTED: hippocampus abundant transcript 1...    132   1e-32   Nicotiana tomentosiformis
ref|XP_009617452.1|  PREDICTED: hippocampus abundant transcript 1...    132   2e-32   
gb|KEH44397.1|  MFS transporter                                         132   2e-32   Medicago truncatula
gb|KEH44398.1|  MFS transporter                                         132   2e-32   Medicago truncatula
ref|XP_007222153.1|  hypothetical protein PRUPE_ppa005755mg             132   2e-32   
ref|XP_008221200.1|  PREDICTED: hippocampus abundant transcript 1...    132   2e-32   Prunus mume [ume]
ref|XP_004242975.1|  PREDICTED: hippocampus abundant transcript-l...    132   2e-32   
gb|EYU37988.1|  hypothetical protein MIMGU_mgv1a006415mg                132   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_008445313.1|  PREDICTED: hippocampus abundant transcript 1...    132   2e-32   Cucumis melo [Oriental melon]
ref|XP_004144923.1|  PREDICTED: hippocampus abundant transcript-l...    132   2e-32   Cucumis sativus [cucumbers]
gb|EMT20897.1|  Hippocampus abundant transcript 1 protein               132   2e-32   
ref|XP_006364509.1|  PREDICTED: hippocampus abundant transcript-l...    132   2e-32   Solanum tuberosum [potatoes]
ref|XP_010442182.1|  PREDICTED: hippocampus abundant transcript-l...    132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010918154.1|  PREDICTED: uncharacterized protein LOC105042...    130   3e-32   
ref|XP_008447922.1|  PREDICTED: hippocampus abundant transcript-l...    130   3e-32   
ref|XP_008447923.1|  PREDICTED: hippocampus abundant transcript-l...    130   4e-32   
gb|EPS73404.1|  hypothetical protein M569_01349                         131   4e-32   Genlisea aurea
ref|XP_008447920.1|  PREDICTED: hippocampus abundant transcript 1...    131   5e-32   Cucumis melo [Oriental melon]
ref|XP_010918152.1|  PREDICTED: hippocampus abundant transcript-l...    130   9e-32   Elaeis guineensis
ref|XP_004142991.1|  PREDICTED: hippocampus abundant transcript 1...    130   1e-31   Cucumis sativus [cucumbers]
gb|KGN62271.1|  hypothetical protein Csa_2G347100                       129   1e-31   Cucumis sativus [cucumbers]
ref|XP_007041738.1|  Major facilitator superfamily protein, putat...    130   1e-31   
ref|XP_007041737.1|  Major facilitator superfamily protein, putat...    129   1e-31   
ref|XP_010482014.1|  PREDICTED: hippocampus abundant transcript 1...    129   2e-31   
ref|XP_010482011.1|  PREDICTED: hippocampus abundant transcript 1...    129   2e-31   
ref|XP_010482015.1|  PREDICTED: hippocampus abundant transcript 1...    129   2e-31   
ref|XP_008445315.1|  PREDICTED: hippocampus abundant transcript-l...    128   5e-31   Cucumis melo [Oriental melon]
ref|XP_004500907.1|  PREDICTED: hippocampus abundant transcript-l...    127   7e-31   
ref|XP_008387898.1|  PREDICTED: hippocampus abundant transcript 1...    127   1e-30   Malus domestica [apple tree]
ref|XP_003603840.1|  Hippocampus abundant transcript-like protein       126   2e-30   
ref|XP_002454504.1|  hypothetical protein SORBIDRAFT_04g032320          126   2e-30   Sorghum bicolor [broomcorn]
ref|XP_006409366.1|  hypothetical protein EUTSA_v10022689mg             126   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_004953398.1|  PREDICTED: hippocampus abundant transcript 1...    126   3e-30   Setaria italica
ref|XP_002865555.1|  hypothetical protein ARALYDRAFT_331182             125   3e-30   
ref|XP_009124108.1|  PREDICTED: hippocampus abundant transcript-l...    125   4e-30   
ref|XP_009334544.1|  PREDICTED: uncharacterized protein LOC103927348    125   5e-30   
ref|XP_008668533.1|  PREDICTED: tetracycline transporter protein ...    125   1e-29   
tpg|DAA46148.1|  TPA: hypothetical protein ZEAMMB73_581598              124   1e-29   
gb|AFW72716.1|  hypothetical protein ZEAMMB73_747947                    124   2e-29   
ref|NP_001144256.1|  uncharacterized protein LOC100277128 precursor     124   2e-29   Zea mays [maize]
gb|AFW72717.1|  hypothetical protein ZEAMMB73_747947                    123   3e-29   
ref|XP_011083420.1|  PREDICTED: hippocampus abundant transcript 1...    123   3e-29   Sesamum indicum [beniseed]
ref|XP_006362772.1|  PREDICTED: uncharacterized protein LOC102586357    121   4e-29   
ref|XP_010548123.1|  PREDICTED: uncharacterized protein LOC104819660    122   4e-29   Tarenaya hassleriana [spider flower]
gb|ERM96250.1|  hypothetical protein AMTR_s00001p00145830               119   8e-29   
gb|KJB47710.1|  hypothetical protein B456_008G037600                    119   6e-28   
gb|KJB47711.1|  hypothetical protein B456_008G037600                    119   7e-28   
ref|XP_006409365.1|  hypothetical protein EUTSA_v10022688mg             118   7e-28   
ref|XP_011628920.1|  PREDICTED: uncharacterized protein LOC184241...    119   7e-28   
gb|KJB47709.1|  hypothetical protein B456_008G037600                    119   7e-28   
ref|XP_011628919.1|  PREDICTED: hippocampus abundant transcript 1...    119   8e-28   
ref|XP_006409364.1|  hypothetical protein EUTSA_v10022688mg             119   9e-28   
gb|KHG05703.1|  Hippocampus abundant transcript-like protein 1          118   1e-27   
gb|EYU17555.1|  hypothetical protein MIMGU_mgv1a006533mg                118   1e-27   
ref|XP_006297712.1|  hypothetical protein CARUB_v10013741mg             117   3e-27   
ref|XP_002305536.2|  hypothetical protein POPTR_0004s18510g             116   4e-27   
ref|NP_179290.3|  major facilitator protein                             116   7e-27   
gb|AAQ22617.1|  At2g16980                                               116   8e-27   
dbj|BAF00204.1|  putative tetracycline transporter protein              116   9e-27   
ref|NP_973476.1|  major facilitator protein                             116   9e-27   
ref|XP_002884027.1|  hypothetical protein ARALYDRAFT_480580             116   1e-26   
ref|XP_006648918.1|  PREDICTED: hippocampus abundant transcript 1...    115   2e-26   
ref|XP_006299476.1|  hypothetical protein CARUB_v10015641mg             114   3e-26   
ref|XP_010489313.1|  PREDICTED: uncharacterized protein LOC104767002    114   5e-26   
ref|XP_009136357.1|  PREDICTED: uncharacterized protein LOC103860...    113   6e-26   
emb|CDY31390.1|  BnaA07g03250D                                          113   6e-26   
gb|EAY87003.1|  hypothetical protein OsI_08398                          113   7e-26   
ref|XP_009121172.1|  PREDICTED: uncharacterized protein LOC103846...    113   7e-26   
ref|XP_010490360.1|  PREDICTED: uncharacterized protein LOC104768128    113   8e-26   
ref|XP_009121173.1|  PREDICTED: uncharacterized protein LOC103846...    113   8e-26   
ref|XP_010467437.1|  PREDICTED: uncharacterized protein LOC104747497    113   1e-25   
ref|XP_009136349.1|  PREDICTED: uncharacterized protein LOC103860...    113   1e-25   
ref|XP_010515798.1|  PREDICTED: uncharacterized protein LOC104791...    112   1e-25   
ref|XP_009112409.1|  PREDICTED: hippocampus abundant transcript 1...    112   1e-25   
ref|XP_010515782.1|  PREDICTED: uncharacterized protein LOC104791...    112   1e-25   
ref|XP_010467432.1|  PREDICTED: uncharacterized protein LOC104747...    112   2e-25   
ref|XP_006297657.1|  hypothetical protein CARUB_v10013679mg             112   2e-25   
ref|XP_010467440.1|  PREDICTED: uncharacterized protein LOC104747...    112   2e-25   
ref|XP_010467439.1|  PREDICTED: uncharacterized protein LOC104747...    112   2e-25   
ref|XP_010467438.1|  PREDICTED: uncharacterized protein LOC104747...    112   2e-25   
ref|XP_002884030.1|  tetracycline transporter                           111   3e-25   
ref|XP_010467449.1|  PREDICTED: uncharacterized protein LOC104747...    110   5e-25   
ref|XP_002884029.1|  predicted protein                                  110   6e-25   
ref|XP_010467445.1|  PREDICTED: uncharacterized protein LOC104747...    110   7e-25   
gb|KFK40087.1|  hypothetical protein AALP_AA3G328800                    112   1e-24   
gb|KFK40086.1|  hypothetical protein AALP_AA3G328800                    112   1e-24   
ref|XP_010467436.1|  PREDICTED: uncharacterized protein LOC104747...    109   1e-24   
ref|XP_010467435.1|  PREDICTED: uncharacterized protein LOC104747...    110   1e-24   
ref|XP_011458696.1|  PREDICTED: uncharacterized protein LOC101295...    108   2e-24   
ref|XP_010515842.1|  PREDICTED: hippocampus abundant transcript 1...    108   4e-24   
gb|KHN37382.1|  Hippocampus abundant transcript 1 protein               108   5e-24   
gb|EMS58246.1|  Tetracycline resistance protein, class A                108   9e-24   
ref|NP_179291.2|  major facilitator protein                             107   1e-23   
ref|XP_010467430.1|  PREDICTED: uncharacterized protein LOC104747...    107   2e-23   
gb|KJB32683.1|  hypothetical protein B456_005G255500                    105   2e-23   
dbj|BAJ86597.1|  predicted protein                                      104   1e-22   
ref|XP_010515758.1|  PREDICTED: uncharacterized protein LOC104791538    103   2e-22   
ref|XP_010489311.1|  PREDICTED: uncharacterized protein LOC104767...    103   2e-22   
gb|KCW68015.1|  hypothetical protein EUGRSUZ_F01701                     102   7e-22   
ref|XP_004500909.1|  PREDICTED: hippocampus abundant transcript-l...    101   2e-21   
gb|KGN62273.1|  hypothetical protein Csa_2G347120                     95.9    4e-21   
ref|XP_002865559.1|  hypothetical protein ARALYDRAFT_917584           95.9    5e-21   
ref|XP_008347370.1|  PREDICTED: hippocampus abundant transcript 1...  99.0    8e-21   
ref|XP_011088648.1|  PREDICTED: hippocampus abundant transcript-l...  98.2    1e-20   
ref|XP_008357148.1|  PREDICTED: hippocampus abundant transcript 1...  99.0    2e-20   
gb|AAM15009.1|  putative tetracycline transporter protein             93.6    7e-19   
ref|XP_009802650.1|  PREDICTED: hippocampus abundant transcript-l...  92.8    1e-18   
ref|XP_010918153.1|  PREDICTED: hippocampus abundant transcript-l...  92.8    1e-18   
emb|CDY02224.1|  BnaA03g39430D                                        92.0    3e-18   
gb|AAC64231.1|  putative tetracycline transporter protein             88.6    4e-17   
ref|NP_179289.4|  tetracycline transporter-like protein 1             88.6    6e-17   
ref|XP_009136351.1|  PREDICTED: uncharacterized protein LOC103860...  86.7    2e-16   
ref|XP_009136350.1|  PREDICTED: uncharacterized protein LOC103860...  86.7    2e-16   
ref|XP_006299583.1|  hypothetical protein CARUB_v10015760mg           85.9    5e-16   
ref|XP_010467434.1|  PREDICTED: uncharacterized protein LOC104747...  84.3    1e-15   
ref|XP_010515790.1|  PREDICTED: uncharacterized protein LOC104791...  83.6    3e-15   
ref|XP_009112410.1|  PREDICTED: hippocampus abundant transcript 1...  82.8    5e-15   
gb|EEE57537.1|  hypothetical protein OsJ_07859                        82.4    6e-15   
ref|XP_009121174.1|  PREDICTED: uncharacterized protein LOC103846...  82.0    1e-14   
ref|XP_009407351.1|  PREDICTED: uncharacterized protein LOC103990...  81.3    1e-14   
ref|XP_009124112.1|  PREDICTED: hippocampus abundant transcript-l...  76.6    5e-13   
ref|XP_004452323.1|  PREDICTED: hippocampus abundant transcript-l...  76.6    1e-12   
ref|XP_012014527.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_011985150.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_007529249.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_011985157.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
gb|EAW92610.1|  hippocampus abundant transcript-like 1, isoform C...  72.4    2e-12   
ref|XP_011985143.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_012014520.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_011985134.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    2e-12   
ref|XP_005977372.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    3e-12   
ref|XP_011985116.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    3e-12   
ref|XP_003468440.1|  PREDICTED: hippocampus abundant transcript-l...  75.5    3e-12   
ref|XP_012014521.1|  PREDICTED: hippocampus abundant transcript-l...  75.1    3e-12   
ref|XP_004004514.1|  PREDICTED: hippocampus abundant transcript-l...  75.1    3e-12   
ref|XP_005683559.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  75.1    3e-12   
ref|XP_003795084.1|  PREDICTED: hippocampus abundant transcript-l...  74.7    4e-12   
ref|XP_006140634.1|  PREDICTED: hippocampus abundant transcript-l...  74.3    5e-12   
ref|XP_006922852.1|  PREDICTED: hippocampus abundant transcript-l...  73.9    6e-12   
ref|XP_010467431.1|  PREDICTED: uncharacterized protein LOC104747...  73.9    6e-12   
ref|XP_004442775.1|  PREDICTED: hippocampus abundant transcript-l...  74.3    6e-12   
gb|ELU06448.1|  hypothetical protein CAPTEDRAFT_182946                73.9    6e-12   
ref|XP_011377272.1|  PREDICTED: hippocampus abundant transcript-l...  73.9    7e-12   
ref|XP_008991417.1|  PREDICTED: hippocampus abundant transcript-l...  73.6    7e-12   
ref|XP_005385035.1|  PREDICTED: hippocampus abundant transcript-l...  73.9    7e-12   
gb|AAH33469.1|  Hippocampus abundant transcript-like 1                73.9    7e-12   
gb|ELK03383.1|  Hippocampus abundant transcript-like protein 1        73.9    7e-12   
ref|XP_006922851.1|  PREDICTED: hippocampus abundant transcript-l...  73.9    7e-12   
ref|NP_598441.3|  hippocampus abundant transcript-like protein 1      73.9    7e-12   
dbj|BAG62308.1|  unnamed protein product                              72.8    7e-12   
ref|XP_008053481.1|  PREDICTED: hippocampus abundant transcript-l...  73.6    8e-12   
ref|XP_006717368.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    1e-11   
ref|XP_010851096.1|  PREDICTED: hippocampus abundant transcript-l...  73.2    1e-11   
tpg|DAA27103.1|  TPA: hippocampus abundant transcript-like 1          73.2    1e-11   
ref|XP_010851095.1|  PREDICTED: hippocampus abundant transcript-l...  73.2    1e-11   
gb|ELR58660.1|  Hippocampus abundant transcript-like protein 1        73.2    1e-11   
ref|XP_008155111.1|  PREDICTED: hippocampus abundant transcript-l...  73.2    1e-11   
ref|XP_006047602.1|  PREDICTED: hippocampus abundant transcript-l...  73.2    1e-11   
ref|NP_001077131.1|  hippocampus abundant transcript-like protein 1   73.2    2e-11   
ref|XP_005892617.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
ref|XP_007968012.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
gb|EAW92612.1|  hippocampus abundant transcript-like 1, isoform C...  72.4    2e-11   
ref|XP_010609262.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
ref|XP_011901002.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
gb|EAW92611.1|  hippocampus abundant transcript-like 1, isoform C...  72.4    2e-11   
ref|XP_008179803.1|  PREDICTED: hippocampus abundant transcript 1...  72.8    2e-11   
ref|XP_010373435.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_011854827.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_003912052.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  72.8    2e-11   
ref|XP_011517416.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|NP_001230329.1|  hippocampus abundant transcript-like protein 1   72.8    2e-11   
ref|XP_003260560.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
ref|NP_001181213.1|  hippocampus abundant transcript-like protein 1   72.8    2e-11   
ref|XP_004803163.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_002708269.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
ref|XP_011769576.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
gb|EHH57523.1|  Hippocampus abundant transcript-like protein 1        72.4    2e-11   
ref|XP_008689077.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_003938256.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_009455214.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_002820022.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|NP_115947.2|  hippocampus abundant transcript-like protein 1      72.4    2e-11   
gb|EHH24288.1|  Hippocampus abundant transcript-like protein 1        72.4    2e-11   
gb|AAI06063.1|  Hippocampus abundant transcript-like 1                72.4    2e-11   
ref|XP_005582340.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_004766222.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_009043957.1|  hypothetical protein LOTGIDRAFT_228011           72.4    2e-11   
ref|XP_006900786.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
gb|KIH49189.1|  hypothetical protein ANCDUO_20737                     68.9    2e-11   
ref|XP_004685105.1|  PREDICTED: hippocampus abundant transcript-l...  72.8    2e-11   
ref|XP_008255027.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_011782873.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_005616057.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_003995350.2|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_011769574.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_006742552.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_004393640.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_004048342.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  72.4    2e-11   
ref|XP_007182460.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    3e-11   
ref|XP_533564.3|  PREDICTED: hippocampus abundant transcript-like...  72.4    3e-11   
ref|XP_007182462.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    3e-11   
ref|XP_009036070.1|  hypothetical protein AURANDRAFT_37260            69.7    3e-11   
ref|XP_008848913.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  72.4    3e-11   
ref|XP_007462843.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    3e-11   
ref|XP_004876777.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    3e-11   
ref|XP_004276872.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    3e-11   
ref|XP_004322713.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  72.0    3e-11   
ref|XP_005321186.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    4e-11   
ref|XP_004656580.1|  PREDICTED: hippocampus abundant transcript-l...  72.0    4e-11   
ref|XP_007097412.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  71.6    4e-11   
ref|XP_007122354.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  72.0    4e-11   
ref|XP_008534891.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    4e-11   
ref|XP_006209272.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    4e-11   
ref|XP_006102258.1|  PREDICTED: hippocampus abundant transcript-l...  71.2    4e-11   
ref|XP_004643895.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    4e-11   
ref|XP_005881715.1|  PREDICTED: hippocampus abundant transcript-l...  71.2    4e-11   
ref|XP_005605172.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    5e-11   
ref|XP_003493666.1|  PREDICTED: hippocampus abundant transcript 1...  71.6    5e-11   
gb|EPQ17285.1|  Hippocampus abundant transcript-like protein 1        71.2    5e-11   
ref|XP_004591912.1|  PREDICTED: hippocampus abundant transcript-l...  71.2    5e-11   
ref|XP_003493667.1|  PREDICTED: hippocampus abundant transcript 1...  71.6    5e-11   
ref|XP_004384271.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    5e-11   
ref|XP_010960080.1|  PREDICTED: hippocampus abundant transcript-l...  68.9    5e-11   
ref|XP_004620186.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    5e-11   
ref|XP_624637.2|  PREDICTED: hippocampus abundant transcript 1 pr...  70.9    7e-11   
ref|XP_003695969.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    7e-11   
ref|XP_012136320.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    7e-11   
ref|XP_006560033.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    7e-11   
ref|XP_012136323.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|NP_001100804.1|  hippocampus abundant transcript-like protein 1   70.9    8e-11   
ref|XP_012136319.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_010598957.1|  PREDICTED: hippocampus abundant transcript-l...  70.9    8e-11   
ref|XP_006560034.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_006560036.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_006560035.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_012136321.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_012136325.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    8e-11   
ref|XP_012136322.1|  PREDICTED: hippocampus abundant transcript 1...  70.9    9e-11   
ref|XP_005371711.1|  PREDICTED: hippocampus abundant transcript-l...  70.9    9e-11   
ref|XP_007951192.1|  PREDICTED: hippocampus abundant transcript-l...  70.5    9e-11   
ref|XP_007609087.1|  PREDICTED: hippocampus abundant transcript-l...  70.5    1e-10   
ref|XP_011499344.1|  PREDICTED: hippocampus abundant transcript 1...  70.5    1e-10   
gb|ERE78691.1|  hippocampus abundant transcript-like protein 1        70.5    1e-10   
ref|XP_003401551.1|  PREDICTED: hippocampus abundant transcript 1...  70.5    1e-10   
ref|XP_005078505.1|  PREDICTED: hippocampus abundant transcript-l...  70.5    1e-10   
emb|CBY24621.1|  unnamed protein product                              70.5    1e-10   
ref|XP_003401552.1|  PREDICTED: hippocampus abundant transcript 1...  70.5    1e-10   
ref|XP_009010528.1|  hypothetical protein HELRODRAFT_194830           70.5    1e-10   
ref|XP_008202704.1|  PREDICTED: hippocampus abundant transcript 1...  70.5    1e-10   
ref|XP_008202705.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
gb|EWM30276.1|  hippocampus abundant transcript 1                     70.1    1e-10   
ref|XP_003425499.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_008202703.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_003425498.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_008202701.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_004713979.1|  PREDICTED: hippocampus abundant transcript-l...  70.5    1e-10   
ref|XP_005110458.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_001604922.2|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_007652260.1|  PREDICTED: hippocampus abundant transcript-l...  70.1    1e-10   
ref|XP_008591367.1|  PREDICTED: hippocampus abundant transcript-l...  69.7    1e-10   
ref|XP_011871216.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    1e-10   
ref|XP_011871217.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    2e-10   
ref|XP_011871218.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    2e-10   
emb|CDY12985.1|  BnaC02g29920D                                        69.7    2e-10   
ref|XP_011871215.1|  PREDICTED: hippocampus abundant transcript 1...  70.1    2e-10   



>ref|XP_011076924.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Sesamum indicum]
Length=436

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTTNALC G  +C +AIYING+QQTVVGIFKM+VLP+LGQL+D++GR
Sbjct  18   WIAEEMTVSVLVDVTTNALCPGHKTCPQAIYINGIQQTVVGIFKMIVLPLLGQLADEHGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI+PFTLLAIN+S+  +YAYYVLRTISYIISQGSIFCISVAYAADV+++ 
Sbjct  78   KPLLLITVSTTIVPFTLLAINQSKASIYAYYVLRTISYIISQGSIFCISVAYAADVIDDD  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAAAFSWITG FSASHV+G++LARFLPEDYIF VSI LLIFVP+YM L L ETV+P
Sbjct  138  KRAAAFSWITGLFSASHVLGNILARFLPEDYIFAVSIALLIFVPIYMSLFLTETVRP  194



>ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=441

 Score =   298 bits (763),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G S+CSEAIYING+QQTVVGIFKM+VLP+LGQLSD+YGR
Sbjct  23   WIAEEMTVSVLVDVTTSALCPGNSTCSEAIYINGVQQTVVGIFKMLVLPILGQLSDEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+STTIIPF LL INKS+GFVYAYYVLRTISYIISQGSIFCISVAYAADVV+ES
Sbjct  83   KPLLLLTISTTIIPFGLLTINKSKGFVYAYYVLRTISYIISQGSIFCISVAYAADVVDES  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            +RAA FSWITG FSASHV+G++LARFLP  YIF VSI LLIFVP+YM L L ETV P
Sbjct  143  SRAAVFSWITGLFSASHVMGNVLARFLPVGYIFQVSIGLLIFVPIYMILFLEETVSP  199



>ref|XP_002266084.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI35249.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC G S+C+E IYINGLQQTVVGIFKMVVLPVLGQL+D+YGR
Sbjct  17   WIAEEMTVSVLVDVTTAALCSGASTCAEVIYINGLQQTVVGIFKMVVLPVLGQLADEYGR  76

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLL+VTVST+I PF +LA NKS+GFVYAYYVLRT+SYI+SQGSIFCISVAY ADVVE+S
Sbjct  77   KPLLMVTVSTSIFPFAVLAWNKSKGFVYAYYVLRTVSYILSQGSIFCISVAYVADVVEDS  136

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAAAFSWITG FSASHV+G++LARFLPE YIF VSI LLIF PVYM L LVETV+
Sbjct  137  KRAAAFSWITGIFSASHVLGNVLARFLPEKYIFEVSIALLIFGPVYMQLFLVETVR  192



>gb|EYU19784.1| hypothetical protein MIMGU_mgv1a006484mg [Erythranthe guttata]
Length=442

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTTNALC GQ +C +AIYING+QQTVVGIFKM+VLP+LGQL+D+YGR
Sbjct  26   WIAEEMTVSVLVDVTTNALCPGQLTCPQAIYINGIQQTVVGIFKMIVLPLLGQLADEYGR  85

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI PFTLLAIN+S+G VYAYY +RT+SYIISQGSIFCISVAYAADVV+ES
Sbjct  86   KPLLLLTVSTTIFPFTLLAINQSKGSVYAYYGIRTVSYIISQGSIFCISVAYAADVVDES  145

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAAAFSWITG FSASHVVG+LLARFLPE YIF VSI LLIF  VYM   L ETV+P
Sbjct  146  RRAAAFSWITGLFSASHVVGNLLARFLPEYYIFEVSIALLIFCSVYMAKFLKETVRP  202



>ref|XP_002311018.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
 gb|EEE88385.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
Length=444

 Score =   291 bits (746),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T+ALC GQ++CSEAIYI+GLQQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVVTSALCPGQTTCSEAIYISGLQQTVVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVST+I PF +LA N+SRG VY YYVLRTIS+IISQGSIFCI+VAYAAD++EE 
Sbjct  87   KPLLLITVSTSIFPFAVLAWNQSRGSVYVYYVLRTISFIISQGSIFCIAVAYAADIIEEG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRAAAFSWITGFFSASHV+G+LLARFLPE YIFVVSI  LIF PVYM   L ETV+
Sbjct  147  NRAAAFSWITGFFSASHVLGNLLARFLPEKYIFVVSIAFLIFSPVYMHFLLAETVE  202



>ref|XP_006436628.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
 ref|XP_006485217.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Citrus sinensis]
 gb|ESR49868.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
Length=439

 Score =   291 bits (744),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AE MT SVLVDV TNALC GQ +CSEAIYI+GLQQTVVG+FKMVVLP+LGQL+D+YGR
Sbjct  22   WVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGR  81

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI+PFTLLA N+S+ FVYAYYVLRTISYIISQGSIFCI+VAYAADVV E+
Sbjct  82   KPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAADVVNEN  141

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AFSWITG FSASHV+G++LARFLPE YIF VSI LLIFVPVYM   LVETV+
Sbjct  142  KRATAFSWITGLFSASHVLGNVLARFLPEKYIFPVSIALLIFVPVYMQFFLVETVE  197



>ref|XP_011032839.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=444

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T+ALC GQ+ CSEAIYI+GLQQTVVGIFKMVVLP LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVVTSALCPGQTKCSEAIYISGLQQTVVGIFKMVVLPFLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVST+I PF +LA N+SRG VY YYVLRTIS+IISQGSIFCI+VAYAAD++EE 
Sbjct  87   KPLLLITVSTSIFPFAVLAWNQSRGSVYVYYVLRTISFIISQGSIFCIAVAYAADIIEEG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRAAAFSWITGFFSASHV+G+LLARFLPE YIFVVSI  LIF PVYM   L ETV+
Sbjct  147  NRAAAFSWITGFFSASHVLGNLLARFLPEQYIFVVSIAFLIFSPVYMHFLLAETVE  202



>ref|XP_010681370.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC  Q++CSEAIY+NG+QQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVTTRALCPAQTTCSEAIYLNGVQQTVVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLL++T+STTI+PFTLLAI +SR FVYAYY LRTISYIISQGSIFCI+VAYAADV+E+S
Sbjct  87   KPLLIITLSTTILPFTLLAIEQSREFVYAYYFLRTISYIISQGSIFCIAVAYAADVIEDS  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSWITG FSASHV+G++LARFLPE YIF VSI LLIF PVYM   L ETVK
Sbjct  147  KRAATFSWITGLFSASHVLGNMLARFLPEKYIFKVSIALLIFCPVYMLFFLPETVK  202



>ref|XP_010312533.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum 
lycopersicum]
Length=441

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC G+++CSEAIYING+QQTVVGIFKM+VLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTGALCPGKTTCSEAIYINGVQQTVVGIFKMIVLPILGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLL++TVSTTIIPF LL INKSR  VYAYYVLRTISYIISQGSIFCISVAYAADVV+ S
Sbjct  83   KPLLILTVSTTIIPFGLLTINKSREMVYAYYVLRTISYIISQGSIFCISVAYAADVVDVS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            +RAA FSWITG FSASHV+G++LARFLP  YIF VSI LLIFVPVYM L L ETV P
Sbjct  143  SRAAVFSWITGLFSASHVLGNVLARFLPVGYIFQVSIGLLIFVPVYMTLFLEETVSP  199



>ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=441

 Score =   288 bits (737),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC G+++CSEAIYING+QQTVVGIFKM+VLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTGALCPGKTTCSEAIYINGVQQTVVGIFKMIVLPILGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLL++TVSTTIIPF LL INKSR  VYAYY+LRTISYIISQGSIFCISVAYAADVV+ S
Sbjct  83   KPLLILTVSTTIIPFGLLTINKSREMVYAYYILRTISYIISQGSIFCISVAYAADVVDVS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            +RAA FSWITG FSASHV+G++LARFLP  YIF VSI LLIFVPVYM + L ETV P
Sbjct  143  SRAAVFSWITGLFSASHVLGNVLARFLPVGYIFQVSIGLLIFVPVYMQVFLEETVAP  199



>gb|KEH43443.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=387

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC  QSSCS+AIYINGLQ+T+ GIFKM+VLP+LGQLSDD+GR
Sbjct  24   WIAEEMTVSVLVDVTTTALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+T+STTI PF LLA N+S  FVYAYYVLRTISYIIS+GSIFCISVAY ADVV E+
Sbjct  84   KPFLLLTMSTTIFPFALLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNEN  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA F WITG FSASHVVG++LARFLP++YIFVVSI LLIF PVYM   LVETVK
Sbjct  144  KRAAVFGWITGLFSASHVVGNVLARFLPQNYIFVVSIALLIFCPVYMQFFLVETVK  199



>ref|XP_010088768.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
 gb|EXB36951.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
Length=793

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC GQS+CSEAIYING+QQT+VG+FKMVVLP+LGQL+D++GR
Sbjct  25   WIAEEMTVSVLVDVTTGALCPGQSTCSEAIYINGIQQTIVGVFKMVVLPLLGQLADEHGR  84

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLLVTVSTTIIPF LLA N+S+ FVYAYYVLRTISYIISQGSIFCI+VAY ADVV +S
Sbjct  85   KPLLLVTVSTTIIPFALLAWNQSKEFVYAYYVLRTISYIISQGSIFCIAVAYTADVVSDS  144

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA FSWITG FSASHV+G++LARFLPE YIF+VSI LLIF PVYM L L ETVKP
Sbjct  145  KRAAVFSWITGLFSASHVLGNVLARFLPEKYIFLVSIALLIFGPVYMQLFLKETVKP  201



>gb|KEH43442.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=436

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC  QSSCS+AIYINGLQ+T+ GIFKM+VLP+LGQLSDD+GR
Sbjct  24   WIAEEMTVSVLVDVTTTALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+T+STTI PF LLA N+S  FVYAYYVLRTISYIIS+GSIFCISVAY ADVV E+
Sbjct  84   KPFLLLTMSTTIFPFALLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNEN  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA F WITG FSASHVVG++LARFLP++YIFVVSI LLIF PVYM   LVETVK
Sbjct  144  KRAAVFGWITGLFSASHVVGNVLARFLPQNYIFVVSIALLIFCPVYMQFFLVETVK  199



>ref|XP_010244469.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nelumbo 
nucifera]
Length=443

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC GQ +C EAIY+ GLQQTVVGIFKM VLP+LGQL+DDYGR
Sbjct  23   WIAEEMTVSVLVDVTTGALCPGQMTCPEAIYLTGLQQTVVGIFKMFVLPLLGQLADDYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+STTIIPF LLA N+S+ FVYAYYVLRTISYIISQGSIFCISVAYAAD VE S
Sbjct  83   KPVLLLTISTTIIPFALLAWNESKEFVYAYYVLRTISYIISQGSIFCISVAYAADFVEGS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R AAF WITG FS SHV+G++LARF+PEDYIF VSI LLIF PVYM L LVETVK
Sbjct  143  KRVAAFGWITGLFSFSHVLGNVLARFVPEDYIFEVSILLLIFCPVYMQLFLVETVK  198



>ref|XP_010067148.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Eucalyptus 
grandis]
 gb|KCW65211.1| hypothetical protein EUGRSUZ_G02698 [Eucalyptus grandis]
Length=459

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC GQS+CS+A+YING+QQTVVG+FKMVVLP+LGQL+D+ GR
Sbjct  35   WIAEEMTVSVLVDVTTSALCPGQSTCSQAVYINGIQQTVVGVFKMVVLPLLGQLADECGR  94

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+STTI PF LLA+N+S+ FVYAYY +RT+SYIISQGSIFCISVAYAADV+E+S
Sbjct  95   KPMLLLTLSTTIFPFALLAMNQSKEFVYAYYAIRTVSYIISQGSIFCISVAYAADVIEDS  154

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAAAFSWITG FSASHV+G++LARFLPE YIF VSI LLI  PVY+ L L ETVK
Sbjct  155  KRAAAFSWITGLFSASHVLGNVLARFLPEKYIFHVSIALLILCPVYIQLFLRETVK  210



>ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62023.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=441

 Score =   283 bits (724),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC  QSSCS+AIYINGLQ+T+ GIFKM+VLP+LGQLSDD+GR
Sbjct  24   WIAEEMTVSVLVDVTTTALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+T+STTI PF LLA N+S  FVYAYYVLRTISYIIS+GSIFCISVAY ADVV E+
Sbjct  84   KPFLLLTMSTTIFPFALLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNEN  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA F WITG FSASHVVG++LARFLP++YIFVVSI LLIF PVYM   LVETVK
Sbjct  144  KRAAVFGWITGLFSASHVVGNVLARFLPQNYIFVVSIALLIFCPVYMQFFLVETVK  199



>ref|XP_012074634.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Jatropha 
curcas]
Length=440

 Score =   283 bits (723),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVD+ TNALC G+S+C EAIY+NGLQQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDIVTNALCPGESTCDEAIYLNGLQQTVVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST++IPF LLA N+SRGFVYA+YVLRT+SY++SQGS+FCISVAYAAD V+E 
Sbjct  87   KPLLLLTISTSMIPFALLAWNESRGFVYAFYVLRTVSYVLSQGSVFCISVAYAADFVKEG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAAAFSWITG FSASH++G+++ARFLP++YIF VS+ LLI  PVY+   LVET++P
Sbjct  147  KRAAAFSWITGLFSASHLLGNVVARFLPDNYIFPVSVALLICCPVYLQFFLVETIEP  203



>ref|XP_009594349.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G S+CSEAIYING+QQTVVGIFKM+VLP+LGQLSD+YGR
Sbjct  23   WIAEEMTVSVLVDVTTSALCPGNSTCSEAIYINGVQQTVVGIFKMLVLPILGQLSDEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+STTIIPF LL INKS+GFVYAYYVLRTISYIISQGSIFCISVAYAADVV+ES
Sbjct  83   KPLLLLTLSTTIIPFGLLTINKSKGFVYAYYVLRTISYIISQGSIFCISVAYAADVVDES  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            +RAA FSWITG FSASHV+G++LARFLP  YIF VSI LLIFVPVY+ L L ETV P
Sbjct  143  SRAAVFSWITGLFSASHVMGNVLARFLPVGYIFQVSIGLLIFVPVYLILLLEETVSP  199



>gb|AFK42472.1| unknown [Lotus japonicus]
Length=224

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G S+C + IYINGLQQT+VGIFKMVVLP+LGQLSD++GR
Sbjct  24   WIAEEMTVSVLVDVTTSALCPGGSTCPKVIYINGLQQTIVGIFKMVVLPLLGQLSDEHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+STTI  F +LA ++S  FVYAYYVL T SYIISQGSIFCISVAY ADVV ES
Sbjct  84   KPLLLITMSTTIFSFAVLAWDQSEEFVYAYYVLHTFSYIISQGSIFCISVAYVADVVNES  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA FSWITG FSASHV+G++LARFLPE+YIF VSI LL F PVYM   LVETV P
Sbjct  144  KRAAVFSWITGLFSASHVLGNVLARFLPEEYIFAVSIALLTFCPVYMQFFLVETVTP  200



>ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=443

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AE+MT SVLVDV T ALC GQS+C++AIYI+GLQQ VVGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WVAEQMTVSVLVDVVTAALCPGQSTCAQAIYISGLQQVVVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+TVST+I PF LLA ++SRGFVYAYYVLRTISYI+SQGSIFCISVAYAAD V+E 
Sbjct  87   KPFLLLTVSTSIFPFALLAYDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADFVQED  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSW+TG FSASHV+G++LARFLPE YIF+VSI LLIF P+YM   LVETV+
Sbjct  147  KRAAVFSWMTGLFSASHVLGNILARFLPEKYIFLVSIALLIFGPIYMQFFLVETVE  202



>ref|XP_004308556.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=444

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC   S+CS+ IYING+QQT+VG+FKMVVLP+LGQL+D+ GR
Sbjct  30   WIAEEMTVSVLVDVTTTALCPAHSTCSQPIYINGIQQTIVGLFKMVVLPILGQLADENGR  89

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+TVSTTI PF LLA N+S+GFVYAYYVLRTISYI+SQGSIFCI++AY ADVV E+
Sbjct  90   KPVLLLTVSTTIFPFALLAWNQSKGFVYAYYVLRTISYILSQGSIFCIAIAYVADVVSEN  149

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRAA FSWITG FSASHV+G++LARFLPE YIF VSI L+IF PVYM + LVET  
Sbjct  150  NRAAVFSWITGLFSASHVLGNVLARFLPEIYIFPVSIALMIFCPVYMQIFLVETTN  205



>ref|XP_007214409.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
 gb|EMJ15608.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
Length=436

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVT  ALC  QS+CS+AIYING+QQTVVG+FKMVVLP+LGQL+D+ GR
Sbjct  22   WIAEEMTVSVLVDVTAAALCPSQSTCSQAIYINGVQQTVVGLFKMVVLPLLGQLADERGR  81

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI PF LLA N+S+ FVYAYYV+RT+SYI+SQGSIFCI+VAY ADVV E+
Sbjct  82   KPLLLLTVSTTIFPFVLLAWNQSKEFVYAYYVIRTVSYILSQGSIFCIAVAYVADVVNEN  141

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSWITG FSASHV+G++LARFLPE YIF VSI LLIF PVYM + L ET+ 
Sbjct  142  KRAAVFSWITGLFSASHVLGNVLARFLPEKYIFAVSIALLIFCPVYMQMFLTETIN  197



>ref|XP_008232010.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=439

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVT  ALC  QS+CS+AIYING+QQTVVG+FKMVVLP+LGQL+D++GR
Sbjct  25   WIAEEMTVSVLVDVTAAALCPSQSTCSQAIYINGVQQTVVGLFKMVVLPLLGQLADEHGR  84

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI PF LLA N+S+ FVYAYYV+RTISYI+SQGSIFCI+VAY ADVV E+
Sbjct  85   KPLLLLTVSTTIFPFALLAWNQSKEFVYAYYVIRTISYILSQGSIFCIAVAYVADVVNEN  144

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSWITG FSASHV+G++LARFLPE YIF VSI LLIF PVYM + L ET  
Sbjct  145  KRAAVFSWITGLFSASHVLGNVLARFLPEKYIFSVSIALLIFCPVYMQMFLTETTN  200



>ref|XP_010681372.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIA+EMT SVLVDVTT ALC  Q++CSE IY+NGLQQTVVGIFKMVVLP+LGQLSD+YGR
Sbjct  27   WIADEMTVSVLVDVTTRALCPDQTTCSEVIYLNGLQQTVVGIFKMVVLPLLGQLSDEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+ST I PF LLAIN+SR FVYAYYVLRTIS+IISQGSIFC +VAY ADV+E++
Sbjct  87   KPMLLITISTAIFPFALLAINQSREFVYAYYVLRTISHIISQGSIFCTAVAYTADVIEDT  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSWITG FSASHV+G++LARFLPE YIF +SI LL F P+Y+   L ETVK
Sbjct  147  KRAATFSWITGLFSASHVLGNVLARFLPEKYIFHISIALLTFCPIYILFFLPETVK  202



>gb|KDP35841.1| hypothetical protein JCGZ_10322 [Jatropha curcas]
Length=269

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            MT SVLVD+ TNALC G+S+C EAIY+NGLQQTVVGIFKMVVLP+LGQL+D+YGRKPLLL
Sbjct  1    MTVSVLVDIVTNALCPGESTCDEAIYLNGLQQTVVGIFKMVVLPLLGQLADEYGRKPLLL  60

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +T+ST++IPF LLA N+SRGFVYA+YVLRT+SY++SQGS+FCISVAYAAD V+E  RAAA
Sbjct  61   LTISTSMIPFALLAWNESRGFVYAFYVLRTVSYVLSQGSVFCISVAYAADFVKEGKRAAA  120

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            FSWITG FSASH++G+++ARFLP++YIF VS+ LLI  PVY+   LVET++P
Sbjct  121  FSWITGLFSASHLLGNVVARFLPDNYIFPVSVALLICCPVYLQFFLVETIEP  172



>ref|XP_007010348.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY19158.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=447

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC  QS+CSEAIYI+G+QQTVVG+ KM+VLP+LGQL+D+YGR
Sbjct  29   WIAEEMTVSVLVDVVTAALCPSQSTCSEAIYISGIQQTVVGVLKMLVLPLLGQLADEYGR  88

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI+PF LLA N+SR FVY YYVLRTISYIISQGSIFCI+VAYAADVV   
Sbjct  89   KPLLLLTVSTTIVPFALLAWNQSREFVYIYYVLRTISYIISQGSIFCIAVAYAADVVSVR  148

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRAA FS ITG FSASHV+G++LARFLPE YIF+VSI LLIF PVYM   LVETV+
Sbjct  149  NRAAVFSLITGLFSASHVLGNVLARFLPEKYIFLVSIVLLIFCPVYMQFFLVETVE  204



>ref|XP_012074632.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Jatropha 
curcas]
 gb|KDP35836.1| hypothetical protein JCGZ_10317 [Jatropha curcas]
Length=444

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AE+MT SVLVD+TT+ALC GQ++CS+AIYI+GLQQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WVAEQMTVSVLVDITTSALCPGQTTCSQAIYISGLQQTVVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+TVST+I PF LLA ++++ FVYAYYVLRTIS+I+SQGSIFCISVAYAAD+V+E+
Sbjct  87   KPFLLLTVSTSIFPFALLAYSQTKEFVYAYYVLRTISFILSQGSIFCISVAYAADIVKEN  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSW+TG FSASHV+G++LARFLP  YIF VSI LLIF P YM   LVETV+
Sbjct  147  KRAAVFSWMTGLFSASHVIGNVLARFLPWRYIFTVSIILLIFGPFYMQFFLVETVE  202



>ref|XP_007010347.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY19157.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=509

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC  QS+CSEAIYI+G+QQTVVG+ KM+VLP+LGQL+D+YGR
Sbjct  92   WIAEEMTVSVLVDVVTAALCPSQSTCSEAIYISGIQQTVVGVLKMLVLPLLGQLADEYGR  151

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI+PF LLA N+SR FVY YYVLRTISYIISQGSIFCI+VAYAADVV   
Sbjct  152  KPLLLLTVSTTIVPFALLAWNQSREFVYIYYVLRTISYIISQGSIFCIAVAYAADVVSVR  211

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRAA FS ITG FSASHV+G++LARFLPE YIF+VSI LLIF PVYM   LVETV+
Sbjct  212  NRAAVFSLITGLFSASHVLGNVLARFLPEKYIFLVSIVLLIFCPVYMQFFLVETVE  267



>emb|CDP20482.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMTKSVLVDVTT+ALC G S+C EAIY+NGLQQTVVGIFKMVVLPVLGQLSDDYGR
Sbjct  24   WIAEEMTKSVLVDVTTDALCPGHSTCEEAIYLNGLQQTVVGIFKMVVLPVLGQLSDDYGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI PF+LL I+KS+ FVYAYYVLRTIS+IISQGSIFCI+ AY ADV++++
Sbjct  84   KPLLLITVSTTIFPFSLLIISKSKSFVYAYYVLRTISFIISQGSIFCIAAAYVADVIDDN  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             R     W+ G FSASHV+G++LARFLPED IF VSI LLIF  +YM L L ETV
Sbjct  144  KRTTGLCWMMGLFSASHVLGNVLARFLPEDNIF-VSITLLIFCSLYMALFLPETV  197



>gb|ERN13076.1| hypothetical protein AMTR_s00040p00148020 [Amborella trichopoda]
Length=424

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G+S+CS+AIY++GLQQTVVG+FKM VLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTSALCPGKSTCSQAIYLSGLQQTVVGVFKMFVLPLLGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+ST+I+PF LLA +KS+ FVY YYV RTISYIISQGSIFCISVAYAADVVE S
Sbjct  83   KPILLLTISTSIVPFALLAWSKSKVFVYVYYVARTISYIISQGSIFCISVAYAADVVEVS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF  ITG FSASHV+G++LARFLPEDYIF VS+CLLI   VY+ L L+ETV 
Sbjct  143  KRATAFGCITGLFSASHVLGNILARFLPEDYIFEVSVCLLIISTVYLKLFLIETVN  198



>ref|XP_006851495.2| PREDICTED: hippocampus abundant transcript-like protein 1 [Amborella 
trichopoda]
Length=439

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G+S+CS+AIY++GLQQTVVG+FKM VLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTSALCPGKSTCSQAIYLSGLQQTVVGVFKMFVLPLLGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+ST+I+PF LLA +KS+ FVY YYV RTISYIISQGSIFCISVAYAADVVE S
Sbjct  83   KPILLLTISTSIVPFALLAWSKSKVFVYVYYVARTISYIISQGSIFCISVAYAADVVEVS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF  ITG FSASHV+G++LARFLPEDYIF VS+CLLI   VY+ L L+ETV 
Sbjct  143  KRATAFGCITGLFSASHVLGNILARFLPEDYIFEVSVCLLIISTVYLKLFLIETVN  198



>ref|XP_002524988.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37395.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=442

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AEEMT SVLVDV T+ALC G S+CS+AIY++GLQQTVVGIFKMVVLP+LGQL+D++GR
Sbjct  27   WVAEEMTLSVLVDVITDALCPGDSTCSQAIYLSGLQQTVVGIFKMVVLPLLGQLADEHGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL+T+ST+IIPF +L  N+S+GFVYAYYVL TISYI+SQGSIFCI+VAYAAD V+E 
Sbjct  87   KPFLLLTISTSIIPFAVLVWNQSKGFVYAYYVLHTISYILSQGSIFCIAVAYAADFVKEG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             R AAFSWITG FSASH++G++LAR LPE YIF+VS+ LLI  P+YM   LVET++P
Sbjct  147  KRVAAFSWITGLFSASHLLGNVLARLLPEKYIFMVSVALLICCPLYMQFFLVETIQP  203



>emb|CAN74055.1| hypothetical protein VITISV_026070 [Vitis vinifera]
Length=467

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC G S+C+E IYINGLQQTVVGIFKMVVLPVLGQL+D+YGR
Sbjct  17   WIAEEMTVSVLVDVTTAALCSGASTCAEVIYINGLQQTVVGIFKMVVLPVLGQLADEYGR  76

Query  302  KPLLLVT-VSTTIIPFT-LLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVE  475
            KPLL+V  V    +P + +LA NKS+GFVYAYYVLRT+SYI+SQGSIFCISVAY ADVVE
Sbjct  77   KPLLMVPYVFIAHVPVSAVLAWNKSKGFVYAYYVLRTVSYILSQGSIFCISVAYVADVVE  136

Query  476  ESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            +S RAAAFSWITG FSASHV+G++LARFLPE YIF VSI LLIF PVYM L LVETV+
Sbjct  137  DSKRAAAFSWITGIFSASHVLGNVLARFLPEKYIFEVSIALLIFGPVYMQLFLVETVR  194



>ref|XP_007143809.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15803.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G S+CS+AIYINGLQQT+VG+FKMVVLP+LGQLSD++GR
Sbjct  31   WIAEEMTVSVLVDVTTSALCPGDSTCSKAIYINGLQQTIVGVFKMVVLPLLGQLSDEHGR  90

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL T+ST+I PF LL   +S  FVYAYYVLRTIS IISQGSIFCISVAY ADVV ES
Sbjct  91   KPLLLFTISTSIFPFALLVWRQSEEFVYAYYVLRTISNIISQGSIFCISVAYVADVVNES  150

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RAA FSWI+G  SASHV+GDLLARFLPE YIF VSI LLI  PVYM   LVE++
Sbjct  151  KRAAVFSWISGLLSASHVLGDLLARFLPEKYIFAVSIVLLIVCPVYMKFFLVESM  205



>ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62022.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=442

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAE MT SVLVDVTT ALC  QSSCS+AIYINGLQQT+ GIFKM VLP+LGQLSD++GR
Sbjct  24   WIAEAMTVSVLVDVTTTALCPQQSSCSKAIYINGLQQTITGIFKMAVLPLLGQLSDEHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST+IIPF LLA N+S+ FVYAYYVLRT S+IISQGSIFCISVAY ADVV ES
Sbjct  84   KPLLLLTISTSIIPFALLAWNQSKEFVYAYYVLRTFSHIISQGSIFCISVAYVADVVHES  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R A FSWITG  SA+HV+ ++ ARFLP++YIFVVSI LL F P+YM   LVETVK
Sbjct  144  KRVAVFSWITGLSSAAHVIANVFARFLPQNYIFVVSITLLTFCPLYMHFFLVETVK  199



>gb|AFK40263.1| unknown [Medicago truncatula]
Length=442

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAE MT SVLVDVTT ALC  QSSCS+AIYING+QQT+ GIFKM VLP+LGQLSD++GR
Sbjct  24   WIAEAMTVSVLVDVTTTALCPQQSSCSKAIYINGVQQTITGIFKMAVLPLLGQLSDEHGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST+IIPF LLA N+S+ FVYAYYVLRT S+IISQGSIFCISVAY ADVV ES
Sbjct  84   KPLLLLTISTSIIPFALLAWNQSKEFVYAYYVLRTFSHIISQGSIFCISVAYVADVVHES  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R A FSWITG  SA+HV+ ++ ARFLP++YIFVVSI LL F P+YM   LVETVK
Sbjct  144  KRVAVFSWITGLSSAAHVIANVFARFLPQNYIFVVSITLLTFCPLYMHFFLVETVK  199



>gb|KGN46030.1| hypothetical protein Csa_6G045090 [Cucumis sativus]
Length=416

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV TNALC   ++C +AIY NG +QT+VGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVITNALCSQNTTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVST+I PF LL  ++S+G++YAYYVLRTIS I+SQGSIF ISVAYAAD V+ES
Sbjct  87   KPLLLLTVSTSIFPFALLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADTVQES  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA F WITG  SASHVVG+LLARFLPE YIFVVSI LL+F P+YM   L ETVKP
Sbjct  147  RRAAVFGWITGLSSASHVVGNLLARFLPEKYIFVVSIVLLMFCPIYMYFFLHETVKP  203



>gb|KHN37831.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=442

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AEEMT SVLVDVTT+ALC G+S+CS+AIYING QQT+VGIFKMVVLP+LGQLSD+YGR
Sbjct  24   WVAEEMTVSVLVDVTTSALCPGESTCSKAIYINGFQQTIVGIFKMVVLPLLGQLSDEYGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST I PF LL  ++S  +VYAYYVLRTIS IISQGSIFCISVAYAADVV ES
Sbjct  84   KPLLLITISTAIFPFVLLVWHQSEEYVYAYYVLRTISNIISQGSIFCISVAYAADVVNES  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA F WITG  SASHV+GD+LA  LPE YIF VSI LL   PVYM   LVETV P
Sbjct  144  KRAAVFGWITGLLSASHVLGDVLAWSLPEKYIFAVSIVLLTSCPVYMKFFLVETVIP  200



>ref|XP_003535506.2| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Glycine max]
Length=450

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AEEMT SVLVDVTT+ALC G+S+CS+AIYING+QQT+VGIFKMVVLP+LGQLSD+YGR
Sbjct  32   WVAEEMTVSVLVDVTTSALCPGESTCSKAIYINGVQQTIVGIFKMVVLPLLGQLSDEYGR  91

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST I PF LL  ++S  +VYAYYVLRTIS IISQGSIFCISVAYAADVV ES
Sbjct  92   KPLLLITISTAIFPFVLLVWHQSEEYVYAYYVLRTISNIISQGSIFCISVAYAADVVNES  151

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA F WITG  SASHV+GD+LA  LPE YIF VSI LL   PVYM   LVETV P
Sbjct  152  KRAAVFGWITGLLSASHVLGDVLAWSLPEKYIFAVSIVLLTSCPVYMKFFLVETVIP  208



>ref|XP_007143808.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15802.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT+ALC G S+CS+AIYINGLQQT+VG+FKMVVLP+LGQLSD++GR
Sbjct  31   WIAEEMTVSVLVDVTTSALCPGDSTCSKAIYINGLQQTIVGVFKMVVLPLLGQLSDEHGR  90

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL T+ST+I PF LL   +S  FVYAYYVLRTIS IISQGSIFCISVAY ADVV ES
Sbjct  91   KPLLLFTISTSIFPFALLVWRQSEEFVYAYYVLRTISNIISQGSIFCISVAYVADVVNES  150

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RAA FSWI+G  SASHV+GDLLARFLPE+  F VSI LLI  PVYM   LVE++
Sbjct  151  KRAAVFSWISGLLSASHVLGDLLARFLPENSTFQVSIVLLIVCPVYMKFFLVESM  205



>ref|XP_004140989.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
sativus]
Length=444

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV TNALC   ++C +AIY NG +QT+VGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVITNALCSQNTTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVST+I PF LL  ++S+G++YAYYVLRTIS I+SQGSIF ISVAYAAD V+ES
Sbjct  87   KPLLLLTVSTSIFPFALLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADTVQES  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA F WITG  SASHVVG+LLARFLPE YIFVVSI LL+F P+YM   L ETVKP
Sbjct  147  RRAAVFGWITGLSSASHVVGNLLARFLPEKYIFVVSIVLLMFCPIYMYFFLHETVKP  203



>ref|XP_009407349.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC GQSSC++AIYINGLQQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTRALCPGQSSCAKAIYINGLQQTVVGIFKMVVLPILGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST+I+PF +LA + SR  VY Y+VLRTISYIISQGSI CISVAYAADV+E S
Sbjct  83   KPLLLITISTSIVPFAILAWDVSRAAVYIYFVLRTISYIISQGSILCISVAYAADVIEVS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R+  F WITG FS SHV+G++LARFLPE +IF VSI LL+   +YM + L+ETVK
Sbjct  143  KRSTTFGWITGLFSVSHVLGNILARFLPEGWIFEVSIFLLVCATLYMKIFLIETVK  198



>ref|XP_010681371.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WI +EMT SVLVDVTT ALC   + CSE IY+NGLQQTVVGIFKMV+LP+LGQL+D+YGR
Sbjct  27   WIGDEMTVSVLVDVTTRALCPAHTICSEPIYLNGLQQTVVGIFKMVILPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST I PFTLLAIN+SR  VY YYVLRTIS IIS GSIFCI+VAYAADVVE+S
Sbjct  87   KPLLLITLSTAIFPFTLLAINQSREVVYGYYVLRTISQIISHGSIFCITVAYAADVVEDS  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA  F WITG FSASHV+G+ LARFLPE +IF VS+ LLIF  VYM   L ET+K
Sbjct  147  KRATTFGWITGLFSASHVLGNGLARFLPERHIFQVSVSLLIFAVVYMQFFLPETIK  202



>ref|XP_009416863.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTT ALC G+ SC+EAIYI GLQQTVVG+FKMVVLP+LGQL+D+YGR
Sbjct  23   WIAEEMTVSVLVDVTTGALCPGERSCAEAIYITGLQQTVVGVFKMVVLPILGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST+I+PF +LA + SR  VY Y+VLRTISYIISQGSI CIS+AYAADV+E  
Sbjct  83   KPLLLITISTSIVPFAILAWDDSRAAVYWYFVLRTISYIISQGSILCISIAYAADVIEVG  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             R+AAF WITG FSA+HV+G++LARFLPE +IF VSICLL+   +Y+ + LVETV
Sbjct  143  KRSAAFGWITGLFSAAHVLGNILARFLPEGWIFEVSICLLVCSTLYLKIFLVETV  197



>ref|XP_008456592.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=443

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC    +C +AIY NG +QT+VGIFKMVVLP+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVITKALCPQNPTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVST+I PF LL  ++S+G++YAYYVLRTIS I+SQGSIF ISVAYAAD+V+ES
Sbjct  87   KPLLLLTVSTSIFPFALLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADIVQES  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
             RAA F WITG  SASHVVG+LLARFLPE YIFVVSI LL+F P+YM   L ETVKP
Sbjct  147  RRAAVFGWITGLCSASHVVGNLLARFLPEKYIFVVSIVLLMFCPIYMYFFLHETVKP  203



>ref|XP_002315443.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
 gb|EEF01614.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
Length=668

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            MT SVLVDV T+ALC GQ++CSE IYI+GLQQTVVGIFKMVV+P+LGQL+D+YGRKPLLL
Sbjct  1    MTFSVLVDVLTSALCPGQTTCSEVIYISGLQQTVVGIFKMVVIPLLGQLADEYGRKPLLL  60

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +TVST++ PF +LA N+SR  VY YYVLRTIS+I+SQGSIFCI+VAYAAD+++E NRA A
Sbjct  61   ITVSTSMFPFAVLACNQSRDAVYVYYVLRTISFILSQGSIFCIAVAYAADIIKEENRATA  120

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            FSWITGFFSASHVVG+LLARFLPE YIFVVSI LLIF  VYM   LVETV+
Sbjct  121  FSWITGFFSASHVVGNLLARFLPEKYIFVVSIALLIFGSVYMYFFLVETVE  171



>ref|XP_011024228.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=456

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T+ALC GQ++CSE IYI+GLQQTVVGIFKMVVLP+LGQL+D+YGR
Sbjct  39   WIAEEMTVSVLVDVLTSALCPGQTTCSEVIYISGLQQTVVGIFKMVVLPLLGQLADEYGR  98

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+ VST+I PF +LA N+SR  VY YYVLRTIS+I+SQGSIFCI++AYAAD+++E 
Sbjct  99   KPLLLIAVSTSIFPFAVLACNQSRDAVYVYYVLRTISFILSQGSIFCIAIAYAADIIKEE  158

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            NRA AFSWITGFFSASHVVG+LLARFLPE +IFVVSI LLIF  VYM   LVETV+
Sbjct  159  NRATAFSWITGFFSASHVVGNLLARFLPEKFIFVVSIALLIFGSVYMYFFLVETVE  214



>gb|EPS69092.1| hypothetical protein M569_05672, partial [Genlisea aurea]
Length=441

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDVTTNALC  Q +CSEAIY+NG+QQTVVGIFKM+VLP++GQL+D+YGR
Sbjct  19   WIAEEMTVSVLVDVTTNALCPAQKTCSEAIYLNGIQQTVVGIFKMIVLPLMGQLADEYGR  78

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE-  478
            KPLLL+T+STTI PF L+A+N+SRG VYAYY +RTI  ++SQGSIF IS+ YAADVV++ 
Sbjct  79   KPLLLLTISTTIFPFALIAVNQSRGAVYAYYAIRTICNVLSQGSIFTISIIYAADVVDDG  138

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            S RA  FSW+TG  SASHVVGDL+ARFLP  YIF     LLIF P+Y+ L L ETV
Sbjct  139  SKRAVVFSWMTGLMSASHVVGDLIARFLPSQYIFEACSSLLIFCPIYLSLFLQETV  194



>ref|XP_010032090.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=450

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV  +ALC G ++CSE IY NGL+QT+ G+FKM  +P+LGQL+D+YGR
Sbjct  27   WIAEEMTVSVLVDVLIDALCPGDTTCSEVIYFNGLEQTIAGVFKMFSIPILGQLADEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LLV +ST++ PF +LA ++SRGFVYAYYVLRTISYI+SQGSIFCISVAYAADVVE  
Sbjct  87   KPVLLVIISTSVFPFAMLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA+AFSWITG +SASHV+G+LLARFLPE YIF VSI LL+  P+Y+   L ETV 
Sbjct  147  KRASAFSWITGLYSASHVLGNLLARFLPEKYIFDVSIALLLCCPIYIYFFLRETVN  202



>gb|KCW51480.1| hypothetical protein EUGRSUZ_J00999 [Eucalyptus grandis]
Length=523

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV  +ALC G ++CSE IY NGL+QT+ G+FKM  +P+LGQL+D+YGR
Sbjct  100  WIAEEMTVSVLVDVLIDALCPGDTTCSEVIYFNGLEQTIAGVFKMFSIPILGQLADEYGR  159

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LLV +ST++ PF +LA ++SRGFVYAYYVLRTISYI+SQGSIFCISVAYAADVVE  
Sbjct  160  KPVLLVIISTSVFPFAMLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETG  219

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA+AFSWITG +SASHV+G+LLARFLPE YIF VSI LL+  P+Y+   L ETV 
Sbjct  220  KRASAFSWITGLYSASHVLGNLLARFLPEKYIFDVSIALLLCCPIYIYFFLRETVN  275



>ref|XP_010681373.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 144/176 (82%), Gaps = 10/176 (6%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIA+EMT SVLVDVTT ALC  Q++CSE          VVGIFKMVVLP+LGQLSD+YGR
Sbjct  27   WIADEMTVSVLVDVTTRALCPDQTTCSE----------VVGIFKMVVLPLLGQLSDEYGR  76

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL+T+ST I PF LLAIN+SR FVYAYYVLRTIS+IISQGSIFC +VAY ADV+E++
Sbjct  77   KPMLLITISTAIFPFALLAINQSREFVYAYYVLRTISHIISQGSIFCTAVAYTADVIEDT  136

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAA FSWITG FSASHV+G++LARFLPE YIF +SI LL F P+Y+   L ETVK
Sbjct  137  KRAATFSWITGLFSASHVLGNVLARFLPEKYIFHISIALLTFCPIYILFFLPETVK  192



>emb|CDO99891.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W AEEMT SVLVDVTTNALC  QS+C +AIY+NGLQQT VGIFKM VLPVLGQLSDD+GR
Sbjct  25   WTAEEMTHSVLVDVTTNALCPAQSTCPQAIYLNGLQQTTVGIFKMAVLPVLGQLSDDHGR  84

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP LL TVST+I PFTL+ INKS+GFVYAYYVLRTI+ I +QGSI+CI+ AY ADVV+++
Sbjct  85   KPFLLFTVSTSIFPFTLIVINKSKGFVYAYYVLRTINLIFTQGSIYCITAAYIADVVDDN  144

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFV  583
             +AA+FSW+ G FS SHV+G+ LARFLP  YIF+
Sbjct  145  TKAASFSWMMGLFSTSHVLGNALARFLPGAYIFL  178



>ref|XP_006361453.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=439

 Score =   249 bits (637),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W AEEM+ S++ D+TTNALC  +S+CS+AIYINGLQQ VVGI KMVV+PVLGQL+D+YGR
Sbjct  24   WTAEEMSVSIIADITTNALCPSKSTCSQAIYINGLQQMVVGICKMVVIPVLGQLADEYGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+ VST I P  +LAI++S+GFVYAYYVLR IS+I+SQGSIFCIS AYAAD+++  
Sbjct  84   KPLLLLIVSTAIFPSAILAIDESKGFVYAYYVLRIISHIMSQGSIFCISAAYAADILDGR  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            +RAAAF WI G  S SHV+G+LLAR LP  YIF VS+ LLI  PVYM + L ETVK
Sbjct  144  SRAAAFGWIHGILSLSHVLGNLLARLLPGTYIFEVSVALLIIAPVYMIIFLTETVK  199



>gb|EPS69924.1| hypothetical protein M569_04837, partial [Genlisea aurea]
Length=333

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AEEMT +VLVDVTT+ALC GQ++C EAIY+NG+QQTVVGIFKMV+LP++GQL+D+YGR
Sbjct  23   WVAEEMTIAVLVDVTTSALCPGQNTCPEAIYLNGIQQTVVGIFKMVILPLMGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE-  478
            KPLLL+T+STTI+PF LLAI++SRG VYAYY++RT   I+S+GSIF IS+ YAAD+VE+ 
Sbjct  83   KPLLLLTISTTIVPFALLAIDQSRGSVYAYYIIRTFCNILSKGSIFTISIIYAADLVEDG  142

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIF--VVSICLLIFVPVYMGLALVETV  646
            S RA  FSW++G  SA+ V+GDL ARF+P  YIF   VSI LLIF P+Y+ L L ETV
Sbjct  143  SKRATVFSWMSGLMSAAQVIGDLAARFVPSKYIFEACVSIALLIFGPIYISLFLKETV  200



>ref|XP_010032084.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=421

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+A+EM +SVLVDV  +ALC G ++CSE IY NGL+QT+VG+FKM  +P+LGQLSD+YGR
Sbjct  27   WVAKEMPESVLVDVLIDALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL  ++T++ PF +LA ++SRGFVYAYYVLRTIS I+SQGSI C+SVAYAADVVE  
Sbjct  87   KPVLLAIIATSVFPFAMLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RA AFSWITG  SASHV+G+LLARFLPE YIF ++I LL+  P+YM + L ETV
Sbjct  147  KRAFAFSWITGLLSASHVLGNLLARFLPEKYIFDITIALLLCPPIYMYVFLRETV  201



>gb|KCW51477.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=443

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+A+EM +SVLVDV  +ALC G ++CSE IY NGL+QT+VG+FKM  +P+LGQLSD+YGR
Sbjct  27   WVAKEMPESVLVDVLIDALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL  ++T++ PF +LA ++SRGFVYAYYVLRTIS I+SQGSI C+SVAYAADVVE  
Sbjct  87   KPVLLAIIATSVFPFAMLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RA AFSWITG  SASHV+G+LLARFLPE YIF ++I LL+  P+YM + L ETV
Sbjct  147  KRAFAFSWITGLLSASHVLGNLLARFLPEKYIFDITIALLLCPPIYMYVFLRETV  201



>ref|XP_010032083.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW51476.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=450

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+A+EM +SVLVDV  +ALC G ++CSE IY NGL+QT+VG+FKM  +P+LGQLSD+YGR
Sbjct  27   WVAKEMPESVLVDVLIDALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGR  86

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KP+LL  ++T++ PF +LA ++SRGFVYAYYVLRTIS I+SQGSI C+SVAYAADVVE  
Sbjct  87   KPVLLAIIATSVFPFAMLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESG  146

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RA AFSWITG  SASHV+G+LLARFLPE YIF ++I LL+  P+YM + L ETV
Sbjct  147  KRAFAFSWITGLLSASHVLGNLLARFLPEKYIFDITIALLLCPPIYMYVFLRETV  201



>ref|XP_004250476.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Solanum lycopersicum]
Length=439

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W AEEM+ S++ D+TTNALC  +S+CS+AIYINGLQQ VVGI KMVV+PVLGQL+D+YGR
Sbjct  24   WTAEEMSVSIIADITTNALCPSKSTCSQAIYINGLQQMVVGICKMVVIPVLGQLADEYGR  83

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+ VST I P  +LAI++S+GFVYAYYVLR IS+I+SQGSIFCIS AYAAD+++  
Sbjct  84   KPLLLLIVSTAIFPSAILAIDESKGFVYAYYVLRMISHIMSQGSIFCISAAYAADILDGR  143

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            +RAAAF W+ G  S SHV+G+ LAR LP  YIF VS+ LLI  P+YM + L ETVK
Sbjct  144  SRAAAFGWMHGILSLSHVLGNFLARLLPGTYIFEVSVALLIIAPMYMLIFLTETVK  199



>ref|XP_008788273.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008779095.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
Length=365

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC G+ SC EAIY+ G+QQTVVG+FKMVVLP LGQL+D++GR
Sbjct  23   WIAEEMTVSVLVDVITGALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T ST+IIP+ +LA + S+  +Y ++ LRTIS IIS GSIFCISVAYA+DVVE  
Sbjct  83   KPLLLITTSTSIIPYAILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESR  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF W+TG FSASHV+G++LARFLPE++IF VSI LL+F  +Y+ + L+ETVK
Sbjct  143  KRAVAFGWMTGLFSASHVLGNVLARFLPEEWIFEVSIALLVFTVLYLKIYLIETVK  198



>ref|XP_008788264.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008779094.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
Length=382

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC G+ SC EAIY+ G+QQTVVG+FKMVVLP LGQL+D++GR
Sbjct  23   WIAEEMTVSVLVDVITGALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T ST+IIP+ +LA + S+  +Y ++ LRTIS IIS GSIFCISVAYA+DVVE  
Sbjct  83   KPLLLITTSTSIIPYAILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESR  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF W+TG FSASHV+G++LARFLPE++IF VSI LL+F  +Y+ + L+ETVK
Sbjct  143  KRAVAFGWMTGLFSASHVLGNVLARFLPEEWIFEVSIALLVFTVLYLKIYLIETVK  198



>ref|XP_008788255.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008779093.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
Length=447

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC G+ SC EAIY+ G+QQTVVG+FKMVVLP LGQL+D++GR
Sbjct  23   WIAEEMTVSVLVDVITGALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T ST+IIP+ +LA + S+  +Y ++ LRTIS IIS GSIFCISVAYA+DVVE  
Sbjct  83   KPLLLITTSTSIIPYAILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESR  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF W+TG FSASHV+G++LARFLPE++IF VSI LL+F  +Y+ + L+ETVK
Sbjct  143  KRAVAFGWMTGLFSASHVLGNVLARFLPEEWIFEVSIALLVFTVLYLKIYLIETVK  198



>ref|XP_009773275.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=382

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  236  VVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISY  415
            VVGIFKM+VLP+LGQLSD+YGRKPLLL+T+STTIIPF LL INKS+GFVYAYYVLRTISY
Sbjct  2    VVGIFKMLVLPILGQLSDEYGRKPLLLLTISTTIIPFGLLTINKSKGFVYAYYVLRTISY  61

Query  416  IISQGSIFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSIC  595
            IISQGSIFCISVAYAADVV+ES+RAA FSWITG FSASHV+G++LARFLP  YIF VSI 
Sbjct  62   IISQGSIFCISVAYAADVVDESSRAAVFSWITGLFSASHVMGNVLARFLPVGYIFQVSIG  121

Query  596  LLIFVPVYMGLALVETVKP  652
            LLIFVP+YM L L ETV P
Sbjct  122  LLIFVPIYMILFLEETVSP  140



>ref|XP_010907145.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Elaeis 
guineensis]
Length=447

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            WIAEEMT SVLVDV T ALC G+ SCSEAIY+ G+QQTVVGIFKMVVLP LGQL+D++GR
Sbjct  23   WIAEEMTVSVLVDVITGALCPGEKSCSEAIYLTGVQQTVVGIFKMVVLPTLGQLADEHGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T ST+IIP+ +LA + S+  +Y ++ LRTIS IIS GSIFCIS+AYA+DVVE  
Sbjct  83   KPLLLITTSTSIIPYAILAWDNSKSSIYVFFALRTISSIISHGSIFCISIAYASDVVESR  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RA AF W+TG FSASHV+G++LARFLPE++IF VSI LL+   +Y+ + L+ETVK
Sbjct  143  KRAVAFGWMTGLFSASHVLGNVLARFLPEEWIFEVSIALLVCSVLYLKIYLIETVK  198



>emb|CDO99893.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            MTKSVLVDVTTN LC GQS+C EAI +NGLQQT VGIFKMVVLPVLGQLSDDYGRKPLLL
Sbjct  1    MTKSVLVDVTTNVLCPGQSTCPEAIDLNGLQQTTVGIFKMVVLPVLGQLSDDYGRKPLLL  60

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
             T S  I+PF +LAINKS+GFVYA+YVLR +S I SQGSI+CI+ AY ADVV+++ +A  
Sbjct  61   ATFSADILPFAVLAINKSKGFVYAFYVLRFVSLIFSQGSIYCIAAAYLADVVDDNKKATG  120

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSIC  595
            FSW+ G  SAS V+G++LARFLP    F    C
Sbjct  121  FSWMMGLISASRVLGNVLARFLPGTCFFEACYC  153



>ref|XP_011076925.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011076926.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
Length=375

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            M+VLP+LGQL+D++GRKPLLL+TVSTTI+PFTLLAIN+S+  +YAYYVLRTISYIISQGS
Sbjct  1    MIVLPLLGQLADEHGRKPLLLITVSTTIVPFTLLAINQSKASIYAYYVLRTISYIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCISVAYAADV+++  RAAAFSWITG FSASHV+G++LARFLPEDYIF VSI LLIFVP
Sbjct  61   IFCISVAYAADVIDDDKRAAAFSWITGLFSASHVLGNILARFLPEDYIFAVSIALLIFVP  120

Query  614  VYMGLALVETVKP  652
            +YM L L ETV+P
Sbjct  121  IYMSLFLTETVRP  133



>ref|XP_006485218.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Citrus sinensis]
 ref|XP_006485219.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X3 [Citrus sinensis]
Length=374

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP+LGQL+D+YGRKPLLL+TVSTTI+PFTLLA N+S+ FVYAYYVLRTISYIISQGS
Sbjct  1    MVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI+VAYAADVV E+ RA AFSWITG FSASHV+G++LARFLPE YIF VSI LLIFVP
Sbjct  61   IFCIAVAYAADVVNENKRATAFSWITGLFSASHVLGNVLARFLPEKYIFPVSIALLIFVP  120

Query  614  VYMGLALVETVK  649
            VYM   LVETV+
Sbjct  121  VYMQFFLVETVE  132



>ref|XP_011032840.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP LGQL+D+YGRKPLLL+TVST+I PF +LA N+SRG VY YYVLRTIS+IISQGS
Sbjct  1    MVVLPFLGQLADEYGRKPLLLITVSTSIFPFAVLAWNQSRGSVYVYYVLRTISFIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI+VAYAAD++EE NRAAAFSWITGFFSASHV+G+LLARFLPE YIFVVSI  LIF P
Sbjct  61   IFCIAVAYAADIIEEGNRAAAFSWITGFFSASHVLGNLLARFLPEQYIFVVSIAFLIFSP  120

Query  614  VYMGLALVETVK  649
            VYM   L ETV+
Sbjct  121  VYMHFLLAETVE  132



>ref|XP_010682914.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=444

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            IA EM+   L++V ++ALC G+++CS+A+Y+N LQQT+ G+  + VLP+L +LSD+YGRK
Sbjct  36   IAHEMSSPYLMEVISSALCPGETTCSDALYLNNLQQTIAGLLMIPVLPLLCELSDEYGRK  95

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
            PLLL+T+ST+I P  LLAI+ SR F+ AY+ LR +SYI+S  S+FCI++AYAADVVE+  
Sbjct  96   PLLLLTISTSIFPVVLLAISNSRAFINAYFALRCLSYILSLRSVFCIAIAYAADVVEDDK  155

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            R AAFSWITG  SASHV+G LLARF+P  YIF +SI LL   P+++ L + ET +
Sbjct  156  RVAAFSWITGVLSASHVLGTLLARFVPGKYIFELSIPLLFMCPLFIQLFVAETAR  210



>gb|KDO42035.1| hypothetical protein CISIN_1g0164182mg, partial [Citrus sinensis]
Length=257

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 124/176 (70%), Gaps = 41/176 (23%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AE MT SVLVDV TNALC GQ +CSEAIYI+GLQQTVVG+FKMVVLP+LGQL+D+YGR
Sbjct  22   WVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGR  81

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+TVSTTI+PFTLLA N+S+ FVYAYYVLRTISYIISQGSIFCI+VAYA       
Sbjct  82   KPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYA-------  134

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
                                              VSI LLIFVPVYM   LVETV+
Sbjct  135  ----------------------------------VSIALLIFVPVYMQFFLVETVE  156



>ref|XP_011469316.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=371

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP+LGQL+D+ GRKP+LL+TVSTTI PF LLA N+S+GFVYAYYVLRTISYI+SQGS
Sbjct  1    MVVLPILGQLADENGRKPVLLLTVSTTIFPFALLAWNQSKGFVYAYYVLRTISYILSQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI++AY ADVV E+NRAA FSWITG FSASHV+G++LARFLPE YIF VSI L+IF P
Sbjct  61   IFCIAIAYVADVVSENNRAAVFSWITGLFSASHVLGNVLARFLPEIYIFPVSIALMIFCP  120

Query  614  VYMGLALVETVK  649
            VYM + LVET  
Sbjct  121  VYMQIFLVETTN  132



>ref|XP_007010349.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 ref|XP_007010350.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19159.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19160.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=374

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            M+VLP+LGQL+D+YGRKPLLL+TVSTTI+PF LLA N+SR FVY YYVLRTISYIISQGS
Sbjct  1    MLVLPLLGQLADEYGRKPLLLLTVSTTIVPFALLAWNQSREFVYIYYVLRTISYIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI+VAYAADVV   NRAA FS ITG FSASHV+G++LARFLPE YIF+VSI LLIF P
Sbjct  61   IFCIAVAYAADVVSVRNRAAVFSLITGLFSASHVLGNVLARFLPEKYIFLVSIVLLIFCP  120

Query  614  VYMGLALVETVK  649
            VYM   LVETV+
Sbjct  121  VYMQFFLVETVE  132



>ref|XP_003577048.1| PREDICTED: uncharacterized protein LOC100833620 [Brachypodium 
distachyon]
Length=460

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC--DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDY  295
            W+AEEMT  VLVDVTT ALC  DG SSC EAIY+ GL QTV GIF+ V   ++GQL+D+Y
Sbjct  32   WVAEEMTVPVLVDVTTAALCPGDGTSSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEY  91

Query  296  GRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVE  475
            GRKPLLLV    +IIPF++LA++ ++  VYAY VLRT S++I QG+I C+++AY AD+VE
Sbjct  92   GRKPLLLVAAGASIIPFSVLALSSTKVAVYAYLVLRTFSFMIGQGTITCLALAYTADLVE  151

Query  476  ESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             S RA AF  +TG  SASH +G++ +RFLPE +IF VS+ LLI   +YM + LVET++
Sbjct  152  PSKRAFAFGCMTGILSASHSLGNVFSRFLPEQWIFQVSVLLLICSVLYMKMCLVETLQ  209



>ref|XP_010681374.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=375

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP+LGQLSD+YGRKP+LL+T+ST I PF LLAIN+SR FVYAYYVLRTIS+IISQGS
Sbjct  1    MVVLPLLGQLSDEYGRKPMLLITISTAIFPFALLAINQSREFVYAYYVLRTISHIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFC +VAY ADV+E++ RAA FSWITG FSASHV+G++LARFLPE YIF +SI LL F P
Sbjct  61   IFCTAVAYTADVIEDTKRAATFSWITGLFSASHVLGNVLARFLPEKYIFHISIALLTFCP  120

Query  614  VYMGLALVETVK  649
            +Y+   L ETVK
Sbjct  121  IYILFFLPETVK  132



>emb|CBX25325.1| hypothetical_protein [Oryza brachyantha]
Length=391

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC-DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC    ++C EAIY+NGL QTV GIF+ V   ++GQL+D+YG
Sbjct  11   WVAEEMTVPVLVDVTTRALCPSDDNACPEAIYLNGLHQTVGGIFRAVGYTLMGQLADEYG  70

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+I+P+ +LA NKS+  +Y Y +LRT+S++I QG+I  ++V Y ADVVE 
Sbjct  71   RKPLLLLTASTSILPYGVLACNKSKAAIYIYLILRTLSFMIGQGTITSLAVTYTADVVEP  130

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET +
Sbjct  131  SKRALAFGCITGVLSASHALGNGFSRFLPERWIFQVSVVLLICSVIYMKISLVETFQ  187



>ref|XP_004978692.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Setaria italica]
Length=455

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            +AEEMT   LVD  T ALC     SC EAIY+ GLQ +V GIF+ +   ++GQL+D+YGR
Sbjct  28   VAEEMTVPALVDKVTAALCPADDRSCPEAIYLTGLQSSVGGIFRTIGFTLMGQLADEYGR  87

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T ST+IIPF +LA N SR  VY Y VLRT+S++I QG+IFC+S+AY AD VE S
Sbjct  88   KPLLLLTASTSIIPFAVLAWNNSRTAVYVYLVLRTLSFMIGQGTIFCLSIAYTADAVEPS  147

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAAAF ++TG FSASH +G + +RFLPE  IF VSI LLI   +YM + L+ETV+
Sbjct  148  RRAAAFGFMTGIFSASHTLGSVFSRFLPEKLIFEVSIALLICSILYMKIYLIETVQ  203



>ref|XP_006662736.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Oryza brachyantha]
Length=454

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC-DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC    ++C EAIY+NGL QTV GIF+ V   ++GQL+D+YG
Sbjct  26   WVAEEMTVPVLVDVTTRALCPSDDNACPEAIYLNGLHQTVGGIFRAVGYTLMGQLADEYG  85

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+I+P+ +LA NKS+  +Y Y +LRT+S++I QG+I  ++V Y ADVVE 
Sbjct  86   RKPLLLLTASTSILPYGVLACNKSKAAIYIYLILRTLSFMIGQGTITSLAVTYTADVVEP  145

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET +
Sbjct  146  SKRALAFGCITGVLSASHALGNGFSRFLPERWIFQVSVVLLICSVIYMKISLVETFQ  202



>gb|EEC67684.1| hypothetical protein OsI_35133 [Oryza sativa Indica Group]
Length=436

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC G   +C EAIY+ GL QTV GIF+ V   ++GQL+D+YG
Sbjct  11   WVAEEMTVPVLVDVTTRALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYG  70

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+IIP+ +LA NKS+  VY + +LRT+S++I QG+I  ++V Y ADVV+ 
Sbjct  71   RKPLLLLTASTSIIPYGVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDP  130

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET++
Sbjct  131  SKRAFAFGCITGILSASHALGNGFSRFLPERWIFQVSVALLISSVIYMKISLVETLQ  187



>gb|EEE51661.1| hypothetical protein OsJ_32986 [Oryza sativa Japonica Group]
 tpd|FAA00733.1| TPA: nicotianamine efflux transporter [Oryza sativa Japonica 
Group]
Length=436

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC G   +C EAIY+ GL QTV GIF+ V   ++GQL+D+YG
Sbjct  11   WVAEEMTVPVLVDVTTRALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYG  70

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+IIP+ +LA NKS+  VY + +LRT+S++I QG+I  ++V Y ADVV+ 
Sbjct  71   RKPLLLLTASTSIIPYGVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDP  130

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET++
Sbjct  131  SKRAFAFGCITGILSASHALGNGFSRFLPERWIFQVSVALLISSVIYMKISLVETLQ  187



>ref|XP_002450280.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
 gb|EES09268.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
Length=448

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            +AEEMT   LVD  T ALC     SC EA+Y+ GLQ +V GIF+ +   ++GQL+D+YGR
Sbjct  20   VAEEMTVPALVDKVTAALCPADDRSCPEALYLTGLQSSVGGIFRTIGFTLMGQLADEYGR  79

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPL+L+T ST+IIPF +LA N SR  VY Y VLRT+S++I QG+IFC+++AY AD VE S
Sbjct  80   KPLILLTASTSIIPFAVLAWNNSRTAVYVYLVLRTLSFMIGQGTIFCLAIAYTADAVEPS  139

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             RAAAF  +TG FSA+H +G + +RFLPE +IF VS+ LLI   +YM + LVETV+
Sbjct  140  RRAAAFGIMTGIFSAAHTLGSVFSRFLPEKWIFEVSVVLLICSIIYMKIYLVETVQ  195



>ref|NP_001065767.2| Os11g0151500 [Oryza sativa Japonica Group]
 dbj|BAF27612.2| Os11g0151500, partial [Oryza sativa Japonica Group]
Length=447

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC G   +C EAIY+ GL QTV GIF+ V   ++GQL+D+YG
Sbjct  22   WVAEEMTVPVLVDVTTRALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYG  81

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+IIP+ +LA NKS+  VY + +LRT+S++I QG+I  ++V Y ADVV+ 
Sbjct  82   RKPLLLLTASTSIIPYGVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDP  141

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET++
Sbjct  142  SKRAFAFGCITGILSASHALGNGFSRFLPERWIFQVSVALLISSVIYMKISLVETLQ  198



>ref|NP_001140664.1| uncharacterized protein LOC100272739 precursor [Zea mays]
 gb|ACF84318.1| unknown [Zea mays]
Length=452

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDG-QSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            +AEEMT   LVD  T ALC     SC EA+Y+ GLQ +V GIF+ V   ++GQL+D+YGR
Sbjct  23   VAEEMTVPALVDKVTAALCPAADRSCPEALYLTGLQASVGGIFRTVGFTLMGQLADEYGR  82

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPL+L+T ST+IIPF +LA N SR  VYAY  LRT+S+++ QG+IFC+++AY AD VE S
Sbjct  83   KPLILLTASTSIIPFAVLAWNSSRTAVYAYLALRTLSFMVGQGTIFCLAIAYTADAVEPS  142

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKPP  655
             RAAAF ++TG FSA+H +G +L+RFLP  +IF VSI LLI   +Y+ + LVETV+ P
Sbjct  143  RRAAAFGFLTGIFSAAHTLGSVLSRFLPGRWIFEVSIVLLICSILYIKVYLVETVQRP  200



>ref|XP_010032091.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            M  +P+LGQL+D+YGRKP+LLV +ST++ PF +LA ++SRGFVYAYYVLRTISYI+SQGS
Sbjct  1    MFSIPILGQLADEYGRKPVLLVIISTSVFPFAMLAWDQSRGFVYAYYVLRTISYILSQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCISVAYAADVVE   RA+AFSWITG +SASHV+G+LLARFLPE YIF VSI LL+  P
Sbjct  61   IFCISVAYAADVVETGKRASAFSWITGLYSASHVLGNLLARFLPEKYIFDVSIALLLCCP  120

Query  614  VYMGLALVETVK  649
            +Y+   L ETV 
Sbjct  121  IYIYFFLRETVN  132



>emb|CDP20480.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLPVLGQLSDDYGRKPLLL+TVSTTI PF+LL I+KS+ FVYAYYVLRTIS+IISQGS
Sbjct  1    MVVLPVLGQLSDDYGRKPLLLITVSTTIFPFSLLIISKSKSFVYAYYVLRTISFIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI+ AY ADV+++S R     W+ G FSASHV+G++LARFLPED IF VSI  L F P
Sbjct  61   IFCIAAAYVADVIDDSKRTTGLCWMMGLFSASHVLGNVLARFLPEDSIF-VSIAFLTFCP  119

Query  614  VYMGLALVETV  646
            +YM L L ETV
Sbjct  120  LYMALFLPETV  130



>ref|XP_006589383.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Glycine max]
Length=375

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP+LGQLSD+YGRKPLLL+T+ST I PF LL  ++S  +VYAYYVLRTIS IISQGS
Sbjct  1    MVVLPLLGQLSDEYGRKPLLLITISTAIFPFVLLVWHQSEEYVYAYYVLRTISNIISQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCISVAYAADVV ES RAA F WITG  SASHV+GD+LA  LPE YIF VSI LL   P
Sbjct  61   IFCISVAYAADVVNESKRAAVFGWITGLLSASHVLGDVLAWSLPEKYIFAVSIVLLTSCP  120

Query  614  VYMGLALVETVKP  652
            VYM   LVETV P
Sbjct  121  VYMKFFLVETVIP  133



>gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sativa Japonica 
Group]
 gb|ABA91455.1| Major Facilitator Superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=1143

 Score =   200 bits (509),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQS-SCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W+AEEMT  VLVDVTT ALC G   +C EAIY+ GL QTV GIF+ V   ++GQL+D+YG
Sbjct  718  WVAEEMTVPVLVDVTTRALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYG  777

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+T ST+IIP+ +LA NKS+  VY + +LRT+S++I QG+I  ++V Y ADVV+ 
Sbjct  778  RKPLLLLTASTSIIPYGVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDP  837

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  ITG  SASH +G+  +RFLPE +IF VS+ LLI   +YM ++LVET++
Sbjct  838  SKRAFAFGCITGILSASHALGNGFSRFLPERWIFQVSVALLISSVIYMKISLVETLQ  894



>gb|EMS64155.1| Hippocampus abundant transcript-like protein 1 [Triticum urartu]
Length=447

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC--DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDY  295
            W+AEEMT  VLVDVTT +LC  DG +SC EAIY+ GL QTV GIF+ V   ++GQL+D+Y
Sbjct  18   WVAEEMTVPVLVDVTTASLCPGDGSTSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEY  77

Query  296  GRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVE  475
            GRKPLL++   T+IIP+++LA++ ++  VY Y V RT+S++I QG+I C+++AY AD+VE
Sbjct  78   GRKPLLILAAGTSIIPYSVLALSSTKVAVYVYLVTRTLSFMIGQGTITCLALAYTADLVE  137

Query  476  ESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
             S RA AF  +TG  SASH +G++ +RFLPE +IF VS+ LL+   VYM
Sbjct  138  PSKRAFAFGCMTGILSASHSLGNVFSRFLPEQWIFQVSVLLLVCSVVYM  186



>ref|XP_011024229.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVVLP+LGQL+D+YGRKPLLL+ VST+I PF +LA N+SR  VY YYVLRTIS+I+SQGS
Sbjct  1    MVVLPLLGQLADEYGRKPLLLIAVSTSIFPFAVLACNQSRDAVYVYYVLRTISFILSQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCI++AYAAD+++E NRA AFSWITGFFSASHVVG+LLARFLPE +IFVVSI LLIF  
Sbjct  61   IFCIAIAYAADIIKEENRATAFSWITGFFSASHVVGNLLARFLPEKFIFVVSIALLIFGS  120

Query  614  VYMGLALVETVK  649
            VYM   LVETV+
Sbjct  121  VYMYFFLVETVE  132



>ref|XP_003577047.1| PREDICTED: uncharacterized protein LOC100833312 [Brachypodium 
distachyon]
Length=451

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC-DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYG  298
            W AEEM   VLVDVTT ALC +  SSC EAIY+ G Q+TV GIF+ V   ++GQLSD+YG
Sbjct  19   WAAEEMAVPVLVDVTTAALCPETTSSCPEAIYLTGFQETVGGIFRAVGFTLMGQLSDEYG  78

Query  299  RKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEE  478
            RKPLLL+    ++ P  +LA++ ++  VYAY VLRT+ ++I +G++ C+++AY ADVVE 
Sbjct  79   RKPLLLLAAGASVFPCCVLALSSTKAAVYAYLVLRTLCFMIGKGTVSCLALAYTADVVEP  138

Query  479  SNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            S RA AF  +TG  SAS  +G++L+RFLPE ++F VS+ LLI   +YM + LVET++
Sbjct  139  SKRAFAFGCVTGINSASRALGNVLSRFLPERWVFKVSLVLLICSVLYMKIFLVETLQ  195



>ref|XP_010032085.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
 ref|XP_010032086.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            M  +P+LGQLSD+YGRKP+LL  ++T++ PF +LA ++SRGFVYAYYVLRTIS I+SQGS
Sbjct  1    MFSIPILGQLSDEYGRKPVLLAIIATSVFPFAMLAWSQSRGFVYAYYVLRTISNILSQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            I C+SVAYAADVVE   RA AFSWITG  SASHV+G+LLARFLPE YIF ++I LL+  P
Sbjct  61   ILCVSVAYAADVVESGKRAFAFSWITGLLSASHVLGNLLARFLPEKYIFDITIALLLCPP  120

Query  614  VYMGLALVETV  646
            +YM + L ETV
Sbjct  121  IYMYVFLRETV  131



>gb|KHN37832.1| hypothetical protein glysoja_016956 [Glycine soja]
Length=430

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 130/198 (66%), Gaps = 23/198 (12%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVV-------------  262
            W+A EMT  VLVDVTT+ALC G+S+CS+ IYING+ QT  G   + +             
Sbjct  41   WVAGEMTVFVLVDVTTSALCPGESTCSKVIYINGIHQTDGGTSTIQMSTAVNPLSLLPCP  100

Query  263  ---LPVLGQLSDDYGRK------PLLLVTVSTTIIPF-TLLAINKSRGFVYAYYVLRTIS  412
                P++  L+ +  R        + +  ++T ++ F  LLA N+S  FVYAYYVLRTIS
Sbjct  101  RPYFPLVCSLTSNAFRLVKIYHFNISVTKITTKLLNFIALLAWNQSEDFVYAYYVLRTIS  160

Query  413  YIISQGSIFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSI  592
             IISQGS+F IS+AY ADVV ES RAA FSWITG  SASHV+GD+LA FLPE YIFVVSI
Sbjct  161  NIISQGSVFYISLAYVADVVNESKRAAVFSWITGLLSASHVLGDVLALFLPEKYIFVVSI  220

Query  593  CLLIFVPVYMGLALVETV  646
             LLIF  VYM   LVETV
Sbjct  221  ALLIFCLVYMKFFLVETV  238



>gb|EMT19766.1| Hippocampus abundant transcript-like protein 1 [Aegilops tauschii]
Length=934

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 24/200 (12%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALC--DGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDY  295
            W+AEEMT  VLVDVTT ALC  DG +SC EAIY+ GL QTV GIF+ V   ++GQL+D+Y
Sbjct  18   WVAEEMTVPVLVDVTTAALCPGDGSTSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEY  77

Query  296  GRKPLLLVTVSTTIIPFT----------------------LLAINKSRGFVYAYYVLRTI  409
            GRKPLL++   T+IIP+                       +LA++ ++  VY Y V RT+
Sbjct  78   GRKPLLILAAGTSIIPYKDFYLLHQQSAFHDYCVHMLVAGVLALSSTKVAVYVYLVTRTL  137

Query  410  SYIISQGSIFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVS  589
            S++I QG+I C+++AY AD+VE S RA AF  +TG  SASH +G++ +RFLPE +IF VS
Sbjct  138  SFMIGQGTITCLALAYTADLVEPSKRAFAFGCMTGILSASHSLGNVFSRFLPEHWIFQVS  197

Query  590  ICLLIFVPVYMGLALVETVK  649
            + LL+   VYM + LVET++
Sbjct  198  VLLLVCSVVYMKICLVETLQ  217



>ref|XP_010312534.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312535.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312536.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=372

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +2

Query  254  MVVLPVLGQLSDDYGRKPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGS  433
            MVV+PVLGQL+D+YGRKPLLL+ VST I P  +LAI++S+GFVYAYYVLR IS+I+SQGS
Sbjct  1    MVVIPVLGQLADEYGRKPLLLLIVSTAIFPSAILAIDESKGFVYAYYVLRMISHIMSQGS  60

Query  434  IFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVP  613
            IFCIS AYAAD+++  +RAAAF W+ G  S SHV+G+ LAR LP  YIF VS+ LLI  P
Sbjct  61   IFCISAAYAADILDGRSRAAAFGWMHGILSLSHVLGNFLARLLPGTYIFEVSVALLIIAP  120

Query  614  VYMGLALVETVK  649
            +YM + L ETVK
Sbjct  121  MYMLIFLTETVK  132



>gb|AFK48179.1| unknown [Medicago truncatula]
Length=139

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
             LL+T+ST I PF LLA N+S  FVYAYYVLRTISYIIS+GSIFCISVAY ADVV E+ R
Sbjct  8    FLLLTMSTAIFPFALLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNENKR  67

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            AA F WITG FSASHVVG++LARFLP++YIFVVSI LLIF PVYM   LVETVK
Sbjct  68   AAVFGWITGLFSASHVVGNVLARFLPQNYIFVVSIALLIFCPVYMQFFLVETVK  121



>gb|KHN00908.1| Glycine-rich RNA-binding protein 2, mitochondrial [Glycine soja]
Length=763

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 114/175 (65%), Gaps = 42/175 (24%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            W+AEEMT SVLVDVTT+ALC G+S+CS+AIYING+QQT+VGIFKMVVLP+LGQLSD+YGR
Sbjct  143  WVAEEMTVSVLVDVTTSALCPGESTCSKAIYINGVQQTIVGIFKMVVLPLLGQLSDEYGR  202

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            KPLLL+T+ST I PF                                       DVV ES
Sbjct  203  KPLLLITISTAIFPF---------------------------------------DVVNES  223

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             RAA FSWITG  S   V+GD+LA  LPE YIF VSI LL F PVYM   LVETV
Sbjct  224  KRAAVFSWITGLLS---VLGDVLAWSLPEKYIFAVSIVLLTFSPVYMKFFLVETV  275



>ref|XP_002968361.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
 gb|EFJ30615.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
Length=440

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            +A  M    L DV   ALC GQ+ C+EAIY+ G+QQ V GI  M+V P+LG+LSD+YGRK
Sbjct  38   MATMMVIPALTDVLLGALCPGQAECNEAIYLTGIQQIVAGIGTMLVTPILGELSDEYGRK  97

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
            PLL++  S  ++P  +LA ++SR FVYAY V+ T+  I ++G I C+S AY +D +E   
Sbjct  98   PLLMIPFSAAVLPMAILAYSQSRPFVYAYMVVGTVVRIFAEGGITCLSFAYVSDCIERRY  157

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIF  580
            RA A   + G FS  +V+G LLAR L +D IF
Sbjct  158  RALAIGVLMGSFSVGYVIGILLARVLAQDQIF  189



>ref|XP_002965935.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
 gb|EFJ33355.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
Length=459

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            +A  M    L DV   ALC GQ+ C+EAIY+ G+QQ + GI  M+V P+LG+LSD+YGRK
Sbjct  38   MATMMVIPALTDVLLGALCPGQAECNEAIYLTGIQQIIAGIGTMLVTPILGELSDEYGRK  97

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
            PLL++  S  ++P  +LA ++SR FVYAY V+ T+  I ++G I C+S AY +D +E   
Sbjct  98   PLLMIPFSAAVLPMAILAYSQSRPFVYAYMVVGTVVRIFAEGGITCLSFAYVSDCIERRY  157

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIF  580
            RA A   + G FS  +V+G LLAR L +D IF
Sbjct  158  RALAIGVLMGSFSVGYVIGILLARVLAQDQIF  189



>gb|KDO84973.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
 gb|KDO84974.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
Length=396

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 0/174 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            +  M    + DVT +A+C G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   STSMVAPAITDVTMSAVCPGRDECSLAIYLSGFQQAIIGLGTLVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ +IIP  +LA ++SR F YAYYVLRT++ ++ +GSI C+S+AY AD V    R
Sbjct  80   LLTVPITLSIIPLAILAYSRSRNFFYAYYVLRTLTAMVCEGSIHCLSLAYVADNVPPGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            A+ F   +G  S + V G + ARF+     F  +    I   VYM + L E+V+
Sbjct  140  ASVFGIFSGIVSGAFVCGTISARFISTSAAFQAATAGSIISAVYMRIFLPESVR  193



>ref|XP_010100117.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
 gb|EXB81500.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
Length=425

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 111/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V++P++G+LSD YGRK LL 
Sbjct  24   MVVPAITDVTMSALCPGKDECSLAIYLTGFQQVIIGLGTLVMMPIVGKLSDKYGRKSLLT  83

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++ TIIP  +LA +++R F+YAYY  +T+  +IS GS+ C+++AY AD V E+ RA+A
Sbjct  84   MPMAFTIIPLGILACSRTRNFIYAYYAFKTLFAMISDGSVHCLALAYVADNVPEARRASA  143

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S   V G L ARFL     F V+  L +   VYM + L ++V
Sbjct  144  FGILSGISSCGFVCGTLTARFLSTASTFQVAASLAVVSLVYMRVFLPDSV  193



>ref|XP_006435264.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 ref|XP_006473723.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Citrus 
sinensis]
 gb|ESR48504.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 gb|KDO84972.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
Length=443

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 0/174 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            +  M    + DVT +A+C G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   STSMVAPAITDVTMSAVCPGRDECSLAIYLSGFQQAIIGLGTLVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ +IIP  +LA ++SR F YAYYVLRT++ ++ +GSI C+S+AY AD V    R
Sbjct  80   LLTVPITLSIIPLAILAYSRSRNFFYAYYVLRTLTAMVCEGSIHCLSLAYVADNVPPGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            A+ F   +G  S + V G + ARF+     F  +    I   VYM + L E+V+
Sbjct  140  ASVFGIFSGIVSGAFVCGTISARFISTSAAFQAATAGSIISAVYMRIFLPESVR  193



>ref|XP_010032089.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
Length=500

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  350  LLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGFFSAS  529
            +LA ++SRGFVYAYYVLRTISYI+SQGSIFCISVAYAADVVE   RA+AFSWITG +SAS
Sbjct  153  MLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETGKRASAFSWITGLYSAS  212

Query  530  HVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            HV+G+LLARFLPE YIF VSI LL+  P+Y+   L ETV 
Sbjct  213  HVLGNLLARFLPEKYIFDVSIALLLCCPIYIYFFLRETVN  252



>gb|KJB14351.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
 gb|KJB14352.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
Length=439

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  MT  V+VDVT +ALC G+  CS AI ++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ATFMTAPVIVDVTMSALCPGEIECSLAILLSGFQQAIIGLGSLVMMPLIGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ TIIP  +LA ++SR F YAYYV + ++ +  +GS+ C+S+AY AD V E  R
Sbjct  80   LLTLPITLTIIPLAILAYSRSRNFFYAYYVFKILTSMFCEGSVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S++ V G L  RFL     F V+  + +   VYM + L +++
Sbjct  140  ASAFGILSGIGSSAFVCGTLSTRFLSTASTFQVATAMGMLSAVYMRVFLPDSI  192



>gb|KJB14354.1| hypothetical protein B456_002G120900 [Gossypium raimondii]
Length=501

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  MT  V+VDVT +ALC G+  CS AI ++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  82   ATFMTAPVIVDVTMSALCPGEIECSLAILLSGFQQAIIGLGSLVMMPLIGNLSDKYGRKA  141

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ TIIP  +LA ++SR F YAYYV + ++ +  +GS+ C+S+AY AD V E  R
Sbjct  142  LLTLPITLTIIPLAILAYSRSRNFFYAYYVFKILTSMFCEGSVHCLSLAYVADNVPEGRR  201

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S++ V G L  RFL     F V+  + +   VYM + L +++
Sbjct  202  ASAFGILSGIGSSAFVCGTLSTRFLSTASTFQVATAMGMLSAVYMRVFLPDSI  254



>ref|XP_009767684.1| PREDICTED: uncharacterized protein LOC104218795 [Nicotiana sylvestris]
Length=438

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 112/165 (68%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C G+  CS AIY+ G+QQ +VG+  +V++P+LG LSD YGRK +L V ++ 
Sbjct  28   MTDITLSAICPGKDECSLAIYLTGIQQAIVGMGSLVMMPILGNLSDTYGRKVMLTVPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ F YAYYVLRT+  +I +GS+ C+++AY AD V ES RA+ F  ++
Sbjct  88   SIFPLVILAYSRTKYFFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S++ V G+L ARFL     F V+  + +   VYM + L E+V
Sbjct  148  GIASSAFVCGNLSARFLSTASTFQVAAAMAVIALVYMKMFLPESV  192



>ref|XP_004983780.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Setaria italica]
Length=364

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 95/143 (66%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M  SV+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  23   MVGSVITDVTMGALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLA  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV + ++ ++S GS+ C+S+AY AD V E+ RAAA
Sbjct  83   LPATASIVPLGILAYGRTKGYFYAYYVTKMLTAMVSDGSMMCLSLAYVADRVPEARRAAA  142

Query  497  FSWITGFFSASHVVGDLLARFLP  565
            F   TG  SA  V     ARFLP
Sbjct  143  FGVFTGVCSAGFVASTFAARFLP  165



>ref|XP_008791950.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Phoenix 
dactylifera]
Length=444

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 107/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            +VD+T  ALC G+  CS A+Y+ G+QQ + G+  ++V P++G LSD YGRK LL + ++T
Sbjct  28   IVDITMEALCPGRDQCSLAVYLGGVQQVITGLGTLIVTPLIGNLSDRYGRKALLALPMTT  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             IIP  +LA ++SR + YAYY+++ ++ +  +GS+ C+S+AY AD V E  RA AF   +
Sbjct  88   AIIPLAILAYDRSRAYFYAYYIIKMLTGMFCEGSMQCLSLAYVADKVGERRRATAFGVFS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  +A  V G L ARFL     F VS  + +   VYM L LVET +
Sbjct  148  GVSAAGFVSGTLSARFLSTSSTFQVSAIVAVIAAVYMRLFLVETDR  193



>ref|XP_002465000.1| hypothetical protein SORBIDRAFT_01g030220 [Sorghum bicolor]
 gb|EER91998.1| hypothetical protein SORBIDRAFT_01g030220 [Sorghum bicolor]
Length=447

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 107/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M   V+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  26   MVAPVMTDVTMAALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLA  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV +T++ ++++G++ C+S+AY AD V E+ RAAA
Sbjct  86   LPATASIVPLGILAYGRTKGYFYAYYVTKTLTAMVAEGTMMCLSLAYVADRVPETRRAAA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F   +G  SA  V   + ARFLP    F VS    +   VYM   L ET
Sbjct  146  FGVFSGVCSAGFVASTVAARFLPASSTFQVSAVAAVVTAVYMKAFLQET  194



>gb|KJB58030.1| hypothetical protein B456_009G190900 [Gossypium raimondii]
Length=388

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G+  CS AIYI+G QQ ++G+   V++P++G LSD YGRK 
Sbjct  20   ASFMVIPAITDVTMAALCPGRDECSLAIYISGFQQAIIGLGSFVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ TI P  +LA +++R F YAYY+L+ ++ +  +GS+ C+S+AY AD V E  R
Sbjct  80   LLTVPITLTIFPLAILAYSRTRSFFYAYYILKILTAMFCEGSVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S + V G L  RFL     F VS  + +   +YM + L +++
Sbjct  140  ASAFGILSGIGSCAFVCGTLSTRFLSTASTFQVSTAMAMLSAIYMRVFLPDSI  192



>ref|XP_006386158.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|ABK95031.1| unknown [Populus trichocarpa]
 gb|ERP63955.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=450

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V +P++G +SD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  I+P  +LA +++R F YAYYV+RT+  ++ +GS+ C+++AY AD V ES RA+ 
Sbjct  83   VPMSLIIVPSAILAYSRTRNFFYAYYVVRTLMAMVCEGSVQCLALAYVADNVPESRRAST  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G+L  RFL     F VS  + I   VYM   L E++
Sbjct  143  FGILSGIASSAFVCGNLSTRFLSTSSTFQVSALVAIAALVYMRFFLQESI  192



>ref|XP_004983779.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Setaria italica]
Length=435

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 95/143 (66%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M  SV+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  23   MVGSVITDVTMGALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLA  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV + ++ ++S GS+ C+S+AY AD V E+ RAAA
Sbjct  83   LPATASIVPLGILAYGRTKGYFYAYYVTKMLTAMVSDGSMMCLSLAYVADRVPEARRAAA  142

Query  497  FSWITGFFSASHVVGDLLARFLP  565
            F   TG  SA  V     ARFLP
Sbjct  143  FGVFTGVCSAGFVASTFAARFLP  165



>gb|KDO68188.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=273

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>gb|EMT05362.1| Hippocampus abundant transcript 1 protein [Aegilops tauschii]
Length=424

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 106/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M   V+ DVT  ALC GQ  CS AIY+ GLQQ + G+  +VV PV+G LSD YGRK LL 
Sbjct  24   MVAPVITDVTMAALCPGQDQCSLAIYLTGLQQAITGLGALVVTPVIGNLSDRYGRKALLA  83

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  ++A N++R + YA+Y+ +T++ ++S+G++ C+S+AY AD V E  RAAA
Sbjct  84   LPATLSIVPLAIMAFNQTRPYFYAFYIAKTLTAMVSEGAMMCLSLAYVADKVPEGRRAAA  143

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F   +G  +A  V G + ARFL     F V+    +   VY+   + ET
Sbjct  144  FGVFSGVCTAGFVGGTIAARFLSVSSTFQVATLASVAAAVYLRAFVQET  192



>gb|KHG11074.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=436

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  MT   +VDV  +ALC G+  CS AI ++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ATFMTAPAIVDVAMSALCPGEIECSLAILLSGFQQAIIGLGSLVMMPLIGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ TIIP  +LA ++SR F YAYYV + ++ +  +GS+ C+S+AY AD V E  R
Sbjct  80   LLTLPITLTIIPLAILAYSRSRNFFYAYYVFKILTSMFCEGSVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S++ V G L  RFL     F V+  + +   VYM + L +++
Sbjct  140  ASAFGILSGIGSSAFVCGTLSTRFLSTASTFQVATAMAMLSAVYMRVFLPDSI  192



>ref|XP_004238394.1| PREDICTED: uncharacterized protein LOC101248671 [Solanum lycopersicum]
Length=436

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 111/165 (67%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C GQ  CS AIY+ G+QQ +VG+  +V++PVLG LSD YGRK +L + ++ 
Sbjct  28   MTDITLSAICPGQDECSLAIYLTGVQQAIVGLGSLVMMPVLGNLSDTYGRKVMLTLPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ + YAYYVLRT+  +I +GS+ C++ AY AD V ES RA+ F  ++
Sbjct  88   SIFPLAILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLAFAYVADNVPESRRASVFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S++ V G+L ARFL     F V+  + +   VYM + L E++
Sbjct  148  GIASSAFVCGNLSARFLSTASTFQVAAAMAVIALVYMKMFLPESI  192



>ref|XP_010061116.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=443

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            +  M   V+ DVT +ALC GQ+ CS AIY++G+QQ +VG+  +V++P++G LSD YGRK 
Sbjct  20   SATMVAPVVTDVTVSALCPGQARCSLAIYLSGIQQAIVGLGSLVMMPLIGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  TIIP  +LA ++SR F Y YYV RT++ I  +GS+ C+++AY AD V    R
Sbjct  80   LLTIPLVFTIIPLAILAYSRSRNFFYLYYVFRTLTAIFCEGSVHCLALAYVADNVPAGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  SA+ V G+L  RFL     F V+  + +    YM   L ++V
Sbjct  140  ASAFGILSGIGSAAFVCGNLSTRFLSTPSTFQVATAVAVVALAYMRFFLPDSV  192



>gb|KJB58029.1| hypothetical protein B456_009G190900 [Gossypium raimondii]
Length=444

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G+  CS AIYI+G QQ ++G+   V++P++G LSD YGRK 
Sbjct  20   ASFMVIPAITDVTMAALCPGRDECSLAIYISGFQQAIIGLGSFVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ TI P  +LA +++R F YAYY+L+ ++ +  +GS+ C+S+AY AD V E  R
Sbjct  80   LLTVPITLTIFPLAILAYSRTRSFFYAYYILKILTAMFCEGSVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S + V G L  RFL     F VS  + +   +YM + L +++
Sbjct  140  ASAFGILSGIGSCAFVCGTLSTRFLSTASTFQVSTAMAMLSAIYMRVFLPDSI  192



>ref|XP_008236069.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=444

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + D+T  ALC GQ  CS AIY++G QQ ++G+  +V+ P++G LSD YGRK 
Sbjct  21   ASLMVIPAITDITMLALCPGQDECSLAIYLSGFQQAIIGLGTVVMTPLIGNLSDVYGRKS  80

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ +IIP  +LA ++   F YAY+ LRT++ ++ +GSI C+++AY AD V E  R
Sbjct  81   LLTVPLTLSIIPLVILAYSRETNFFYAYFALRTVTAMVCEGSINCLTLAYVADTVSEGER  140

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             +AF  + GF SAS V G L ARFL     F V+    +   +YM + L E++
Sbjct  141  VSAFGILAGFLSASFVCGTLAARFLSTASTFQVAAFASMLATIYMRVFLKESL  193



>ref|XP_011034951.1| PREDICTED: uncharacterized protein LOC105132907 isoform X1 [Populus 
euphratica]
Length=457

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            +  M    + DV  +ALC G+  CS AIY++GLQ+T++G+  +V +P++G +SD YGRK 
Sbjct  27   STSMVTPAVTDVFMSALCPGEDECSLAIYLSGLQKTIIGLGTLVTMPLIGNMSDKYGRKA  86

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V +S  I+P  +LA +++R F YAYYV+RT+  ++ +GS+ C+++AY AD V E+ R
Sbjct  87   LLTVPMSLIIVPSAILAYSRTRNFFYAYYVVRTLVSMVCEGSVQCLALAYVADNVPENRR  146

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+ F  +TG  S++ V G+L  RFL     F VS  + I   VYM   L +++
Sbjct  147  ASTFGILTGIASSAFVCGNLSTRFLSTSSTFQVSALVAIAALVYMRFFLQDSI  199



>ref|XP_006342087.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=438

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 112/165 (68%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C GQ  CS AIY+ G+QQ +VG+  +V++PVLG LSD YGRK +L + ++ 
Sbjct  28   MTDITLSAICPGQDECSLAIYLTGVQQAIVGLGSLVMMPVLGNLSDIYGRKVVLTLPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ + YAYYVLRT+  +I +GS+ C+++AY AD V ES RA+ F  ++
Sbjct  88   SIFPLAILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S++ V G+L ARFL     F V+  + +   VYM + L E++
Sbjct  148  GIASSAFVCGNLSARFLSTASTFQVAAAMAVIALVYMKMFLPESI  192



>ref|XP_011034952.1| PREDICTED: uncharacterized protein LOC105132907 isoform X2 [Populus 
euphratica]
Length=450

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V +P++G +SD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  I+P  +LA +++R F YAYYV+RT+  ++ +GS+ C+++AY AD V E+ RA+ 
Sbjct  83   VPMSLIIVPSAILAYSRTRNFFYAYYVVRTLVSMVCEGSVQCLALAYVADNVPENRRAST  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  +TG  S++ V G+L  RFL     F VS  + I   VYM   L +++
Sbjct  143  FGILTGIASSAFVCGNLSTRFLSTSSTFQVSALVAIAALVYMRFFLQDSI  192



>ref|XP_010266910.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Nelumbo 
nucifera]
Length=458

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 109/169 (64%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +A+C G+  CS AIY++G QQ + G+  +V++P+LG LSD+YGRK LL+
Sbjct  43   MVIPAITDVTMSAICPGKDECSIAIYLSGFQQAITGVGSLVMMPLLGNLSDEYGRKTLLI  102

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++  ++P  +LA ++++ F YAYYVL+T++ +I +GS+ C+S+AY AD V    R +A
Sbjct  103  LPMTLNVVPLAILACSRTKSFFYAYYVLKTLTAMICEGSVQCLSLAYVADNVPHGKRISA  162

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F  + G  SA+ V G L +RFL     F VS  + +   +YM   L E+
Sbjct  163  FGILAGTGSAAFVCGTLTSRFLSTSSTFQVSASVAVLAAMYMKAFLKES  211



>ref|XP_002510601.1| tetracycline transporter, putative [Ricinus communis]
 gb|EEF52788.1| tetracycline transporter, putative [Ricinus communis]
Length=442

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 111/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V++P++G LSD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLVGNLSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +S T+IP   LA +++  F YAYYV++T++ ++ +GS+ C+++AY AD V E+ RA+A
Sbjct  83   IPMSLTVIPLATLAYSRTTYFFYAYYVMKTLTAMVCEGSVHCLALAYVADNVPEARRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L  RFL     F VS  + +   VYM + L +++
Sbjct  143  FGILSGIGSSAFVCGTLSTRFLSTASTFQVSASMAVVAIVYMKVFLQDSI  192



>gb|KDO68187.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=357

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>ref|XP_002280708.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI37822.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT +ALC G+  CS AIY++G QQ ++G+  +V+ PV+G LSD+YGRK LL + ++ 
Sbjct  28   ITDVTMSALCPGKDECSLAIYLSGFQQAIIGLGTVVMTPVIGNLSDEYGRKALLTIPMAL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA +++    YAY+V+RT++ ++ +GSI C+++AY AD + E  RA+AF  ++
Sbjct  88   SIIPLAILAYSRTTTSFYAYFVIRTLTAMVGEGSINCLALAYVADNISEGQRASAFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SA+ V G L ARFL     F V+  + +   VYM + L ET
Sbjct  148  GVASAAFVCGTLAARFLSTASTFQVATLVSMIATVYMRVFLKET  191



>ref|XP_007201037.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
 gb|EMJ02236.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
Length=444

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 107/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + D+T  ALC GQ  CS AIY++G QQ ++G+  +V+ P++G LSD YGRK 
Sbjct  21   ASLMVIPAITDITMLALCPGQDECSLAIYLSGFQQAIIGLGTVVMTPLIGNLSDVYGRKS  80

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ +IIP  +LA ++   F YAY+ LRT++ ++ +GSI C+++AY AD V E  R
Sbjct  81   LLTVPLALSIIPLVILAYSRETNFFYAYFALRTVTAMVCEGSINCLTLAYVADTVSERER  140

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
              AF  + GF SAS V G L ARFL     F V+    +   +YM + L E++
Sbjct  141  VPAFGILAGFLSASFVCGTLAARFLSTASTFQVAAFASMLATIYMRVFLKESL  193



>ref|XP_011046630.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Populus 
euphratica]
Length=441

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  A+C G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ASLMVIPAITDVTMVAVCPGKDECSLAIYLSGFQQAIIGLGTVVMMPLIGNLSDQYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ +IIP  +LA +++  F YAYYVLRT++ +I +GSI C+++AY AD V E  R
Sbjct  80   LLTLPMTLSIIPLVILAYSRTTNFFYAYYVLRTLTAMICEGSINCLALAYVADNVLERQR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             +AF  ++G  +A+ V G L ARFL     F V+  + +   VYM + L E++
Sbjct  140  TSAFGILSGIATAAFVCGTLAARFLSTALTFQVAALVSMLAAVYMRIFLKESL  192



>ref|XP_010032087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
 ref|XP_010032088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
Length=361

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  335  IIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITG  514
            +I  T+LA ++SRGFVYAYYVLRTIS I+SQGSI C+SVAYAADVVE   RA AFSWITG
Sbjct  9    VITSTMLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITG  68

Query  515  FFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
              SASHV+G+LLARFLPE YIF ++I LL+  P+YM + L ETV
Sbjct  69   LLSASHVLGNLLARFLPEKYIFDITIALLLCPPIYMYVFLRETV  112



>ref|XP_009620054.1| PREDICTED: uncharacterized protein LOC104111941 [Nicotiana tomentosiformis]
Length=438

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 112/165 (68%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C G+  CS AIY+ G+QQ +VG+  +V++PVLG LSD YGRK +L V ++ 
Sbjct  28   MTDITLSAICPGKDECSLAIYLTGIQQAIVGMGSLVMMPVLGNLSDTYGRKIILTVPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ + YAYYVLRT+  +I +GS+ C+++AY AD V ES RA+ F  ++
Sbjct  88   SIFPLVILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S++ V G+L ARFL     F V+  + +   VYM + L +++
Sbjct  148  GIASSAFVCGNLSARFLSTASTFQVAAAMAVIALVYMKMFLPDSI  192



>ref|XP_010690317.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Beta 
vulgaris subsp. vulgaris]
Length=434

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC G+  CS AIY++G QQ V GI  +V+ P+LG LSD YGRK LL + ++ 
Sbjct  28   ITDVTMEALCPGKDECSLAIYLSGFQQAVSGIGSVVMTPLLGNLSDMYGRKALLTLPLTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I+P  +LA ++ R F YAYYVL+T++ +I +G+I C+S+AY AD + +  RA+AF  + 
Sbjct  88   YILPHVVLAYSRERSFFYAYYVLKTVASMICEGTINCLSLAYVADKIPQGKRASAFGVLA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SA+ V G L ARFLP    F  +    +    YM + L ET
Sbjct  148  GVTSAAFVCGTLTARFLPTAQTFQAAAVSSMAAAAYMRIFLKET  191



>gb|EYU37985.1| hypothetical protein MIMGU_mgv1a006613mg [Erythranthe guttata]
Length=437

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 108/174 (62%), Gaps = 0/174 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            AE M    + DVT  A+C G+  CS AIY+ G QQ + G+  ++++P++G LSD YGRK 
Sbjct  20   AELMVSPAIPDVTLAAVCPGKDECSAAIYLTGFQQAIAGVGSVIMMPLIGNLSDVYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V +  T IP  +LA  ++  F YAYY+L+T++ +I+Q  + C+++ Y AD V+E  R
Sbjct  80   LLSVPLVLTFIPLVVLAWKRTTNFFYAYYILKTLTAMITQSGVTCLALGYLADNVKEGKR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             +AF  + G  +A++V G L AR L    IF V+  + I   +YMG+ L ET +
Sbjct  140  VSAFGVLQGVSAAAYVGGTLAARLLSTTQIFQVAATISILAAIYMGVFLKETTR  193



>ref|XP_006486682.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>ref|XP_007017915.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY15140.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=520

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 110/173 (64%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  MT  V++DVT +ALC G+  C  AIY+ G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  97   ATFMTIPVMIDVTMSALCPGKIECYLAIYLTGFQQAIIGLGSLVMMPLVGNLSDKYGRKA  156

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ TIIP  +LA +++R F YAYYVL+ ++ +  +G++ C+S+AY AD V E  R
Sbjct  157  LLTVPMTLTIIPLAILAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRR  216

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             + F  ++G  S + V G L  RFL     F V+  + +   VYM + L +++
Sbjct  217  VSTFGILSGIGSCAFVCGTLSTRFLSTASTFQVATAMAMLSAVYMRIFLPDSI  269



>tpg|DAA46149.1| TPA: hypothetical protein ZEAMMB73_581598 [Zea mays]
Length=360

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M   V+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  32   MVAPVMTDVTMAALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLA  91

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V E+ RAAA
Sbjct  92   LPATASIVPLGILAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAA  151

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F   +G  SA  V G + ARFLP    F VS    +   VYM   L ET
Sbjct  152  FGVFSGVCSAGFVGGTVAARFLPVSSTFQVSAVAAVATAVYMKAFLQET  200



>ref|XP_002313691.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
 gb|EEE87646.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
Length=442

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 108/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  A+C GQ  CS AIY+ G QQ  +G+  +V+LP++G LSD YGRK LL 
Sbjct  23   MVLPAVTDVTMVAVCPGQDECSLAIYLTGFQQASIGMGTVVMLPLIGNLSDQYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++ +IIP  +LA +++ GF YAYY LRT++ +I +GSI C+++AY AD V E  R + 
Sbjct  83   LPMTLSIIPLVILAYSRTTGFFYAYYALRTLTAMICEGSIDCLALAYVADNVLERQRTSV  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  +A+ V G L ARFL     F V+  L +   VYM + L E++
Sbjct  143  FGILSGITTAALVCGTLAARFLSTALTFQVAALLSMLAAVYMRIFLEESL  192



>gb|EYU37986.1| hypothetical protein MIMGU_mgv1a006358mg [Erythranthe guttata]
Length=447

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 110/176 (63%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            + A  +    + DVT  A+C GQ  CS AIY+ G QQ + GI  +V++PV+G LSD YGR
Sbjct  18   YFASLLVNPTIADVTMEAVCPGQDECSLAIYLTGFQQAIAGIGAVVMMPVIGTLSDVYGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            K LL + ++ +I P  +LA+ ++  F YAYY L+T++ ++++G I C+S++Y AD V E 
Sbjct  78   KVLLTIPLTLSIFPLVILAVKRTTEFFYAYYALKTLTSMVTEGGIICLSLSYLADNVSEG  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R +AF  ++G  +A+ V G  +AR LP   IF V+  +     +YM + L ET++
Sbjct  138  KRVSAFGLLSGVVAAATVCGTFVARLLPTTQIFQVAAVVAFIAAIYMKIFLKETIR  193



>ref|XP_006486681.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Citrus sinensis]
 gb|KDO68184.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=445

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>ref|XP_010086842.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
 gb|EXB24040.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
Length=431

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC G+  CS AIY+ G QQ + G+  +V+ PV+G LSD YGRK LL + ++ 
Sbjct  28   ITDVTMTALCPGRDECSFAIYLTGFQQAITGLGMVVMTPVIGNLSDKYGRKSLLTLPLTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             IIP  +LA N++  F YAYYV++T++ ++ +GS  C+++AY AD + +  RA+AF  ++
Sbjct  88   NIIPLVILAYNRTTNFFYAYYVMKTLTAMVCEGSTNCLALAYVADHISDQGRASAFGIMS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SA+ V G L +RFLP    F V+    +   VYM + L E++
Sbjct  148  GVVSAAFVCGTLASRFLPTASTFQVAALASMTAAVYMRVFLEESL  192



>ref|XP_006655183.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Oryza 
brachyantha]
Length=439

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            +A  M    + DVT  ALC G+  CS AIY+ GLQQ + G+  +V  P++G LSD YGRK
Sbjct  17   LAAYMVAPAMTDVTMAALCPGRDECSLAIYLTGLQQAITGLGALVATPIVGNLSDRYGRK  76

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             LLL+  + +I+P  +LA N+++ F YAYYV RT++  +++GS+ C+S+AY AD V  S 
Sbjct  77   TLLLLPATASILPLVILACNRTKAFFYAYYVTRTLTATVAEGSMSCLSLAYVADKVPPSR  136

Query  485  RAAAFSWITGFFSASHVVGDLLARFL  562
            RAAAF   +G   A  V G + ARFL
Sbjct  137  RAAAFGVFSGVCVAGFVAGTVAARFL  162



>ref|XP_009802649.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=442

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 110/174 (63%), Gaps = 0/174 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  +    + D+T +ALC  Q  CS AIY++GLQQ ++G+  M+++P++G LSD YGRK 
Sbjct  21   ALNVVNPAMTDITMDALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKA  80

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL+V V+ +I+P  ++A  ++  + YAYYV+RT++ ++S   I C+ +AYAAD + E  R
Sbjct  81   LLIVPVTASILPSVIMAYRRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKR  140

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            A+A   + G  SA+++ G   ARFL    IF+VS        VYM + L ET +
Sbjct  141  ASAIGIVAGVGSAAYLCGTFAARFLSTAQIFLVSSISSTAAAVYMTIFLKETTR  194



>ref|XP_002306959.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
 gb|EEE93955.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
Length=447

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V++P++G +SD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLIGNMSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  I+P  +LA +++R F YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+A
Sbjct  83   VPLSLVIVPSAILAYSRTRNFFYAYYVVKTLIAMVCEGSVPCLALAYVADNVPEGRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G+L  RFL     F VS  + I   VYM   L +++
Sbjct  143  FGILSGIASSAFVCGNLSTRFLSTASTFQVSASVAIASLVYMRFFLQDSI  192



>gb|KDO68186.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=438

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>gb|KDO68183.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=484

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQR  142

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  143  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>gb|KDP36870.1| hypothetical protein JCGZ_08161 [Jatropha curcas]
Length=421

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +A+C G+  CS AIY++G QQ ++G+  ++++P++G LSD YGRK LL 
Sbjct  1    MVVPAITDVTMSAICPGRDECSLAIYLSGFQQAIIGLGTLLMMPLVGNLSDKYGRKALLT  60

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +   IIP   LA +++R F YAYYVLRT++ ++ +GS+ C+++AY AD V E  RA+A
Sbjct  61   VPLVLGIIPLVTLAYSRTRYFFYAYYVLRTLTAMVCEGSVHCLALAYVADNVPEGRRASA  120

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L  RFL     F V+  + I   VYM + L +++
Sbjct  121  FGILSGIGSSAFVCGTLSTRFLSTASTFQVAASVAIVALVYMKVFLQDSI  170



>ref|XP_006422528.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
 gb|ESR35768.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
Length=445

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK +L 
Sbjct  26   MVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  RA+A
Sbjct  86   LPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            F  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  146  FGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>ref|NP_001130498.1| tetracycline transporter protein [Zea mays]
 gb|ACF78738.1| unknown [Zea mays]
 gb|ACN25405.1| unknown [Zea mays]
 tpg|DAA46151.1| TPA: tetracycline transporter protein [Zea mays]
Length=458

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M   V+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  32   MVAPVMTDVTMAALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLA  91

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V E+ RAAA
Sbjct  92   LPATASIVPLGILAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAA  151

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F   +G  SA  V G + ARFLP    F VS    +   VYM   L ET
Sbjct  152  FGVFSGVCSAGFVGGTVAARFLPVSSTFQVSAVAAVATAVYMKAFLQET  200



>ref|XP_007017916.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY15141.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=443

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ATFMVIPAITDVTMAALCPGKEECSVAIYLSGFQQAIIGLGSLVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ TIIP  +LA +++R F YAYYVL+ ++ +  +G++ C+S+AY AD V E  R
Sbjct  80   LLTVPMTLTIIPLAILAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             + F  ++G  S + V G L  RFL     F V+  + +   VYM + L +++
Sbjct  140  VSTFGILSGIGSCAFVCGTLSTRFLSTASTFQVATAMAMLSAVYMRIFLPDSI  192



>ref|XP_007017917.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY15142.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=444

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ATFMVIPAITDVTMAALCPGKEECSVAIYLSGFQQAIIGLGSLVMMPLVGNLSDKYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL V ++ TIIP  +LA +++R F YAYYVL+ ++ +  +G++ C+S+AY AD V E  R
Sbjct  80   LLTVPMTLTIIPLAILAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             + F  ++G  S + V G L  RFL     F V+  + +   VYM + L +++
Sbjct  140  VSTFGILSGIGSCAFVCGTLSTRFLSTASTFQVATAMAMLSAVYMRIFLPDSI  192



>ref|XP_012073718.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Jatropha 
curcas]
Length=443

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +A+C G+  CS AIY++G QQ ++G+  ++++P++G LSD YGRK LL 
Sbjct  23   MVVPAITDVTMSAICPGRDECSLAIYLSGFQQAIIGLGTLLMMPLVGNLSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +   IIP   LA +++R F YAYYVLRT++ ++ +GS+ C+++AY AD V E  RA+A
Sbjct  83   VPLVLGIIPLVTLAYSRTRYFFYAYYVLRTLTAMVCEGSVHCLALAYVADNVPEGRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L  RFL     F V+  + I   VYM + L +++
Sbjct  143  FGILSGIGSSAFVCGTLSTRFLSTASTFQVAASVAIVALVYMKVFLQDSI  192



>ref|XP_011088646.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum 
indicum]
Length=439

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 110/174 (63%), Gaps = 0/174 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            +E M    + DVT +A+C G+  CS AIY+ G QQ + GI  ++++P++G LSD YGRK 
Sbjct  20   SELMVSPAIPDVTLSAVCPGKDECSPAIYLTGFQQAIAGIGSVIMMPLIGNLSDAYGRKN  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            ++ + +  +IIP  +LA  ++  F YAYY ++T + +++QG + C+++AY AD V E  R
Sbjct  80   MMAIPLLLSIIPLVVLAWKRTLTFFYAYYAIKTFTAMVTQGGVACLALAYLADNVSEGKR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             +AF  ++G  SA++V G L AR L    IF V+  L +   +YMG+ L ET +
Sbjct  140  ISAFGVLSGVTSAAYVGGTLAARLLSTAQIFQVAAILSMVAAIYMGVFLKETTR  193



>ref|XP_012077708.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Jatropha curcas]
Length=419

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 0/166 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DVT  ALC GQ  CS AIY+ G QQ + GI  +V+ P++G LSD YGRK +L + ++
Sbjct  50   VITDVTMLALCPGQDQCSLAIYLTGFQQAMTGIGSVVITPIIGNLSDQYGRKAMLTIPLT  109

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
             +I P  +LA +    F Y+YYVLRT++ ++S+ SI C++ AY AD + E  RA+AF   
Sbjct  110  VSIFPLAILAYSSETNFFYSYYVLRTLTAMVSESSIQCLAFAYVADNISERQRASAFGIQ  169

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            +G FS+S V G L AR L     F V+  + +   VYM + L + V
Sbjct  170  SGIFSSSFVAGTLAARLLSISLTFQVAALVSMVATVYMRIFLKDRV  215



>gb|KJB32680.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
 gb|KJB32682.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
Length=444

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT +ALC G   CS AIY++G QQ V+G+   +++P++G LSD YGRK LL + ++ 
Sbjct  29   ITDVTMSALCPGTDECSLAIYLSGFQQAVIGVGTALMMPLIGNLSDQYGRKSLLTLPMTL  88

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIPF +LA + +  + YAYY LRT++ +IS+GSI C+++AY AD + ++ RA+AF  + 
Sbjct  89   SIIPFAVLACSTATNYFYAYYTLRTLTAMISEGSINCLALAYLADNISDTQRASAFGILA  148

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S + V   L ARFL     F V+  + +   VYM + L E++
Sbjct  149  GISSGAFVFATLAARFLSAGSTFQVATFVSMLAVVYMRIFLEESI  193



>ref|XP_006422527.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
 gb|ESR35767.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
Length=484

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK +L 
Sbjct  26   MVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  RA+A
Sbjct  86   LPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            F  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  146  FGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  187



>emb|CAN64703.1| hypothetical protein VITISV_038996 [Vitis vinifera]
Length=408

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY+ G QQ ++G+  +V++P++G LSD YGRK LL 
Sbjct  23   MVIPAITDVTMAALCPGRDECSIAIYLTGFQQVIIGLGTLVMMPLVGNLSDMYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +  TIIP  +LA ++SR F YAY+VL+T++ ++ +GS+ C+++AY AD + E  RA+A
Sbjct  83   IPMCLTIIPLAILAWSRSRNFFYAYFVLKTLTSMVCEGSVHCLTLAYVADNIPEIRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L ARFL     F V+  +     VYM L L ++V
Sbjct  143  FGVLSGVGSSAFVCGTLSARFLKTSSTFQVAASVAAVAAVYMKLFLPDSV  192



>tpg|DAA46150.1| TPA: hypothetical protein ZEAMMB73_581598 [Zea mays]
Length=448

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M   V+ DVT  ALC G+  CS AIY+ GLQQ V G+  +V+ PV+G LSD YGRK LL 
Sbjct  32   MVAPVMTDVTMAALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLA  91

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V E+ RAAA
Sbjct  92   LPATASIVPLGILAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAA  151

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F   +G  SA  V G + ARFLP    F VS    +   VYM   L ET
Sbjct  152  FGVFSGVCSAGFVGGTVAARFLPVSSTFQVSAVAAVATAVYMKAFLQET  200



>gb|KCW51478.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=348

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  350  LLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGFFSAS  529
            +LA ++SRGFVYAYYVLRTIS I+SQGSI C+SVAYAADVVE   RA AFSWITG  SAS
Sbjct  1    MLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITGLLSAS  60

Query  530  HVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            HV+G+LLARFLPE YIF ++I LL+  P+YM + L ETV
Sbjct  61   HVLGNLLARFLPEKYIFDITIALLLCPPIYMYVFLRETV  99



>ref|XP_002284761.1| PREDICTED: hippocampus abundant transcript 1 protein [Vitis vinifera]
 emb|CBI18912.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G+  CS AIY+ G QQ ++G+  +V++P++G LSD YGRK 
Sbjct  20   ATFMVIPAITDVTMAALCPGRDECSIAIYLTGFQQVIIGLGTLVMMPLVGNLSDMYGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  TIIP  +LA ++SR F YAY+VL+T++ ++ +GS+ C+++AY AD + E  R
Sbjct  80   LLTIPMCLTIIPLAILAWSRSRNFFYAYFVLKTLTSMVCEGSVHCLTLAYVADNIPEIRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++G  S++ V G L ARFL     F V+  +     VYM L L ++V
Sbjct  140  ASAFGVLSGVGSSAFVCGTLSARFLKTSSTFQVAASVAAVAAVYMKLFLPDSV  192



>ref|XP_012077706.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Jatropha curcas]
 ref|XP_012077707.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Jatropha curcas]
 gb|KDP33281.1| hypothetical protein JCGZ_13068 [Jatropha curcas]
Length=447

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 0/166 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DVT  ALC GQ  CS AIY+ G QQ + GI  +V+ P++G LSD YGRK +L + ++
Sbjct  28   VITDVTMLALCPGQDQCSLAIYLTGFQQAMTGIGSVVITPIIGNLSDQYGRKAMLTIPLT  87

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
             +I P  +LA +    F Y+YYVLRT++ ++S+ SI C++ AY AD + E  RA+AF   
Sbjct  88   VSIFPLAILAYSSETNFFYSYYVLRTLTAMVSESSIQCLAFAYVADNISERQRASAFGIQ  147

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            +G FS+S V G L AR L     F V+  + +   VYM + L + V
Sbjct  148  SGIFSSSFVAGTLAARLLSISLTFQVAALVSMVATVYMRIFLKDRV  193



>gb|KHG18467.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=443

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            ++DVT  ALC G   CS AIY++G QQ ++G+   +++P++G LSD YGRK LL + ++ 
Sbjct  29   IIDVTMFALCPGTDECSLAIYLSGFQQAIIGLGTALMMPIIGNLSDQYGRKALLTLPMTL  88

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA N++  + YAY+  +T++ ++ QGSI C+++AY AD +    RA+AF  + 
Sbjct  89   SIIPLAILACNRTTNYFYAYFAFKTLTDMVCQGSINCLALAYLADNISYRQRASAFGILA  148

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SA++V G L ARFL     F V+  + +F  VYM + L E++
Sbjct  149  GVTSAAYVCGTLAARFLSTGLAFQVATFVSLFAVVYMRIFLEESI  193



>ref|XP_011045660.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=442

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 109/173 (63%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  A+C GQ  CS AIY+ G QQ ++G+  +V+LP++G LSD +GRK 
Sbjct  20   ASLMVLPAVTDVTMVAVCPGQDECSLAIYLTGFQQAIIGMGTVVMLPLIGNLSDQHGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ +IIP  +LA +++ GF YAYY LRT++ +I +GSI C+++AY AD V E  R
Sbjct  80   LLTLPLTLSIIPLAILAYSRTTGFFYAYYALRTLTAMICEGSIECLALAYVADNVLERQR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             + F  + G  +A+ V G L ARFL     F V+  + +   VYM + + E++
Sbjct  140  TSVFGILAGMATAALVCGTLAARFLSTALTFQVAALVSMLAAVYMRIFVEESL  192



>ref|XP_011045668.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=422

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 109/173 (63%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  A+C GQ  CS AIY+ G QQ ++G+  +V+LP++G LSD +GRK 
Sbjct  20   ASLMVLPAVTDVTMVAVCPGQDECSLAIYLTGFQQAIIGMGTVVMLPLIGNLSDQHGRKA  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + ++ +IIP  +LA +++ GF YAYY LRT++ +I +GSI C+++AY AD V E  R
Sbjct  80   LLTLPLTLSIIPLAILAYSRTTGFFYAYYALRTLTAMICEGSIECLALAYVADNVLERQR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
             + F  + G  +A+ V G L ARFL     F V+  + +   VYM + + E++
Sbjct  140  TSVFGILAGMATAALVCGTLAARFLSTALTFQVAALVSMLAAVYMRIFVEESL  192



>ref|XP_004290751.1| PREDICTED: uncharacterized protein LOC101295772 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  A+C G+ SCS AIY+ G QQ ++G+  +V+ PV+G LSD YGRK LL   ++ 
Sbjct  48   ITDVTIAAVCPGRESCSLAIYLTGFQQAMIGMGTVVMNPVIGNLSDLYGRKALLTFPLTL  107

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA ++   F YA+Y+LRT++ +  +GS+ C+++AY AD + E  R + F  + 
Sbjct  108  SIIPLAILAYSQETNFFYAFYLLRTLTAMTCEGSVNCLALAYLADNIPEKERVSTFGILA  167

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            GF SAS V G L+ARFLP    F V+    +   VYM + L E+
Sbjct  168  GFTSASFVCGTLVARFLPTSLTFQVAALGSMMAAVYMRIFLKES  211



>ref|XP_010943478.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Elaeis 
guineensis]
Length=443

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC G+  CS AIY++G QQ + G+  ++V P++G LSD YGRK LL + ++T
Sbjct  28   ITDITVEALCPGRDECSLAIYLSGFQQVITGLGTLMVTPLIGNLSDRYGRKALLTLPMTT  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             IIP  +LA ++SR + Y YY+++  + I  +GS+ C+S+AY AD V E  RA+AF  ++
Sbjct  88   AIIPLAILAYDRSRVYFYIYYIVKMFTGIFCEGSMQCLSLAYVADKVGEQRRASAFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  +A  V G  +ARFL     F VS  + +    YM L L ET
Sbjct  148  GVSAAGFVSGTFVARFLSTSSTFQVSATVAVIAAAYMRLFLAET  191



>ref|XP_010028772.1| PREDICTED: uncharacterized protein LOC104418982 [Eucalyptus grandis]
Length=440

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 112/174 (64%), Gaps = 0/174 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            +A  M    + DVT +ALC G+  CS AIY++GLQQ +VG   +++ P++G LSD+YGRK
Sbjct  19   MASFMVVPAITDVTMSALCPGKDECSLAIYLSGLQQAIVGFGTVILTPLIGNLSDEYGRK  78

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             LL + ++  IIP  +LA ++   F YAY+VLRT++ I+ +G+I C+++AY AD V  + 
Sbjct  79   ALLTIPMTAAIIPLVILAYSRETKFFYAYFVLRTLAAIVGEGTIICLALAYVADNVPGTE  138

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            R +AF  ++G  SA+ V G L ARF+     F V+  + +   VYM + L E++
Sbjct  139  RVSAFGILSGVLSAAFVFGTLAARFISTALTFQVAAAVSMVAVVYMRIFLKESI  192



>ref|XP_007136127.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
 gb|ESW08121.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
Length=433

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIY+ G QQ ++G+  +V++P+LG  SD YGRK +L 
Sbjct  23   MVVPAITDVTMAALCPGQDECSLAIYLTGFQQAMIGVGTLVMMPLLGNFSDKYGRKAILK  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +  TIIP  +LA N+++ F Y YYV + +  ++ +GS+ C+++AY AD + ES R+ A
Sbjct  83   VPMILTIIPTGILAYNRTKKFFYVYYVFKILISMVCEGSVPCLALAYVADNIPESGRSTA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  I+G  SA+ V   L ARFL     F VS  + +   VYM L L ++V
Sbjct  143  FGIISGIGSAAFVCATLSARFLSTAQTFQVSTLIAVIGAVYMQLFLRDSV  192



>gb|EYU40457.1| hypothetical protein MIMGU_mgv1a021568mg [Erythranthe guttata]
Length=438

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (61%), Gaps = 0/176 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            + A  +    + DVT   +C G+  CS AIY+ G QQ V G+  +V++P++G LSD YGR
Sbjct  18   YFASLLVNPTIADVTMECVCPGKDECSLAIYLTGFQQAVGGLGAVVIMPLIGNLSDSYGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            K LL + ++ +IIPF +LA+ ++    Y YYVL+T++ ++S+G + C+S++Y AD V E 
Sbjct  78   KVLLTIPLTLSIIPFAILALKRTTQSFYVYYVLKTLTSMVSEGGVMCLSLSYLADNVSEG  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             R +AF  + G  S + V G + AR LP   IF V+    I   VYM   L +T++
Sbjct  138  KRVSAFGLLAGVVSVATVCGTIAARLLPTPQIFQVAAVASIVATVYMRAFLEDTIR  193



>ref|XP_009776326.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
sylvestris]
 ref|XP_009776327.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
sylvestris]
Length=440

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 108/168 (64%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + D+T +A+C G+  CS AIY+ G Q  ++G+  ++++PVLG LSD YGRK +L 
Sbjct  25   MVIPAITDITMSAICPGKDECSLAIYLTGFQHAIIGLGSLIIMPVLGNLSDTYGRKVMLT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V ++ +I P  +LA ++++ F YAYYVLRT+  ++ +G++ C+++AY ADVV ES RA+ 
Sbjct  85   VPLTLSIFPLVILAYSRTKYFFYAYYVLRTLVAMVCEGNVHCLALAYVADVVPESRRASV  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
            F  ++G  S++ V G+L  RFL     F V+  + +   VY  + L E
Sbjct  145  FGVLSGIASSAFVCGNLSTRFLSTASTFQVAATVAVIALVYTRMFLPE  192



>ref|XP_009775454.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Nicotiana 
sylvestris]
Length=449

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC  Q  CS AIY++G QQ ++G+  M++LP+LG LSD YGRK LL V V+ 
Sbjct  28   ITDITVGALCPAQDECSLAIYLSGFQQAILGLGSMLMLPLLGHLSDIYGRKALLTVPVAA  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I+P  +LAI +S  + YAYY ++T + ++S   I C+S+AYAA  + E  R +A   + 
Sbjct  88   AIVPSVILAIGRSTNYFYAYYAIKTFTGMVSDNGIECLSIAYAAASISEEKRVSAIGAVA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SA+++ G + ARFL   +IF+V+    +   +YM + L ET
Sbjct  148  GIGSAAYLFGTMAARFLSTAHIFLVAAISSMVAAIYMRIFLEET  191



>ref|XP_009624104.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 109/168 (65%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + D+T +A+C G+  CS AIY+ G Q  ++G+  ++++PVLG LSD YGRK +L+
Sbjct  25   MVIPAITDITMSAICPGKDECSLAIYLTGFQHAIIGLGSLIIMPVLGNLSDTYGRKVMLM  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V ++ +I P  +LA ++++ F YAYYVLRT+  ++ +G++ C+++AY ADVV +S RA+ 
Sbjct  85   VPLTLSIFPLVILAYSRTKYFFYAYYVLRTLVAMVCEGNVHCLALAYVADVVPKSRRASV  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
            F  ++G  S++ V G+L  RFL     F V+  + +   VY  + L E
Sbjct  145  FGVLSGIASSAFVCGNLSTRFLSTASTFQVAATVAVIALVYTRMFLPE  192



>ref|XP_008382447.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Malus domestica]
 ref|XP_008382448.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Malus domestica]
Length=442

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC G+  CS AIY++G QQ ++G+  +V+ PV+G LSD YGRK LL + +  
Sbjct  28   ITDITVLALCPGRDECSLAIYLSGFQQAIIGVGTVVMTPVIGNLSDVYGRKSLLTIPMIL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  ++A ++   F YAYYVLRT++ ++ + SI C+++AY AD V E  R +AF+ + 
Sbjct  88   SIIPLVIMAYSRETSFFYAYYVLRTVTAMVGEASITCLALAYVADNVAERERISAFAILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SA+ V G L ARFL     F V+    I   VYMG+ L E++
Sbjct  148  GITSAAIVCGTLAARFLSAASTFQVAAFASILSTVYMGIFLKESL  192



>ref|XP_004248636.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=444

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC  Q  CS AIY++G QQ ++G+  M++LP+LG LSD YGRK LL V V+ 
Sbjct  30   ITDITVGALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAA  89

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LAI +S  + YAYY ++T + ++S   I C+S+AYAA  + E  R +A  ++ 
Sbjct  90   SIIPSVILAIGRSTNYFYAYYAVKTFTGMVSDNGIECLSIAYAAANISEEKRVSAIGFVA  149

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SA+ ++G + ARFL    IF+V+    +   +YM + + ET
Sbjct  150  GIGSAASLLGTMAARFLSTAQIFLVAALSSMIATIYMRIFVKET  193



>ref|XP_009588093.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=442

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +ALC  Q  CS AIY++GLQQ ++G+  M+++P++G LSD YGRK LL+V V+ 
Sbjct  29   MTDITMDALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKALLIVPVTA  88

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I+P  ++A  ++  + YAYYV+RT++ ++S   I C+ +AYAAD + E  RA+A   + 
Sbjct  89   SILPSVIMAYKRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKRASAIGVVA  148

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA++  G    RFL    IF+VS        VYM + L ET +
Sbjct  149  GVGSAAYFCGTFAVRFLSTAQIFLVSSISSTAAAVYMTIFLKETTR  194



>gb|KJB15873.1| hypothetical protein B456_002G200900 [Gossypium raimondii]
Length=494

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            ++DVT  +LC G   CS AIY++G QQ ++G+   +++P++G LSD YGRK LL + ++ 
Sbjct  80   IIDVTMFSLCPGTDECSLAIYLSGFQQAIIGLGTALMMPIIGNLSDQYGRKALLTLPMTL  139

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA N++  + YAY+  +T++ ++ QGSI C+++AY AD +    RA+AF  + 
Sbjct  140  SIIPLAILACNRTTNYFYAYFAFKTLTDMVCQGSINCLALAYLADNISYRQRASAFGILA  199

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SA++V G L ARFL     F V+  + +F  VYM + L E++
Sbjct  200  GVTSAAYVCGTLAARFLSTGLAFQVATFVSLFAVVYMRIFLEESI  244



>ref|XP_009588092.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=457

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +ALC  Q  CS AIY++GLQQ ++G+  M+++P++G LSD YGRK LL+V V+ 
Sbjct  29   MTDITMDALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKALLIVPVTA  88

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I+P  ++A  ++  + YAYYV+RT++ ++S   I C+ +AYAAD + E  RA+A   + 
Sbjct  89   SILPSVIMAYKRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKRASAIGVVA  148

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA++  G    RFL    IF+VS        VYM + L ET +
Sbjct  149  GVGSAAYFCGTFAVRFLSTAQIFLVSSISSTAAAVYMTIFLKETTR  194



>ref|XP_009355593.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009355595.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X2 [Pyrus x bretschneideri]
Length=442

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 107/165 (65%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC G+  CS AIY++G QQ ++G+  +V+ PV+G LSD YGRK LL + ++ 
Sbjct  28   ITDITMLALCPGRDECSLAIYLSGFQQAIIGVGTVVMTPVIGNLSDVYGRKSLLTIPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  ++A ++   F YAYYVLRT++ ++ + SI C+++AY AD V E  R +AF+ + 
Sbjct  88   SIIPLVIMACSRETSFFYAYYVLRTVTALVGETSINCLALAYVADNVSERERISAFAILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SA+ V G L ARFL    IF V+    I   VYM + L E++
Sbjct  148  GITSAAIVCGTLAARFLTTASIFQVAAFASILSTVYMRIFLKESL  192



>gb|KCW55587.1| hypothetical protein EUGRSUZ_I01458 [Eucalyptus grandis]
Length=517

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 112/174 (64%), Gaps = 0/174 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            +A  M    + DVT +ALC G+  CS AIY++GLQQ +VG   +++ P++G LSD+YGRK
Sbjct  96   MASFMVVPAITDVTMSALCPGKDECSLAIYLSGLQQAIVGFGTVILTPLIGNLSDEYGRK  155

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             LL + ++  IIP  +LA ++   F YAY+VLRT++ I+ +G+I C+++AY AD V  + 
Sbjct  156  ALLTIPMTAAIIPLVILAYSRETKFFYAYFVLRTLAAIVGEGTIICLALAYVADNVPGTE  215

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            R +AF  ++G  SA+ V G L ARF+     F V+  + +   VYM + L E++
Sbjct  216  RVSAFGILSGVLSAAFVFGTLAARFISTALTFQVAAAVSMVAVVYMRIFLKESI  269



>ref|XP_009124111.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Brassica rapa]
Length=434

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G   CS AIY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMA  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P  +LA ++     Y YYVL+T + I  +GS+FC+++AY AD V E++RA+AF  +
Sbjct  90   LNILPLAILAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V  +  ARFL     F V+  + IF  VYM + L ++++
Sbjct  150  TGIGSCAFVCANCCARFLSTTATFQVATTVAIFSTVYMRIFLPDSIR  196



>gb|KHN20137.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 104/169 (62%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIYI G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  23   MVVPAITDVTMAALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +  TIIP  +LA ++++ F Y YYV + +  +I +GS+ C+ +AY AD + ES R+ A
Sbjct  83   VPMILTIIPVGILAYSRTKKFFYVYYVFKILISMICEGSVPCLGLAYVADNIPESGRSTA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F  ++G  SA+ V G L ARFL     F VS  + +   +YM   L ++
Sbjct  143  FGILSGIASAAFVCGTLSARFLSTALTFQVSTLIAVIGALYMQFFLRDS  191



>ref|XP_006342707.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=440

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C G+  CS AIY+ G+Q  ++G+  ++++PVLG LSD +GRK +L++ ++ 
Sbjct  30   ITDITMSAICPGKDECSIAIYLTGIQHAIIGLGSLIIMPVLGNLSDTHGRKVMLMLPLTL  89

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ + YAYYVL+T+  I+ +G++ C+++AY ADVV ES RA+ F  ++
Sbjct  90   SIFPLVILAYSRTKYYFYAYYVLKTLVAIVCEGNVHCLALAYVADVVPESRRASVFGVLS  149

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  S++ V G+L  RFL     F V+  + +   VY  + L E +K
Sbjct  150  GIASSAFVCGNLSTRFLSTASTFQVAATVAVIALVYTRMFLPEPLK  195



>ref|XP_009124113.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Brassica rapa]
Length=445

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G   CS AIY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMA  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P  +LA ++     Y YYVL+T + I  +GS+FC+++AY AD V E++RA+AF  +
Sbjct  90   LNILPLAILAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V  +  ARFL     F V+  + IF  VYM + L ++++
Sbjct  150  TGIGSCAFVCANCCARFLSTTATFQVATTVAIFSTVYMRIFLPDSIR  196



>emb|CDY02382.1| BnaA02g22910D [Brassica napus]
Length=438

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G   CS AIY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMA  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P  +LA ++     Y YYVL+T + I  +GS+FC+++AY AD V E++RA+AF  +
Sbjct  90   LNILPLAILAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V  +  ARFL     F V+  + IF  VYM + L ++++
Sbjct  150  TGIGSCAFVCANCCARFLSTTATFQVATTVAIFSTVYMRIFLPDSIR  196



>ref|XP_003527649.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
Length=432

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 104/169 (62%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIYI G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  23   MVVPAITDVTMAALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +  TIIP  +LA ++++ F Y YYV + +  +I +GS+ C+ +AY AD + ES R+ A
Sbjct  83   VPMILTIIPVGILAYSRTKKFFYVYYVFKILISMICEGSVPCLGLAYVADNIPESGRSTA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F  ++G  SA+ V G L ARFL     F VS  + +   +YM   L ++
Sbjct  143  FGILSGIASAAFVCGTLSARFLSTALTFQVSTLIAVIGALYMQFFLRDS  191



>gb|KDO68185.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=444

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 1/165 (1%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT  ALC G   CS AIY++G QQ ++G+  +V++PV+G LSD YGRK 
Sbjct  23   ATMMVVPAITDVTMMALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKA  82

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + ++ +IIP  +LA  +S  F YAYY LRT++ ++ +GSI C+++AY AD + E  R
Sbjct  83   MLTLPLTLSIIPLAILAYRRSISFFYAYYALRTLTAMVCEGSINCLALAY-ADNISERQR  141

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYM  622
            A+AF  + G  SAS V G L ARFL     F  +  + +    YM
Sbjct  142  ASAFGILLGVLSASFVCGTLAARFLSTTSAFQAATIVSMLAAAYM  186



>ref|XP_004500910.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X5 [Cicer arietinum]
Length=395

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIY+ G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  25   MVHPAITDVTMAALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  IIP  +LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++A
Sbjct  85   VPMSLMIIPLGILAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L ARFL     F VS  + +   VYM + L ++V
Sbjct  145  FGILSGIGSSAFVCGTLAARFLSTAQTFQVSTFVAVIGAVYMQIFLRDSV  194



>ref|XP_010061115.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW68014.1| hypothetical protein EUGRSUZ_F01701 [Eucalyptus grandis]
Length=443

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  A+C G   CS AIY++G QQ +VG+  +V++P++G LSD YGRK LL 
Sbjct  23   MVIPAITDVTMAAICPGMDECSLAIYLSGFQQAIVGLGSLVMMPLIGNLSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +  TIIP  +LA ++SR F Y YYV RT++ I  +GS+ C+++AY AD V    RA+A
Sbjct  83   IPLVFTIIPLAILAYSRSRNFFYLYYVFRTLTAIFCEGSVHCLALAYVADNVPAGRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  SA+ V G+L  RFL     F V+  + +    YM   L ++V
Sbjct  143  FGILSGIGSAAFVCGNLSTRFLSTPSTFQVATAVAVVALAYMRFFLPDSV  192



>emb|CDP07341.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 111/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +A+C G+  CS AIY++G QQ ++G+  +V++P++G LSD YGRK +L 
Sbjct  24   MVIPAITDVTMSAVCPGKDECSLAIYLSGFQQAIIGLGSLVMMPLVGNLSDRYGRKVMLT  83

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V ++ +I P  +LA ++++GF YAY VLRT+  ++++GS+ C+++AY AD V ES R + 
Sbjct  84   VPMTLSIFPLAVLAYSRTKGFFYAYCVLRTLISMLTEGSVQCLALAYVADNVPESKRVSI  143

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S + V G+L  RFL    +F V+    +   VYM + L E++
Sbjct  144  FGILSGIASCAFVCGNLSTRFLSTSAVFQVAAGGTVISLVYMRMFLPESM  193



>ref|XP_009400334.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY++G+ Q + G+  +VV P++G LSD YGRK LL 
Sbjct  23   MVIPAITDVTIEALCPGRDQCSLAIYLSGINQAITGLGTLVVTPLVGNLSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +++ I+P  +LA  +SR  +YAY+V++ +S + S GS+ C+S+AY AD V E  RA+A
Sbjct  83   LPMTSAIVPLVVLACGRSRTHLYAYFVIKMVSGMFSDGSMQCLSLAYVADKVCERRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F  ++G  +A  V G + ARFLP  + F VS  +     VYM + L ET
Sbjct  143  FGVLSGVSAAGFVSGTVAARFLPTSHTFQVSASVAAVAAVYMRVFLEET  191



>ref|XP_012077712.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Jatropha curcas]
Length=422

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 0/174 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            ++  M   V+ DVT  ALC GQ  CS AIY++G QQ + GI  +V+ P++G LSD YGRK
Sbjct  20   LSASMVLPVITDVTMLALCPGQDHCSIAIYLSGFQQAMTGIGSVVITPIIGNLSDQYGRK  79

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             +L + ++ +I P  +LA +    F Y+YYVLR ++ ++S  SI+C+++AY AD + E  
Sbjct  80   AMLTIPLTVSIFPLAILAYSSETNFFYSYYVLRILTAMVSGSSIYCLALAYVADNISERQ  139

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            RA+AF  ++G   AS V G L AR L     F V+  + +   VYM + L + V
Sbjct  140  RASAFGILSGIALASSVAGILAARLLSTSLTFKVAAFVSMVAAVYMRIFLKDRV  193



>ref|XP_012077711.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Jatropha curcas]
Length=437

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 0/174 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            ++  M   V+ DVT  ALC GQ  CS AIY++G QQ + GI  +V+ P++G LSD YGRK
Sbjct  20   LSASMVLPVITDVTMLALCPGQDHCSIAIYLSGFQQAMTGIGSVVITPIIGNLSDQYGRK  79

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             +L + ++ +I P  +LA +    F Y+YYVLR ++ ++S  SI+C+++AY AD + E  
Sbjct  80   AMLTIPLTVSIFPLAILAYSSETNFFYSYYVLRILTAMVSGSSIYCLALAYVADNISERQ  139

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            RA+AF  ++G   AS V G L AR L     F V+  + +   VYM + L + V
Sbjct  140  RASAFGILSGIALASSVAGILAARLLSTSLTFKVAAFVSMVAAVYMRIFLKDRV  193



>ref|XP_012077709.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Jatropha curcas]
 ref|XP_012077710.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Jatropha curcas]
 gb|KDP33282.1| hypothetical protein JCGZ_13069 [Jatropha curcas]
Length=451

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 106/175 (61%), Gaps = 0/175 (0%)
 Frame = +2

Query  125  IAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRK  304
            ++  M   V+ DVT  ALC GQ  CS AIY++G QQ + GI  +V+ P++G LSD YGRK
Sbjct  20   LSASMVLPVITDVTMLALCPGQDHCSIAIYLSGFQQAMTGIGSVVITPIIGNLSDQYGRK  79

Query  305  PLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESN  484
             +L + ++ +I P  +LA +    F Y+YYVLR ++ ++S  SI+C+++AY AD + E  
Sbjct  80   AMLTIPLTVSIFPLAILAYSSETNFFYSYYVLRILTAMVSGSSIYCLALAYVADNISERQ  139

Query  485  RAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            RA+AF  ++G   AS V G L AR L     F V+  + +   VYM + L + V 
Sbjct  140  RASAFGILSGIALASSVAGILAARLLSTSLTFKVAAFVSMVAAVYMRIFLKDRVS  194



>ref|XP_004500908.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X3 [Cicer arietinum]
Length=439

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIY+ G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  25   MVHPAITDVTMAALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  IIP  +LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++A
Sbjct  85   VPMSLMIIPLGILAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L ARFL     F VS  + +   VYM + L ++V
Sbjct  145  FGILSGIGSSAFVCGTLAARFLSTAQTFQVSTFVAVIGAVYMQIFLRDSV  194



>ref|XP_011458698.1| PREDICTED: uncharacterized protein LOC101306408 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=432

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  A+C  + SCS AIY+ G QQ ++G+  +V+ PV+G LSD YGRK LL   ++ 
Sbjct  47   ITDVTVAAVCPSRESCSLAIYLTGFQQAIIGLGTVVMNPVIGNLSDLYGRKALLTFPLTL  106

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA ++   F YA++VLRT++ +  +GS+ C+++AY AD + E  R + F  + 
Sbjct  107  SIIPLAILAFSRETNFFYAFFVLRTLTAMTCEGSVNCLALAYIADNISEKERVSTFGILA  166

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            G  SAS V G L+AR LP    F V+    +   VYM + L ET  P
Sbjct  167  GCTSASFVCGTLVARILPTSSTFQVAALASMMAAVYMRIFLKETRLP  213



>ref|XP_004500906.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Cicer arietinum]
Length=466

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIY+ G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  25   MVHPAITDVTMAALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  IIP  +LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++A
Sbjct  85   VPMSLMIIPLGILAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G L ARFL     F VS  + +   VYM + L ++V
Sbjct  145  FGILSGIGSSAFVCGTLAARFLSTAQTFQVSTFVAVIGAVYMQIFLRDSV  194



>ref|XP_004291324.1| PREDICTED: uncharacterized protein LOC101296167 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY+ G QQ +VG+  +V++P++G LSD +GRK LL 
Sbjct  26   MVIPAITDVTMTALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKFGRKALLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +  TIIP  +LA +++R F YAY+V +T++ ++ +GS+ C+++AY AD V E  RA+ 
Sbjct  86   LPMIFTIIPLGILAYSRTRNFFYAYFVAKTLTAMVCEGSVHCLALAYVADNVPEGRRAST  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  SA+ V G L  RF+    +F V+  + +   +YM + L E++
Sbjct  146  FGILSGISSAAFVCGTLFTRFVSTPSMFQVATSVAVVAVMYMRIFLPESI  195



>ref|XP_011458697.1| PREDICTED: uncharacterized protein LOC101306408 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=450

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  A+C  + SCS AIY+ G QQ ++G+  +V+ PV+G LSD YGRK LL   ++ 
Sbjct  47   ITDVTVAAVCPSRESCSLAIYLTGFQQAIIGLGTVVMNPVIGNLSDLYGRKALLTFPLTL  106

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA ++   F YA++VLRT++ +  +GS+ C+++AY AD + E  R + F  + 
Sbjct  107  SIIPLAILAFSRETNFFYAFFVLRTLTAMTCEGSVNCLALAYIADNISEKERVSTFGILA  166

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            G  SAS V G L+AR LP    F V+    +   VYM + L ET  P
Sbjct  167  GCTSASFVCGTLVARILPTSSTFQVAALASMMAAVYMRIFLKETRLP  213



>ref|XP_009783818.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Nicotiana sylvestris]
Length=313

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G LSD YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  +++ F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVAAVYMQIFLEDT  191



>gb|KJB32681.1| hypothetical protein B456_005G255500 [Gossypium raimondii]
Length=443

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 108/165 (65%), Gaps = 1/165 (1%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT +ALC G   CS AIY++G QQ V+G+   +++P++G LSD YGRK LL + ++ 
Sbjct  29   ITDVTMSALCPGTDECSLAIYLSGFQQ-VIGVGTALMMPLIGNLSDQYGRKSLLTLPMTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIPF +LA + +  + YAYY LRT++ +IS+GSI C+++AY AD + ++ RA+AF  + 
Sbjct  88   SIIPFAVLACSTATNYFYAYYTLRTLTAMISEGSINCLALAYLADNISDTQRASAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  S + V   L ARFL     F V+  + +   VYM + L E++
Sbjct  148  GISSGAFVFATLAARFLSAGSTFQVATFVSMLAVVYMRIFLEESI  192



>ref|XP_004292638.2| PREDICTED: uncharacterized protein LOC101306408 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  A+C  + SCS AIY+ G QQ ++G+  +V+ PV+G LSD YGRK LL   ++ 
Sbjct  47   ITDVTVAAVCPSRESCSLAIYLTGFQQAIIGLGTVVMNPVIGNLSDLYGRKALLTFPLTL  106

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA ++   F YA++VLRT++ +  +GS+ C+++AY AD + E  R + F  + 
Sbjct  107  SIIPLAILAFSRETNFFYAFFVLRTLTAMTCEGSVNCLALAYIADNISEKERVSTFGILA  166

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVKP  652
            G  SAS V G L+AR LP    F V+    +   VYM + L ET  P
Sbjct  167  GCTSASFVCGTLVARILPTSSTFQVAALASMMAAVYMRIFLKETRLP  213



>ref|XP_011088647.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Sesamum indicum]
Length=443

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 111/174 (64%), Gaps = 0/174 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            + A  +    + DVT  A+C G+  CS AIY++G QQ + GI  +VV+P++G LSD YGR
Sbjct  18   YFASLVVNPTIADVTMEAVCPGKDECSLAIYLSGFQQAIAGIGSVVVMPLIGFLSDTYGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            K LL + ++ +I P  +LA+ ++  F Y YYVL+T++ ++++G + C++++Y AD V E 
Sbjct  78   KVLLTIPMTLSIFPLVILAVRRTTEFFYVYYVLKTLTAMVTEGGVICLALSYLADNVSEG  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             R +AF  ++G  +A+ V G L+AR LP   IF ++  + +   VYM + L +T
Sbjct  138  KRVSAFGLLSGVTAAATVCGTLVARLLPTTRIFQLAAVVAVVAAVYMKIFLKDT  191



>ref|XP_011003093.1| PREDICTED: uncharacterized protein LOC105109921 [Populus euphratica]
Length=447

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V++P++G +SD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLIGNMSDKYGRKALLT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +S  I+P  +LA +++R   YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+A
Sbjct  83   VPLSLVIVPSAILAYSRTRYSFYAYYVVKTLIAMVCEGSVPCLALAYVADNVPEGRRASA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G+L  RFL     F VS  + +   VYM   L +++
Sbjct  143  FGILSGIASSAFVCGNLSTRFLSTASTFQVSASVAVASLVYMRFFLQDSI  192



>gb|AES74091.2| MFS transporter [Medicago truncatula]
Length=434

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 106/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M +  + DVT  ALC GQ  CS AIY+ G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  25   MVQPAITDVTMAALCPGQDECSIAIYLTGFQQAMIGMGTLVMMPILGDLSDKYGRKAILT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + ++  IIP  +LA ++++ F Y YYV + I  +I  G + C+++AY AD V E  R++A
Sbjct  85   LPMTLMIIPLGILAYSRTKTFFYVYYVFKIIINMICDGCVPCLALAYVADNVPEGRRSSA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S++ V G + ARFL     F VS  + +   VYM + L ++V
Sbjct  145  FGVLSGIGSSAFVCGTVAARFLSAAQTFQVSTFVAVLGAVYMQIFLRDSV  194



>ref|XP_006360887.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Solanum tuberosum]
Length=444

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC  Q  CS AIY++G QQ ++G+  M++LP+LG LSD YGRK LL V V+ 
Sbjct  30   ITDITVGALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAA  89

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LAI +S  + Y YY ++T + ++S   I C+S+AYAA  + E  R +A  ++ 
Sbjct  90   SIIPSVILAIGRSTNYFYVYYAVKTFTGMVSDSGIECLSIAYAAANISEEKRVSAIGFVA  149

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SA+ ++G + ARFL    IF+++    +   +YM + + ET
Sbjct  150  GIGSAASLLGTMAARFLSTAQIFLIAAISSMVATIYMRIFVKET  193



>emb|CAN70291.1| hypothetical protein VITISV_019346 [Vitis vinifera]
Length=494

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT +ALC G+  CS AIY++G QQ ++G+  +V+ PV+G LSD+YGRK LL + ++ 
Sbjct  28   ITDVTMSALCPGKDECSLAIYLSGFQQAIIGLGTVVMTPVIGNLSDEYGRKALLTIPMAL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LA +++    YAY+V+RT++ ++ +GSI C+++AY AD + E  RA+AF  ++
Sbjct  88   SIIPLAILAYSRTTTSFYAYFVIRTLTAMVGEGSINCLALAYVADNISEGQRASAFGVLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVV  586
            G  SA+ V G L ARFL     F V
Sbjct  148  GVASAAFVCGTLAARFLSTASTFQV  172



>ref|XP_009783817.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Nicotiana sylvestris]
Length=355

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G LSD YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  +++ F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVAAVYMQIFLEDT  191



>ref|XP_004253206.1| PREDICTED: uncharacterized protein LOC101250386 [Solanum lycopersicum]
Length=440

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C G+  CS AIY+ G+Q T++G+  ++++P+LG LSD +GRK +L++ ++ 
Sbjct  30   ITDITMSAICPGKDECSIAIYLTGIQHTLIGLGSLIIMPLLGNLSDTHGRKVMLMLPLTL  89

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +I P  +LA ++++ + YAYYVL+T+  I+ +G++ C+++AY ADVV E++RA+ F  ++
Sbjct  90   SIFPLVILAYSRTKYYFYAYYVLKTLVAIVCEGNVHCLALAYVADVVPENHRASVFGVLS  149

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
            G  S++ V G+L  RFL     F V+  + I   VY  + L E
Sbjct  150  GIASSAFVCGNLSTRFLSVASTFQVAAIVAIIALVYTRMFLPE  192



>ref|XP_010539088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Tarenaya hassleriana]
Length=438

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY++G QQ V G+  ++++P++G LSD YGRK LL 
Sbjct  26   MVIPAITDVTMAALCPGEDECSLAIYLSGFQQAVSGLGSLLMMPIVGTLSDTYGRKALLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +S  I+P   LA +++    Y YYVL+T++  + +GS+ C+++AY AD V E  RA+A
Sbjct  86   LPMSLAILPLASLAYSRTTTTFYVYYVLKTLTSTVCEGSVHCLALAYVADNVSEQRRASA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S + V G L ARFL     F V+  + +   VYM L L +++
Sbjct  146  FGILSGIGSCAFVCGTLSARFLSTSATFQVAATVAVLSTVYMRLFLPDSI  195



>ref|XP_010539087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=450

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY++G QQ V G+  ++++P++G LSD YGRK LL 
Sbjct  26   MVIPAITDVTMAALCPGEDECSLAIYLSGFQQAVSGLGSLLMMPIVGTLSDTYGRKALLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +S  I+P   LA +++    Y YYVL+T++  + +GS+ C+++AY AD V E  RA+A
Sbjct  86   LPMSLAILPLASLAYSRTTTTFYVYYVLKTLTSTVCEGSVHCLALAYVADNVSEQRRASA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  S + V G L ARFL     F V+  + +   VYM L L +++
Sbjct  146  FGILSGIGSCAFVCGTLSARFLSTSATFQVAATVAVLSTVYMRLFLPDSI  195



>ref|XP_010327393.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327394.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327395.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
Length=473

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T  ALC  Q  CS AIY++G QQ ++G+  M++LP+LG LSD YGRK LL V V+ 
Sbjct  30   ITDITVGALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAA  89

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            +IIP  +LAI +S  + YAYY ++T + ++S   I C+S+AYAA  + E  R +A  ++ 
Sbjct  90   SIIPSVILAIGRSTNYFYAYYAVKTFTGMVSDNGIECLSIAYAAANISEEKRVSAIGFVA  149

Query  512  GFFSASHVVGDLLARFLPEDYIFVV  586
            G  SA+ ++G + ARFL    IF+V
Sbjct  150  GIGSAASLLGTMAARFLSTAQIFLV  174



>ref|XP_009783816.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=429

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G LSD YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  +++ F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVAAVYMQIFLEDT  191



>gb|EEE63183.1| hypothetical protein OsJ_17992 [Oryza sativa Japonica Group]
Length=401

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC GQ  CS AIY+ GLQQ + G+  +V  P++G LSD YGRK LLL
Sbjct  21   MVAPAMTDVTMDALCPGQDECSLAIYLTGLQQAITGLGALVATPIVGNLSDKYGRKALLL  80

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA N+++ F YAYY+ R ++ ++++GS+ C+S+AY AD V  S RAAA
Sbjct  81   LPATASILPLVILACNRTKAFFYAYYITRMVTAMVAEGSMHCLSLAYVADKVPPSRRAAA  140

Query  497  FSWITG  514
            F   +G
Sbjct  141  FGVFSG  146



>ref|XP_009783815.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Nicotiana sylvestris]
Length=433

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G LSD YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  +++ F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVAAVYMQIFLEDT  191



>gb|EEC78948.1| hypothetical protein OsI_19397 [Oryza sativa Indica Group]
Length=401

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC GQ  CS AIY+ GLQQ + G+  +V  P++G LSD YGRK LLL
Sbjct  21   MVAPAMTDVTMDALCPGQDECSLAIYLTGLQQAITGLGALVATPIVGNLSDKYGRKALLL  80

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +I+P  +LA N+++ F YAYY+ R ++ ++++GS+ C+S+AY AD V  S RAAA
Sbjct  81   LPATASILPLVILACNRTKAFFYAYYITRMVTAMVAEGSMHCLSLAYVADKVPPSRRAAA  140

Query  497  FSWITG  514
            F   +G
Sbjct  141  FGVFSG  146



>ref|XP_003523261.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
 gb|KHN45961.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 104/170 (61%), Gaps = 0/170 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC GQ  CS AIYI G QQ ++G+  +V++P+LG LSD YGRK +L 
Sbjct  23   MVVPAITDVTMAALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + +  TIIP  +LA ++++ F Y YYV + +  ++ +GS+ C+++AY AD V ES R+  
Sbjct  83   LPMILTIIPVGILAYSRTKKFFYVYYVFKILISMVCEGSVPCLALAYVADNVPESGRSTV  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            F  ++G  SA+ V   L ARFL     F VS  + +   +YM   L ++V
Sbjct  143  FGILSGIGSAAFVCATLSARFLSSALTFQVSTLIAVIGALYMQFFLRDSV  192



>ref|XP_010494158.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Camelina sativa]
Length=423

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  L I   VYM L L ++++
Sbjct  150  TGIASCAFVCATLCARFLSIATTFQVAATLAILSTVYMRLLLPDSIQ  196



>ref|XP_010315398.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Solanum lycopersicum]
Length=346

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C  Q  CS AIY++G QQ ++G+  M+++P++G LSD YGRK LL + V+ 
Sbjct  28   ITDITMDAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I P  ++A  ++  + YAYYV+RT++ ++S   I CIS+AYAAD + E NRA+A + + 
Sbjct  88   LIFPSVIMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA+ +  + + RFL    IF+VS        +YM + L + + 
Sbjct  148  GVGSAAFLCSNFVVRFLSTAQIFLVSSISSSAALLYMTIFLKDNIN  193



>ref|XP_010494156.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Camelina sativa]
Length=435

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  L I   VYM L L ++++
Sbjct  150  TGIASCAFVCATLCARFLSIATTFQVAATLAILSTVYMRLLLPDSIQ  196



>ref|XP_010494157.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Camelina sativa]
Length=432

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  L I   VYM L L ++++
Sbjct  150  TGIASCAFVCATLCARFLSIATTFQVAATLAILSTVYMRLLLPDSIQ  196



>ref|XP_010494154.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
 ref|XP_010494155.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
Length=438

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  L I   VYM L L ++++
Sbjct  150  TGIASCAFVCATLCARFLSIATTFQVAATLAILSTVYMRLLLPDSIQ  196



>ref|XP_010315397.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Solanum lycopersicum]
Length=355

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C  Q  CS AIY++G QQ ++G+  M+++P++G LSD YGRK LL + V+ 
Sbjct  28   ITDITMDAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I P  ++A  ++  + YAYYV+RT++ ++S   I CIS+AYAAD + E NRA+A + + 
Sbjct  88   LIFPSVIMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA+ +  + + RFL    IF+VS        +YM + L + + 
Sbjct  148  GVGSAAFLCSNFVVRFLSTAQIFLVSSISSSAALLYMTIFLKDNIN  193



>ref|XP_002301947.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|EEE81220.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=474

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 24/194 (12%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ ++G+  +V +P++G +SD YGRK LL 
Sbjct  23   MVIPAITDVTMSALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLT  82

Query  317  VTVSTTIIPF------------------------TLLAINKSRGFVYAYYVLRTISYIIS  424
            V +S  I+P                         T+LA +++R F YAYYV+RT+  ++ 
Sbjct  83   VPMSLIIVPSGWGFSTLWLVSRYLIVNIYKLLQSTILAYSRTRNFFYAYYVVRTLMAMVC  142

Query  425  QGSIFCISVAYAADVVEESNRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLI  604
            +GS+ C+++AY AD V ES RA+ F  ++G  S++ V G+L  RFL     F VS  + I
Sbjct  143  EGSVQCLALAYVADNVPESRRASTFGILSGIASSAFVCGNLSTRFLSTSSTFQVSALVAI  202

Query  605  FVPVYMGLALVETV  646
               VYM   L E++
Sbjct  203  AALVYMRFFLQESI  216



>ref|XP_010315396.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=364

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C  Q  CS AIY++G QQ ++G+  M+++P++G LSD YGRK LL + V+ 
Sbjct  28   ITDITMDAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I P  ++A  ++  + YAYYV+RT++ ++S   I CIS+AYAAD + E NRA+A + + 
Sbjct  88   LIFPSVIMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA+ +  + + RFL    IF+VS        +YM + L + + 
Sbjct  148  GVGSAAFLCSNFVVRFLSTAQIFLVSSISSSAALLYMTIFLKDNIN  193



>gb|KGN62272.1| hypothetical protein Csa_2G347110 [Cucumis sativus]
Length=425

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT +ALC GQ  CS AIY+ G Q  V+GI  ++++P+LG LSD  GRK 
Sbjct  20   ATMMIVPAITDVTMSALCPGQDECSLAIYLTGFQHAVMGIGALLMMPLLGNLSDKLGRKT  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  T++P  +L   +SR   Y Y+VL+ ++ I+ +GS+ C++VAYAAD V E  R
Sbjct  80   LLTIPMILTVVPLGILGYGRSRNLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++   S++ V G L ARFL     F V+        VYM + L ++V
Sbjct  140  ASAFGLLSAVGSSAFVCGTLCARFLSISSTFQVAAFTAAVAVVYMKIFLADSV  192



>ref|XP_003535759.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 104/165 (63%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G QQ + G+  +V+ P++G LSD YGRK LL + ++ 
Sbjct  28   ITDVTMAALCPGQDQCSLAIYLSGFQQAMAGVGSVVMTPLIGNLSDRYGRKALLTLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C+++AY AD V +  R +AF  + 
Sbjct  88   SVIPQVILAYSRDTQFFYAYYVVKTLAAMAGEGSFHCLALAYVADKVPDGKRTSAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SAS V G L ARFL     F V+  L +   VYM + L ++V
Sbjct  148  GVGSASFVGGTLAARFLSTALTFQVASVLSMVALVYMRIFLKDSV  192



>ref|XP_003555206.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 104/165 (63%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G QQ + G+  +V+ P++G LSD YGRK LL + ++ 
Sbjct  28   ITDVTMAALCPGQDQCSLAIYLSGFQQAMAGVGSVVMTPLIGNLSDRYGRKALLTLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C+++AY AD V +  R +AF  + 
Sbjct  88   SVIPQVILAYSRDTQFFYAYYVVKTLAAMAGEGSFHCLALAYVADKVPDGKRTSAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SAS V G L ARFL     F V+  L +   VYM + L ++V
Sbjct  148  GVGSASFVGGTLAARFLSTALTFQVASVLSMVALVYMRIFLKDSV  192



>ref|XP_004231065.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Solanum lycopersicum]
Length=375

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C  Q  CS AIY++G QQ ++G+  M+++P++G LSD YGRK LL + V+ 
Sbjct  28   ITDITMDAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I P  ++A  ++  + YAYYV+RT++ ++S   I CIS+AYAAD + E NRA+A + + 
Sbjct  88   LIFPSVIMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA+ +  + + RFL    IF+VS        +YM + L + + 
Sbjct  148  GVGSAAFLCSNFVVRFLSTAQIFLVSSISSSAALLYMTIFLKDNIN  193



>ref|XP_011649471.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X2 [Cucumis sativus]
Length=437

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT +ALC GQ  CS AIY+ G Q  V+GI  ++++P+LG LSD  GRK 
Sbjct  20   ATMMIVPAITDVTMSALCPGQDECSLAIYLTGFQHAVMGIGALLMMPLLGNLSDKLGRKT  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  T++P  +L   +SR   Y Y+VL+ ++ I+ +GS+ C++VAYAAD V E  R
Sbjct  80   LLTIPMILTVVPLGILGYGRSRNLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++   S++ V G L ARFL     F V+        VYM + L ++V
Sbjct  140  ASAFGLLSAVGSSAFVCGTLCARFLSISSTFQVAAFTAAVAVVYMKIFLADSV  192



>gb|EYU37987.1| hypothetical protein MIMGU_mgv1a019548mg, partial [Erythranthe 
guttata]
Length=432

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 103/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            + A  +    + DVT  A+C GQ  CS AIY+ G QQ + GI  + V+P++G LSD YGR
Sbjct  18   YFASVLVNPTIADVTMEAVCPGQDECSLAIYLTGFQQAIAGIGSVFVMPLIGNLSDSYGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            K LL + +   I P  +LA+ ++  F Y YYV++ ++ ++++G + C+S+ Y AD V E 
Sbjct  78   KVLLTIPLIVAIFPPAILAVRRTTEFFYVYYVMKILTAVVTEGGVICLSLGYLADNVSEG  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
             R +AF  ++G  +A+ V G L AR LP + IF V+  +     VYM + L E
Sbjct  138  KRVSAFGLLSGVVAAATVCGTLTARLLPTNQIFKVAAVIAALAAVYMKIFLKE  190



>gb|KFK32943.1| hypothetical protein AALP_AA6G309500 [Arabis alpina]
Length=436

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 104/167 (62%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS AIY++GLQQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLAIYLSGLQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYV +T + I+ +GS+FC+++AY AD + E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTTFYVYYVFKTFTSIVCEGSVFCLALAYVADNIPEGRRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  + +   VYM + L  +++
Sbjct  150  TGISSCAFVCATLCARFLSTAATFQVATTMAVLSTVYMRVFLPVSIR  196



>ref|XP_011649470.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X1 [Cucumis sativus]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT +ALC GQ  CS AIY+ G Q  V+GI  ++++P+LG LSD  GRK 
Sbjct  20   ATMMIVPAITDVTMSALCPGQDECSLAIYLTGFQHAVMGIGALLMMPLLGNLSDKLGRKT  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  T++P  +L   +SR   Y Y+VL+ ++ I+ +GS+ C++VAYAAD V E  R
Sbjct  80   LLTIPMILTVVPLGILGYGRSRNLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++   S++ V G L ARFL     F V+        VYM + L ++V
Sbjct  140  ASAFGLLSAVGSSAFVCGTLCARFLSISSTFQVAAFTAAVAVVYMKIFLADSV  192



>ref|XP_008445314.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=438

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 103/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT +ALC GQ  CS AIY  G QQ V GI  ++++P+LG LSD  GRK 
Sbjct  21   ATMMIVPAITDVTMSALCPGQDECSLAIYFTGFQQVVTGIGALLIMPLLGNLSDKLGRKT  80

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            LL + +  T++P  +L   +SR   Y Y+VL+ ++ I+ +GS+ C++VAYAAD V E  R
Sbjct  81   LLTIPMILTVVPLGILGYGRSRTLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRR  140

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++   S++ V G L ARFL     F V+        VYM + L ++V
Sbjct  141  ASAFGLLSAVGSSAFVCGTLCARFLSIPSTFQVAALTAAVAAVYMRIFLTDSV  193



>gb|KEH44396.1| MFS transporter [Medicago truncatula]
Length=361

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G QQ ++GI  ++  P++G LSD YGRK L+ + ++ 
Sbjct  28   ITDVTMAALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + 
Sbjct  88   SLIPQAILAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SAS V G L ARFL     F V+    +   VYM + L E+
Sbjct  148  GVGSASFVGGTLAARFLSAALTFQVASVSSMIGLVYMRIFLKES  191



>ref|XP_006280482.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
 gb|EOA13380.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
Length=438

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 103/166 (62%), Gaps = 0/166 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY++GLQQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VMTDVSMAALCPGKDECSLVIYLSGLQQIITGVGSLMMMPLVGSLSDKHGRKCLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   +A ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA++F  +
Sbjct  90   LNILPLATMAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASSFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            TG  S + V   L ARFL     F V+  + I   +YM L L E++
Sbjct  150  TGIASCAFVCATLCARFLSIATTFQVAATMAILSTIYMRLFLPESI  195



>ref|XP_009617454.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Nicotiana tomentosiformis]
Length=355

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G L D YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  ++  F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVASVYMQIFLEDT  191



>ref|XP_007142795.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
 gb|ESW14789.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
Length=443

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 104/165 (63%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G+QQ + G+  +V+ P++G LSD YGRK L+ + ++ 
Sbjct  28   ITDVTMAALCPGQDQCSLAIYLSGIQQAMAGVGSVVMTPLIGNLSDRYGRKALITLPLTL  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C++ AY AD V +  R +AF  + 
Sbjct  88   SVIPSVILAYSRETRFFYAYYVVKTLASMAGEGSFHCLAFAYVADKVPDGKRTSAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SAS VVG L ARFL     F V+    +   +YM + L ++V
Sbjct  148  GVGSASFVVGTLAARFLSTALTFQVAAVTSMIALMYMRIFLKDSV  192



>ref|XP_003570066.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Brachypodium 
distachyon]
Length=458

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 0/143 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  A+C G+  CS AIY++G Q  + G+  +VV PV+G LSD YGRK L+ + V+ 
Sbjct  28   ITDVTMEAVCPGRDECSVAIYLSGFQNAITGLGALVVTPVVGNLSDRYGRKALMTLPVTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I+P  +LA N+S  + Y YYV + ++ I  +GS+ C+S+AY AD V    RAAAF  ++
Sbjct  88   AILPLFILACNRSEAYFYVYYVAKIVAGIFCEGSMHCLSLAYVADQVGTRRRAAAFGLLS  147

Query  512  GFFSASHVVGDLLARFLPEDYIF  580
            G  +A  V G L ARFLP    F
Sbjct  148  GVSAAGFVSGTLTARFLPTSSTF  170



>ref|XP_004497200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cicer 
arietinum]
Length=445

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY+ G Q  ++G+  +V  P++G LSD YGRK L+ + ++ 
Sbjct  28   ITDVTMAALCPGQDECSLAIYLTGFQHAMIGVGSVVTTPLIGNLSDRYGRKALITLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA +++  F YAYYV++T++ I  +GS  C+++AY AD V    RA+AF  + 
Sbjct  88   SLIPQAILAYSRATKFFYAYYVVKTLAAIAGEGSFHCLALAYVADKVPVGKRASAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            G  SAS V G L ARFL     F V+    +   VYM + L E++
Sbjct  148  GVGSASFVGGTLAARFLSPALTFQVASVFSMIALVYMRIFLKESL  192



>dbj|BAF00568.1| hypothetical protein [Arabidopsis thaliana]
Length=184

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ D++  ALC G+  CS AIY++G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDISMAALCPGKDECSLAIYLSGFQQVITGVGSLIMMPLVGSLSDKHGRKCLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T++ I+ +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLVTLAYSRGATIFYMYYVLKTLTSIVCEGSVLCLALAYVADNVPEGRRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFL  562
            TG  S + V  +L ARFL
Sbjct  150  TGITSCAFVCANLSARFL  167



>ref|XP_009617453.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G L D YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  ++  F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVASVYMQIFLEDT  191



>ref|XP_009617452.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Nicotiana tomentosiformis]
Length=436

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT  ALC GQ  CS AIY++G QQ ++GI  ++++P++G L D YGRK LL + V+ +I
Sbjct  30   DVTMMALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  ++  F Y YYVLRT++ +I  G I C+++AY AD +  + RA+A   + G 
Sbjct  90   IPPVILAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             SA+ V G L   FL    IF+V+        VYM + L +T
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVAAIASTVASVYMQIFLEDT  191



>gb|KEH44397.1| MFS transporter [Medicago truncatula]
Length=394

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G QQ ++GI  ++  P++G LSD YGRK L+ + ++ 
Sbjct  28   ITDVTMAALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + 
Sbjct  88   SLIPQAILAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SAS V G L ARFL     F V+    +   VYM + L E+
Sbjct  148  GVGSASFVGGTLAARFLSAALTFQVASVSSMIGLVYMRIFLKES  191



>gb|KEH44398.1| MFS transporter [Medicago truncatula]
Length=440

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + DVT  ALC GQ  CS AIY++G QQ ++GI  ++  P++G LSD YGRK L+ + ++ 
Sbjct  28   ITDVTMAALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTV  87

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
            ++IP  +LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + 
Sbjct  88   SLIPQAILAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILA  147

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            G  SAS V G L ARFL     F V+    +   VYM + L E+
Sbjct  148  GVGSASFVGGTLAARFLSAALTFQVASVSSMIGLVYMRIFLKES  191



>ref|XP_007222153.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
 gb|EMJ23352.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
Length=445

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 105/169 (62%), Gaps = 0/169 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ +VG+  +V++P++G LSD  GRK LL 
Sbjct  25   MVIPAITDVTMSALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKCGRKALLT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +  TIIP  +L  +++R F Y Y+V +T++ +I +GS+ C+++AY AD V E  RA+ 
Sbjct  85   VPMILTIIPLGILGYSRNRTFFYIYFVAKTLTAMICEGSVHCLALAYVADNVAEERRAST  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
            F  ++G  S++ V G L  RFL     F V+  + +   +Y+ + L ++
Sbjct  145  FGVLSGIGSSAFVCGTLFTRFLSTSSTFQVATSVAVVSAMYLRIFLPDS  193



>ref|XP_008221200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Prunus 
mume]
Length=446

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 0/148 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT +ALC G+  CS AIY+ G QQ +VG+  +V++P++G LSD  GRK LL 
Sbjct  25   MVIPAITDVTMSALCPGRDECSIAIYLTGFQQAIVGMGTLVMMPLVGNLSDKCGRKALLT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            V +  TIIP  +L  +++R F Y Y+V +T++ +I +GS+ C+++AY AD V E  RA+A
Sbjct  85   VPMILTIIPLGILGYSRNRTFFYVYFVAKTLTAMICEGSVHCLALAYVADNVAEERRASA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIF  580
            F  ++G  S++ V G L  RFL     F
Sbjct  145  FGVLSGIGSSAFVCGTLFTRFLSTSSTF  172



>ref|XP_004242975.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum 
lycopersicum]
Length=435

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 101/164 (62%), Gaps = 0/164 (0%)
 Frame = +2

Query  158  DVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTTI  337
            DVT   LC  Q  CS AIY++G QQ +VGI  +V++P++G LSD YGRK LL V ++  I
Sbjct  30   DVTMMLLCPAQDECSLAIYLSGFQQAIVGIGLVVMMPIIGNLSDVYGRKALLTVPLTLAI  89

Query  338  IPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITGF  517
            IP  +LA  +++ F Y YYVLRT++ +I  G I C+++AY AD + ++ RA+A   + G 
Sbjct  90   IPPVILAYRRTKKFYYVYYVLRTLTGMICDGGIQCVALAYVADHMSQAKRASAIGILAGV  149

Query  518  FSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
             SA+ V G L   FL    IF+V+        VYM + L +T +
Sbjct  150  GSAAFVCGTLADHFLSTSQIFLVATIASTIAVVYMQIFLEDTAR  193



>gb|EYU37988.1| hypothetical protein MIMGU_mgv1a006415mg [Erythranthe guttata]
Length=444

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 102/165 (62%), Gaps = 1/165 (1%)
 Frame = +2

Query  158  DVTTNALCDG-QSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVSTT  334
            DVT  A+C G +  CS AIY+ G  Q + G+  +V++P++G LSD YGRK L+ + ++  
Sbjct  30   DVTVQAVCGGGKEECSLAIYLTGFTQAITGLGAVVMMPMIGNLSDVYGRKNLMTIPMTLA  89

Query  335  IIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWITG  514
            IIP  ++A N++  F YAYYV +T++ I++ G I C+++ Y AD V E  R A FS ++G
Sbjct  90   IIPLVIMAWNRTTNFYYAYYVFKTLTDIVADGGILCLALGYLADCVAEGKRVAVFSVLSG  149

Query  515  FFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
                ++V G L AR L   +IF V+  + I   +YM + L + V+
Sbjct  150  VICGANVCGSLAARLLSTPHIFQVAAVISIVAAIYMRVFLKDPVR  194



>ref|XP_008445313.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
melo]
Length=437

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 103/173 (60%), Gaps = 0/173 (0%)
 Frame = +2

Query  128  AEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKP  307
            A  M    + DVT +ALC  Q  CS AIY  GLQQ V G+  ++++P+LG LSD +GRK 
Sbjct  20   ATMMVIPAITDVTMSALCPDQDECSLAIYFTGLQQVVTGLGSLLMMPLLGNLSDKFGRKT  79

Query  308  LLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNR  487
            +L + +   ++P  +L   +SR F Y Y+VL+ ++ II +GS+ C++VAYAAD V E  R
Sbjct  80   VLTIPMILVVLPLGILGYGRSRKFYYVYFVLKCVTSIICEGSVQCLAVAYAADNVPEHQR  139

Query  488  AAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETV  646
            A+AF  ++   SA+ V G L  RFL     F  +    +   VYM + L ++V
Sbjct  140  ASAFGILSAIISAAFVCGTLCTRFLSIPSTFQFAASTAVVAAVYMRIFLTDSV  192



>ref|XP_004144923.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
sativus]
 gb|KGN43275.1| hypothetical protein Csa_7G016600 [Cucumis sativus]
Length=448

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 103/168 (61%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY+ G QQ + G   +V+ P+LG LSD YGRK LL 
Sbjct  25   MVLPAITDVTMAALCPGRDECSLAIYLTGSQQALSGFGAVVITPLLGNLSDKYGRKALLT  84

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +IIP  +LA ++ R F YAYY  RT++ ++S+G+   +++AY AD    +NRA+A
Sbjct  85   LPTAISIIPLAILAYSRERRFFYAYYATRTLTAMVSEGTAASLALAYLADNTSLANRASA  144

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
            F   TG  SA+ V G L +RFL  DYIF ++    +   VYM + L +
Sbjct  145  FGLFTGVCSAAFVCGTLASRFLATDYIFPIAAVFSMVATVYMRIFLKD  192



>gb|EMT20897.1| Hippocampus abundant transcript 1 protein [Aegilops tauschii]
Length=441

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  A+C G+  CS AIY++G Q  + G+  +VV P++G LSD YGRK L+ 
Sbjct  23   MVLPAITDVTMEAVCPGRDECSVAIYLSGFQNAITGLGALVVTPIVGNLSDKYGRKALMT  82

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            + V+  I+P  +LA N+S  + YAYYV++ ++ I  +GSI C+S+AY AD V    RAAA
Sbjct  83   LPVTVAILPLFILACNRSEVYFYAYYVMKILAGIFCEGSIHCLSLAYVADHVGTKRRAAA  142

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIF  580
            F  ++G  +A  + G L ARFL     F
Sbjct  143  FGLLSGVSAAGFLSGTLTARFLATSSTF  170



>ref|XP_006364509.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=453

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 104/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  152  LVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVST  331
            + D+T +A+C  Q  CS AIY++G QQ ++G+  M+++P++G LSD YGRK LL + V+ 
Sbjct  37   ITDITMDAICPSQDKCSLAIYLSGFQQAIMGLGSMLLMPLIGNLSDVYGRKALLTIPVTL  96

Query  332  TIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWIT  511
             I P  ++A  ++  + YAYYV+RT++ +IS   I CI +AYAAD + E NRA+A + + 
Sbjct  97   LIFPSVIMAYRRTTNYFYAYYVIRTLTGMISDTGIQCIPIAYAADCMSEENRASAIATVA  156

Query  512  GFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            G  SA+ +    + RFL    IF+VS        +YM + L +T +
Sbjct  157  GVGSAAFLCSTFVVRFLSTAQIFLVSSISSSAAVLYMTIFLKDTTR  202



>ref|XP_010442182.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442183.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442184.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
Length=438

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 101/167 (60%), Gaps = 0/167 (0%)
 Frame = +2

Query  149  VLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLVTVS  328
            V+ DV+  ALC G+  CS  IY+ G QQ + G+  ++++P++G LSD +GRK LL + ++
Sbjct  30   VITDVSMAALCPGKDECSLVIYLFGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMT  89

Query  329  TTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAAFSWI  508
              I+P   LA ++     Y YYVL+T + II +GS+ C+++AY AD V E  RA+AF  +
Sbjct  90   LNILPLATLAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVTEGQRASAFGIL  149

Query  509  TGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVETVK  649
            TG  S + V   L ARFL     F V+  + I   VYM L L + ++
Sbjct  150  TGIASCAFVCATLCARFLAISTTFQVAATMAILSTVYMRLFLPDFIR  196



>ref|XP_010918154.1| PREDICTED: uncharacterized protein LOC105042569 isoform X3 [Elaeis 
guineensis]
Length=378

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 105/174 (60%), Gaps = 0/174 (0%)
 Frame = +2

Query  122  WIAEEMTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGR  301
            + A  M    + D+T  ALC G+  CS A+Y++GLQQ + G+  ++V P++G LSD YGR
Sbjct  18   YFAAFMVIPSITDITMEALCPGRVQCSLAVYLSGLQQVITGLGTLIVTPLIGNLSDRYGR  77

Query  302  KPLLLVTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEES  481
            K LL + +   IIP  +LA ++SR + YAYYV++  + +  +GS+ C+S+AY AD V E 
Sbjct  78   KALLTLPMIIAIIPLAILAYDRSRAYFYAYYVIKMFTGMFCEGSMQCLSLAYVADKVGER  137

Query  482  NRAAAFSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVET  643
             RAAAF   +G   A  V G + ARFL     F VS  + +    YM L LVET
Sbjct  138  RRAAAFGVFSGVSCAGFVSGTVAARFLSTSSTFQVSATVAVIAAAYMRLFLVET  191



>ref|XP_008447922.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Cucumis melo]
Length=395

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (62%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  MTKSVLVDVTTNALCDGQSSCSEAIYINGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLL  316
            M    + DVT  ALC G+  CS AIY+ G QQ + G   +V+ P++G LSD YGRK LL 
Sbjct  26   MVLPAITDVTMAALCPGRDECSLAIYLTGFQQALSGFGAVVITPIVGNLSDKYGRKALLT  85

Query  317  VTVSTTIIPFTLLAINKSRGFVYAYYVLRTISYIISQGSIFCISVAYAADVVEESNRAAA  496
            +  + +IIP  +LA ++ R F YAYYV RT++ ++S+G+  C+++AY AD    +NR +A
Sbjct  86   LPTAISIIPLAILAYSRERRFFYAYYVTRTLTAMVSEGTAACLALAYLADNTSLTNRGSA  145

Query  497  FSWITGFFSASHVVGDLLARFLPEDYIFVVSICLLIFVPVYMGLALVE  640
            F   TG  SA+ V G + +RFL  DYIF ++    +   VYM + L +
Sbjct  146  FGLFTGVCSAAFVCGTIASRFLATDYIFPIAAIFSMVATVYMRIFLKD  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1035462857458