BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4519

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004242571.1|  PREDICTED: uncharacterized protein DDB_G0287625    125   2e-28   Solanum lycopersicum
ref|XP_006343674.1|  PREDICTED: uncharacterized protein LOC102595293    124   4e-28   Solanum tuberosum [potatoes]
ref|XP_009774126.1|  PREDICTED: uncharacterized protein LOC104224...    112   6e-24   Nicotiana sylvestris
ref|XP_009589662.1|  PREDICTED: uncharacterized protein LOC104086995  88.6    4e-16   Nicotiana tomentosiformis
emb|CAN75318.1|  hypothetical protein VITISV_026156                   84.7    9e-16   Vitis vinifera
gb|EPS62002.1|  hypothetical protein M569_12793                       84.0    4e-15   Genlisea aurea
emb|CBI36522.3|  unnamed protein product                              85.1    5e-15   Vitis vinifera
ref|XP_010656604.1|  PREDICTED: FIP1[V]-like protein                  84.7    7e-15   Vitis vinifera
gb|KHG13413.1|  Pre-mRNA 3'-end-processing factor FIP1                81.6    7e-14   Gossypium arboreum [tree cotton]
ref|XP_012071475.1|  PREDICTED: FIP1[V]-like protein                  80.5    2e-13   Jatropha curcas
gb|KJB07589.1|  hypothetical protein B456_001G031400                  79.7    3e-13   Gossypium raimondii
gb|KJB07587.1|  hypothetical protein B456_001G031400                  79.7    3e-13   Gossypium raimondii
ref|XP_010047128.1|  PREDICTED: zinc finger CCCH domain-containin...  78.2    9e-13   Eucalyptus grandis [rose gum]
gb|KCW78928.1|  hypothetical protein EUGRSUZ_C00363                   77.8    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010047129.1|  PREDICTED: uncharacterized protein LOC104436...  77.8    1e-12   Eucalyptus grandis [rose gum]
ref|XP_011078592.1|  PREDICTED: FIP1[V]-like protein isoform X1       77.4    1e-12   Sesamum indicum [beniseed]
ref|XP_011078593.1|  PREDICTED: FIP1[V]-like protein isoform X2       77.4    2e-12   Sesamum indicum [beniseed]
ref|XP_010100240.1|  hypothetical protein L484_005444                 77.0    2e-12   
ref|XP_008242955.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.5    6e-12   
ref|XP_008384539.1|  PREDICTED: uncharacterized protein LOC103447...  75.1    7e-12   
ref|XP_008384553.1|  PREDICTED: uncharacterized protein LOC103447...  75.1    7e-12   
ref|XP_009366155.1|  PREDICTED: uncharacterized protein LOC103955965  75.1    7e-12   
ref|XP_008384531.1|  PREDICTED: uncharacterized protein LOC103447...  75.1    7e-12   
ref|XP_008384547.1|  PREDICTED: uncharacterized protein LOC103447...  75.1    7e-12   
gb|KHG03808.1|  Pre-mRNA 3'-end-processing factor FIP1                74.3    1e-11   Gossypium arboreum [tree cotton]
ref|XP_009358572.1|  PREDICTED: uncharacterized protein LOC103949191  73.9    1e-11   
ref|XP_008443875.1|  PREDICTED: trichohyalin isoform X1               73.9    2e-11   Cucumis melo [Oriental melon]
ref|XP_008443876.1|  PREDICTED: trichohyalin isoform X2               73.9    2e-11   Cucumis melo [Oriental melon]
gb|KGN65239.1|  hypothetical protein Csa_1G268330                     73.2    2e-11   Cucumis sativus [cucumbers]
ref|XP_004146694.1|  PREDICTED: FIP1[V]-like protein isoform X1       73.2    3e-11   Cucumis sativus [cucumbers]
ref|XP_011655917.1|  PREDICTED: FIP1[V]-like protein isoform X2       73.2    3e-11   Cucumis sativus [cucumbers]
ref|XP_007204683.1|  hypothetical protein PRUPE_ppa000270mg           72.8    4e-11   Prunus persica
ref|XP_011017996.1|  PREDICTED: FIP1[V]-like protein isoform X2       72.0    7e-11   Populus euphratica
ref|XP_011017995.1|  PREDICTED: FIP1[V]-like protein isoform X1       72.0    8e-11   Populus euphratica
ref|XP_008336909.1|  PREDICTED: uncharacterized protein LOC103400008  70.5    2e-10   
ref|XP_010275740.1|  PREDICTED: filaggrin-like                        70.9    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008352094.1|  PREDICTED: trichohyalin-like                     70.5    2e-10   
ref|XP_002324551.2|  hypothetical protein POPTR_0018s11860g           70.1    3e-10   Populus trichocarpa [western balsam poplar]
gb|KJB82860.1|  hypothetical protein B456_013G217400                  70.1    3e-10   Gossypium raimondii
gb|KJB82858.1|  hypothetical protein B456_013G217400                  70.1    3e-10   Gossypium raimondii
gb|KJB82859.1|  hypothetical protein B456_013G217400                  69.7    4e-10   Gossypium raimondii
ref|XP_007138264.1|  hypothetical protein PHAVU_009G194000g           69.7    4e-10   Phaseolus vulgaris [French bean]
ref|XP_010443517.1|  PREDICTED: uncharacterized protein LOC104726372  68.2    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009411336.1|  PREDICTED: uncharacterized protein LOC103993109  66.6    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473979.1|  PREDICTED: microtubule-associated protein fu...  65.9    7e-09   Citrus sinensis [apfelsine]
ref|XP_006473981.1|  PREDICTED: microtubule-associated protein fu...  65.9    8e-09   Citrus sinensis [apfelsine]
gb|KJB54929.1|  hypothetical protein B456_009G054800                  65.5    1e-08   Gossypium raimondii
gb|KJB54930.1|  hypothetical protein B456_009G054800                  65.5    1e-08   Gossypium raimondii
gb|KJB54928.1|  hypothetical protein B456_009G054800                  65.1    1e-08   Gossypium raimondii
ref|XP_008790389.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.1    1e-08   Phoenix dactylifera
dbj|BAF01390.1|  hypothetical protein                                 63.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936256.1|  PREDICTED: FIP1[V]-like protein                  64.7    2e-08   Elaeis guineensis
ref|XP_006453657.1|  hypothetical protein CICLE_v10007258mg           63.2    6e-08   Citrus clementina [clementine]
gb|KDO59420.1|  hypothetical protein CISIN_1g000758mg                 63.2    6e-08   Citrus sinensis [apfelsine]
gb|KDO59423.1|  hypothetical protein CISIN_1g000758mg                 63.2    6e-08   Citrus sinensis [apfelsine]
gb|KDO59422.1|  hypothetical protein CISIN_1g000758mg                 63.2    6e-08   Citrus sinensis [apfelsine]
ref|XP_006453658.1|  hypothetical protein CICLE_v10007258mg           62.8    6e-08   
gb|KDO59421.1|  hypothetical protein CISIN_1g000758mg                 62.8    6e-08   Citrus sinensis [apfelsine]
ref|XP_003535062.1|  PREDICTED: uncharacterized protein LOC100803...  62.8    7e-08   Glycine max [soybeans]
gb|KDO59424.1|  hypothetical protein CISIN_1g000758mg                 62.8    8e-08   Citrus sinensis [apfelsine]
emb|CDX88655.1|  BnaA03g09940D                                        62.0    1e-07   
ref|XP_009132085.1|  PREDICTED: uncharacterized protein LOC103856715  62.0    1e-07   Brassica rapa
ref|XP_006587147.1|  PREDICTED: uncharacterized protein LOC100803...  62.0    1e-07   Glycine max [soybeans]
ref|XP_006587148.1|  PREDICTED: uncharacterized protein LOC100803...  61.6    2e-07   Glycine max [soybeans]
ref|XP_008785688.1|  PREDICTED: uncharacterized protein LOC103704249  61.2    3e-07   Phoenix dactylifera
ref|XP_004513530.1|  PREDICTED: trichohyalin-like                     60.8    4e-07   Cicer arietinum [garbanzo]
ref|XP_007154905.1|  hypothetical protein PHAVU_003G157600g           60.5    4e-07   Phaseolus vulgaris [French bean]
ref|XP_010939298.1|  PREDICTED: FIP1[V]-like protein isoform X1       60.5    5e-07   Elaeis guineensis
ref|XP_010939299.1|  PREDICTED: FIP1[V]-like protein isoform X2       60.5    5e-07   Elaeis guineensis
ref|XP_010939301.1|  PREDICTED: FIP1[V]-like protein isoform X3       60.1    6e-07   Elaeis guineensis
ref|XP_009396447.1|  PREDICTED: uncharacterized protein LOC103981443  59.3    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006598040.1|  PREDICTED: uncharacterized protein LOC100799266  58.2    3e-06   Glycine max [soybeans]
ref|XP_010687726.1|  PREDICTED: FIP1[V]-like protein                  57.8    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033462.1|  PREDICTED: FIP1[V]-like protein isoform X1       57.0    6e-06   Populus euphratica
ref|XP_006279559.1|  hypothetical protein CARUB_v10025759mg           57.0    7e-06   
dbj|BAB10995.1|  unnamed protein product                              56.2    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200612.2|  FIP1 [V]-like protein                               56.2    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864546.1|  hypothetical protein ARALYDRAFT_495910           55.8    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_002523498.1|  ATP binding protein, putative                    55.1    3e-05   
ref|XP_007011968.1|  FIP1, putative isoform 1                         54.3    5e-05   
ref|XP_006401136.1|  hypothetical protein EUTSA_v10012479mg           53.9    7e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010483368.1|  PREDICTED: uncharacterized protein LOC104761899  52.0    3e-04   Camelina sativa [gold-of-pleasure]
gb|KEH37870.1|  Fip1 [V]-like protein                                 51.6    4e-04   Medicago truncatula
gb|KEH37869.1|  Fip1 [V]-like protein                                 51.6    4e-04   Medicago truncatula
gb|KFK27337.1|  hypothetical protein AALP_AA8G370000                  51.2    5e-04   Arabis alpina [alpine rockcress]
emb|CDY43886.1|  BnaC09g33570D                                        51.2    5e-04   Brassica napus [oilseed rape]
ref|XP_009120319.1|  PREDICTED: filaggrin isoform X1                  50.4    0.001   Brassica rapa



>ref|XP_004242571.1| PREDICTED: uncharacterized protein DDB_G0287625 [Solanum lycopersicum]
Length=1380

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 4/150 (3%)
 Frame = -1

Query  643  NCESSVVEAGGSEHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGP  464
            N  + V+EA G+E +IPG++IPGVSG     G     E+      +DDL+IVLNDN HGP
Sbjct  183  NAGNFVIEASGAEQLIPGLAIPGVSGGAGNTG-EGTFEDDWDSDSEDDLQIVLNDNTHGP  241

Query  463  mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAK  290
            MGM+RMG   +DD+D+  PLVIVA++D PSH PM+EEQ+WG+E G +A+GERKE  DA K
Sbjct  242  MGMERMGIGEEDDEDED-PLVIVADNDGPSHPPMMEEQDWGEEGGPAANGERKEILDALK  300

Query  289  VNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            VN  PG A K+GY NH Y+HPYHSQ+K  R
Sbjct  301  VNGAPGVAGKVGYPNHAYNHPYHSQYKYVR  330



>ref|XP_006343674.1| PREDICTED: uncharacterized protein LOC102595293 [Solanum tuberosum]
Length=1380

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 4/145 (3%)
 Frame = -1

Query  628  VVEAGGSEHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdr  449
            V+EA G+E +IPG+ IPGVSG     G     E+      +DDL+IVLNDN HGPMGM+R
Sbjct  188  VIEASGAEQLIPGLEIPGVSGGAGNTG-EGNVEDDWDSDSEDDLQIVLNDNTHGPMGMER  246

Query  448  mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGP  275
            MG   +DD+D+  PLVIVA++D PSH PM+EEQ+WG+E G +A+GERKE  DA KVN  P
Sbjct  247  MGIGEEDDEDED-PLVIVADNDGPSHPPMMEEQDWGEEGGPAANGERKEITDALKVNGAP  305

Query  274  GYAPKIGYSNHGYHHPYHSQFKVSR  200
            G A K+GY NH Y+HPYHSQ+K  R
Sbjct  306  GVAGKVGYPNHAYNHPYHSQYKYVR  330



>ref|XP_009774126.1| PREDICTED: uncharacterized protein LOC104224220 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009774127.1| PREDICTED: uncharacterized protein LOC104224220 isoform X2 [Nicotiana 
sylvestris]
Length=1380

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 6/140 (4%)
 Frame = -1

Query  607  EHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  428
            E +IPGVSIPGVSG     G   ++++WDSD  +DDL+IVLNDN HGPMGM+RMG D DD
Sbjct  195  EPLIPGVSIPGVSGGGGNGGDGNLEDDWDSDDSEDDLQIVLNDNTHGPMGMERMGDDEDD  254

Query  427  ddddgDPLVIVANSDDPSHQPMV-EEQEWGDELGNSADGERKE--DAAKVNVGPG-YAPK  260
            +D +  PLVIVA++D PSH PM+ EEQEWGDE G + +GERKE  DA KVN  PG  A K
Sbjct  255  EDGE--PLVIVADNDGPSHPPMIMEEQEWGDEGGPAVNGERKEINDALKVNGAPGGVAAK  312

Query  259  IGYSNHGYHHPYHSQFKVSR  200
            +GY+NHGYHHPYHSQ+K  R
Sbjct  313  VGYNNHGYHHPYHSQYKYVR  332



>ref|XP_009589662.1| PREDICTED: uncharacterized protein LOC104086995 [Nicotiana tomentosiformis]
Length=1374

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 103/140 (74%), Gaps = 6/140 (4%)
 Frame = -1

Query  607  EHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  428
            E +IPG+SIPGVSG     G   ++++WDSD  +DDL+IVLNDN HGPMGM+RMG D DD
Sbjct  193  EPLIPGLSIPGVSGGGGNGGDGNLEDDWDSDDSEDDLQIVLNDNTHGPMGMERMGDDEDD  252

Query  427  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN-SADGERKE--DAAKVNVGPG-YAPK  260
            +D +  PLVIVA++D PSH PM+ E++   E G  +A+GERKE  DA KVN  PG    K
Sbjct  253  EDGE--PLVIVADNDGPSHPPMIMEEQEWGEEGGPAANGERKEINDALKVNGAPGGVVAK  310

Query  259  IGYSNHGYHHPYHSQFKVSR  200
            +GY+NHGYHHPYHSQ+K  R
Sbjct  311  VGYNNHGYHHPYHSQYKYVR  330



>emb|CAN75318.1| hypothetical protein VITISV_026156 [Vitis vinifera]
Length=362

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (74%), Gaps = 8/103 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmg-gdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  323
            L+IVLNDNNHGPM  +R G    DD+D+DGDPLVIVA+ D  +H P+ EEQEWG++   +
Sbjct  182  LQIVLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THPPL-EEQEWGED--TA  237

Query  322  ADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             DGERKE  DAAKVN      PKIGYS+HGY HP+HSQFK  R
Sbjct  238  VDGERKEGADAAKVNGAIAGPPKIGYSSHGY-HPFHSQFKYVR  279



>gb|EPS62002.1| hypothetical protein M569_12793, partial [Genlisea aurea]
Length=450

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (66%), Gaps = 12/141 (9%)
 Frame = -1

Query  586  SIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDP  407
            +IPG+SG  E+ G    D+ WDSD  +DDL IVLNDNN   MGM+RM G  D + ++G+P
Sbjct  10   AIPGLSGKMESRGTANFDDGWDSDESEDDLEIVLNDNNRVIMGMERMKGMDDANYEEGEP  69

Query  406  LVIVANSDDPSHQP----MVEEQEWGDE-LGNSADGERKE--DAAKVNVGPGYA-----P  263
            LV+VA++ D  H      M++EQEWGDE  G +ADGERKE  DA K  +G   A     P
Sbjct  70   LVVVADNSDLGHHLHHPHMIDEQEWGDEEAGPAADGERKESGDATKPAMGGPSAMAAVPP  129

Query  262  KIGYSNHGYHHPYHSQFKVSR  200
            KIGY++H YHHP HSQFK  R
Sbjct  130  KIGYNSHMYHHPLHSQFKYVR  150



>emb|CBI36522.3| unnamed protein product [Vitis vinifera]
Length=824

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 8/103 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrm-ggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  323
            L+IVLNDNNHGPM  +R      DD+D+DGDPLVIVA+ D  +H P+ EEQEWG++   +
Sbjct  163  LQIVLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THPPL-EEQEWGED--TA  218

Query  322  ADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             DGERKE  DAAKVN      PKIGYS+HGY HP+HSQFK  R
Sbjct  219  VDGERKEGADAAKVNGAIAGPPKIGYSSHGY-HPFHSQFKYVR  260



>ref|XP_010656604.1| PREDICTED: FIP1[V]-like protein [Vitis vinifera]
Length=1474

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 8/103 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrm-ggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  323
            L+IVLNDNNHGPM  +R      DD+D+DGDPLVIVA+ D  +H P+ EEQEWG++   +
Sbjct  232  LQIVLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THPPL-EEQEWGED--TA  287

Query  322  ADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             DGERKE  DAAKVN      PKIGYS+HGY HP+HSQFK  R
Sbjct  288  VDGERKEGADAAKVNGAIAGPPKIGYSSHGY-HPFHSQFKYVR  329



>gb|KHG13413.1| Pre-mRNA 3'-end-processing factor FIP1 [Gossypium arboreum]
Length=1339

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 8/104 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDNNHGP+ M+   M G+ DDDD+DGDPLVI+A+ D  ++Q   E QEWG+E G 
Sbjct  177  LQIVLNDNNHGPVAMETGGMIGEDDDDDEDGDPLVILADGD--ANQGTAE-QEWGEERGQ  233

Query  325  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +A KV  G   APKIGYS+H Y HP+HSQFK  R
Sbjct  234  AADGEKKEGGEAGKVTSGSVLAPKIGYSSHLY-HPFHSQFKYVR  276



>ref|XP_012071475.1| PREDICTED: FIP1[V]-like protein [Jatropha curcas]
 gb|KDP38657.1| hypothetical protein JCGZ_04010 [Jatropha curcas]
Length=1372

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 76/110 (69%), Gaps = 15/110 (14%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdr---mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  329
            L+IVLNDNNHGPMGM+R      D DDDD+DGDPLVIVA+ D   +QPM EEQ+WG  +G
Sbjct  184  LQIVLNDNNHGPMGMERGMMGDADDDDDDEDGDPLVIVADGD--PNQPM-EEQDWG--VG  238

Query  328  NSA------DGERKEDAAKVNVGPGYA-PKIGYSNHGYHHPYHSQFKVSR  200
              A      +GERKE +     G   A PK+GYSNHGYHHP+HSQFK  R
Sbjct  239  EDAAATVGAEGERKEGSEAAGKGSAVAGPKVGYSNHGYHHPFHSQFKYVR  288



>gb|KJB07589.1| hypothetical protein B456_001G031400 [Gossypium raimondii]
Length=1165

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R     DDDD+DGDPLVIVA++D  ++Q M EEQ+WG+E G +A
Sbjct  174  LQIVLNDNNHGPMAMERGVIGEDDDDEDGDPLVIVADAD--ANQGM-EEQDWGEEGGQTA  230

Query  319  DGERKE-------DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            DGERKE         A    G   APKIGYS+HG+ HP+HSQFK  R
Sbjct  231  DGERKEGGEVGKVGTAGSGGGGVVAPKIGYSSHGF-HPFHSQFKYVR  276



>gb|KJB07587.1| hypothetical protein B456_001G031400 [Gossypium raimondii]
Length=1339

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R     DDDD+DGDPLVIVA++D  ++Q M EEQ+WG+E G +A
Sbjct  174  LQIVLNDNNHGPMAMERGVIGEDDDDEDGDPLVIVADAD--ANQGM-EEQDWGEEGGQTA  230

Query  319  DGERKE-------DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            DGERKE         A    G   APKIGYS+HG+ HP+HSQFK  R
Sbjct  231  DGERKEGGEVGKVGTAGSGGGGVVAPKIGYSSHGF-HPFHSQFKYVR  276



>ref|XP_010047128.1| PREDICTED: zinc finger CCCH domain-containing protein 13 isoform 
X1 [Eucalyptus grandis]
Length=1351

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 12/108 (11%)
 Frame = -1

Query  499  LRIVLNDN--NHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN  +HGP+G+    G  +DDD+DGDPLVIVA+ D PS QP+VE QEWG++   
Sbjct  186  LQIVLNDNAAHHGPVGVIGDAGGEEDDDEDGDPLVIVADGD-PS-QPLVE-QEWGEDTAE  242

Query  325  SA-DGERKE-----DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +  +GERKE     + AK N G G APKIGYSN GY HP+HSQFK  R
Sbjct  243  AGPEGERKEGGGSSELAKANGGVGVAPKIGYSNLGY-HPFHSQFKYVR  289



>gb|KCW78928.1| hypothetical protein EUGRSUZ_C00363 [Eucalyptus grandis]
Length=1347

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 12/108 (11%)
 Frame = -1

Query  499  LRIVLNDN--NHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN  +HGP+G+    G  +DDD+DGDPLVIVA+ D PS QP+VE QEWG++   
Sbjct  186  LQIVLNDNAAHHGPVGVIGDAGGEEDDDEDGDPLVIVADGD-PS-QPLVE-QEWGEDTAE  242

Query  325  SA-DGERKE-----DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +  +GERKE     + AK N G G APKIGYSN GY HP+HSQFK  R
Sbjct  243  AGPEGERKEGGGSSELAKANGGVGVAPKIGYSNLGY-HPFHSQFKYVR  289



>ref|XP_010047129.1| PREDICTED: uncharacterized protein LOC104436103 isoform X2 [Eucalyptus 
grandis]
Length=1178

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 12/108 (11%)
 Frame = -1

Query  499  LRIVLNDN--NHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN  +HGP+G+    G  +DDD+DGDPLVIVA+ D PS QP+VE QEWG++   
Sbjct  186  LQIVLNDNAAHHGPVGVIGDAGGEEDDDEDGDPLVIVADGD-PS-QPLVE-QEWGEDTAE  242

Query  325  SA-DGERKE-----DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +  +GERKE     + AK N G G APKIGYSN GY HP+HSQFK  R
Sbjct  243  AGPEGERKEGGGSSELAKANGGVGVAPKIGYSNLGY-HPFHSQFKYVR  289



>ref|XP_011078592.1| PREDICTED: FIP1[V]-like protein isoform X1 [Sesamum indicum]
Length=1397

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 19/152 (13%)
 Frame = -1

Query  613  GSEHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdg  434
            GSE MIPG+S     G  E  GG  +++EW+SD  +DDL+IVLNDNNHGPMGM+RM G  
Sbjct  184  GSEQMIPGLS-----GKMENHGGSNLEDEWESDESEDDLQIVLNDNNHGPMGMERMPGGD  238

Query  433  ddddddgDPLVIVANSDD------PSHQPMVEEQEWGDELGNSADGERKE--------DA  296
            D+DD+DG+PLVIVA++ D           M E++  G+E G  ADGERKE          
Sbjct  239  DEDDEDGEPLVIVADNGDVGHHHHHQQMMMEEQEYAGEEGGPGADGERKELGDTAKASGV  298

Query  295  AKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
                      PKIGYSNH YHHP+HSQFK  R
Sbjct  299  GGAAAPAAVQPKIGYSNHVYHHPFHSQFKYVR  330



>ref|XP_011078593.1| PREDICTED: FIP1[V]-like protein isoform X2 [Sesamum indicum]
Length=1396

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 19/152 (13%)
 Frame = -1

Query  613  GSEHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdg  434
            GSE MIPG+S     G  E  GG  +++EW+SD  +DDL+IVLNDNNHGPMGM+RM G  
Sbjct  184  GSEQMIPGLS-----GKMENHGGSNLEDEWESDESEDDLQIVLNDNNHGPMGMERMPGGD  238

Query  433  ddddddgDPLVIVANSDD------PSHQPMVEEQEWGDELGNSADGERKE--------DA  296
            D+DD+DG+PLVIVA++ D           M E++  G+E G  ADGERKE          
Sbjct  239  DEDDEDGEPLVIVADNGDVGHHHHHQQMMMEEQEYAGEEGGPGADGERKELGDTAKASGV  298

Query  295  AKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
                      PKIGYSNH YHHP+HSQFK  R
Sbjct  299  GGAAAPAAVQPKIGYSNHVYHHPFHSQFKYVR  330



>ref|XP_010100240.1| hypothetical protein L484_005444 [Morus notabilis]
 gb|EXB82160.1| hypothetical protein L484_005444 [Morus notabilis]
Length=1337

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 8/104 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPm--gmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDNNHG M     RM G  DDDD+D D LVIVA+ D   +Q M EEQ+WG++   
Sbjct  183  LQIVLNDNNHGHMGMERGRMAGGDDDDDEDEDGLVIVADGD--PNQAM-EEQDWGEDAAQ  239

Query  325  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGERKE  +A K  VG   A KIGYSNHG+ HP+HSQFK  R
Sbjct  240  AADGERKEMGEAGKPGVGGAMASKIGYSNHGF-HPFHSQFKYVR  282



>ref|XP_008242955.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103341244 
[Prunus mume]
Length=1343

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+ + DD D   +V  +D   +QPM EEQEWG++   +A
Sbjct  187  LQIVLNDNNHGPMAMERGGIGGNAEGDDDDEDGLVIVADGELNQPM-EEQEWGEDGAQAA  245

Query  319  DGERKE--DAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K  VG G     PK+GYSNHGY HP+HSQFK  R
Sbjct  246  EGERKEMGEAGKA-VGGGSVVAPPKVGYSNHGY-HPFHSQFKYVR  288



>ref|XP_008384539.1| PREDICTED: uncharacterized protein LOC103447129 isoform X2 [Malus 
domestica]
Length=1422

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190  LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K   G    PK+GYS+HGY HP+HSQFK  R
Sbjct  246  EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVR  286



>ref|XP_008384553.1| PREDICTED: uncharacterized protein LOC103447129 isoform X4 [Malus 
domestica]
Length=1368

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190  LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K   G    PK+GYS+HGY HP+HSQFK  R
Sbjct  246  EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVR  286



>ref|XP_009366155.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
 ref|XP_009366156.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
 ref|XP_009366157.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
Length=1372

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190  LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K   G    PK+GYS+HGY HP+HSQFK  R
Sbjct  246  EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVR  286



>ref|XP_008384531.1| PREDICTED: uncharacterized protein LOC103447129 isoform X1 [Malus 
domestica]
Length=1437

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190  LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K   G    PK+GYS+HGY HP+HSQFK  R
Sbjct  246  EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVR  286



>ref|XP_008384547.1| PREDICTED: uncharacterized protein LOC103447129 isoform X3 [Malus 
domestica]
Length=1389

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190  LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE  +A K   G    PK+GYS+HGY HP+HSQFK  R
Sbjct  246  EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVR  286



>gb|KHG03808.1| Pre-mRNA 3'-end-processing factor FIP1 [Gossypium arboreum]
Length=1265

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmgg--dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+I+LNDNNHG M M+R G   + DDDD+D DPLVIVA++D        EE EWG+E   
Sbjct  136  LQILLNDNNHGLMDMERRGMIGEDDDDDEDEDPLVIVADAD---ANQGTEEHEWGEEGCQ  192

Query  325  SADGERKE--DAAKVNVGPG-----YAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +AAKV    G      APKIGYS+HGY HP+HSQFK  R
Sbjct  193  AADGEKKEGGEAAKVGTACGGGGSVVAPKIGYSDHGY-HPFHSQFKYVR  240



>ref|XP_009358572.1| PREDICTED: uncharacterized protein LOC103949191 [Pyrus x bretschneideri]
Length=800

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G   +DDDD    LVIVA  D   +QPM ++QEWG+E   + 
Sbjct  190  LQIVLNDNNHGPMAMERGGMGDEDDDDG---LVIVA--DGEPNQPM-DDQEWGEESTQTV  243

Query  319  DGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE       G G     PK+GYS+HGY HP+HSQFK  R
Sbjct  244  EGERKEMGEAGKTGAGSVVVPPKVGYSSHGY-HPFHSQFKYVR  285



>ref|XP_008443875.1| PREDICTED: trichohyalin isoform X1 [Cucumis melo]
Length=1397

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 23/155 (15%)
 Frame = -1

Query  613  GSEHMIPG------VSIPGVSGVPETCGGRAMdeewdsdsdddD---------LRIVLND  479
            G E +IPG      +SI G SG  E   G  M++      D  D         L+I+LND
Sbjct  166  GVEPIIPGLSPSVGISIHGTSGNLENAEGFRMNDASRDRGDGGDDWDSDSEDDLQILLND  225

Query  478  NNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE-  302
            ++ GPM M+R G  GDD+D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE 
Sbjct  226  SDRGPMAMERGGLVGDDEDEP--PLVILGDND---QNQVMEEQEWGDDAVPTADGERKET  280

Query  301  -DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             +AAK + G   APK+GYSN+GY  P+HSQ+K  R
Sbjct  281  GEAAKSSAGMVVAPKLGYSNYGY-RPFHSQYKYVR  314



>ref|XP_008443876.1| PREDICTED: trichohyalin isoform X2 [Cucumis melo]
Length=1395

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 23/155 (15%)
 Frame = -1

Query  613  GSEHMIPG------VSIPGVSGVPETCGGRAMdeewdsdsdddD---------LRIVLND  479
            G E +IPG      +SI G SG  E   G  M++      D  D         L+I+LND
Sbjct  166  GVEPIIPGLSPSVGISIHGTSGNLENAEGFRMNDASRDRGDGGDDWDSDSEDDLQILLND  225

Query  478  NNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE-  302
            ++ GPM M+R G  GDD+D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE 
Sbjct  226  SDRGPMAMERGGLVGDDEDEP--PLVILGDND---QNQVMEEQEWGDDAVPTADGERKET  280

Query  301  -DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             +AAK + G   APK+GYSN+GY  P+HSQ+K  R
Sbjct  281  GEAAKSSAGMVVAPKLGYSNYGY-RPFHSQYKYVR  314



>gb|KGN65239.1| hypothetical protein Csa_1G268330 [Cucumis sativus]
Length=520

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 8/102 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+I+LND++ GPM M+R G  GDD+D+   PLVI+ ++D      ++EEQEWGD+   +A
Sbjct  219  LQILLNDSDRGPMAMERGGLVGDDEDEP--PLVILGDND---QNQVMEEQEWGDDTVPTA  273

Query  319  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            DGERKE  +AAK + G   APK+GYSN+GY  P+HSQ+K  R
Sbjct  274  DGERKETGEAAKSSAGMVVAPKLGYSNYGY-RPFHSQYKYVR  314



>ref|XP_004146694.1| PREDICTED: FIP1[V]-like protein isoform X1 [Cucumis sativus]
Length=1399

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 23/155 (15%)
 Frame = -1

Query  613  GSEHMIPG------VSIPGVSGVPETCGGRAMdeewdsdsdddD---------LRIVLND  479
            G E +IPG      +SI G SG  E   G  M++      D  D         L+I+LND
Sbjct  166  GGEPIIPGLSPSGGISIHGTSGNLENPEGFRMNDASRDRGDGGDDWDSDSEDDLQILLND  225

Query  478  NNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE-  302
            ++ GPM M+R G  GDD+D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE 
Sbjct  226  SDRGPMAMERGGLVGDDEDEP--PLVILGDND---QNQVMEEQEWGDDTVPTADGERKET  280

Query  301  -DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             +AAK + G   APK+GYSN+GY  P+HSQ+K  R
Sbjct  281  GEAAKSSAGMVVAPKLGYSNYGY-RPFHSQYKYVR  314



>ref|XP_011655917.1| PREDICTED: FIP1[V]-like protein isoform X2 [Cucumis sativus]
Length=1397

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 23/155 (15%)
 Frame = -1

Query  613  GSEHMIPG------VSIPGVSGVPETCGGRAMdeewdsdsdddD---------LRIVLND  479
            G E +IPG      +SI G SG  E   G  M++      D  D         L+I+LND
Sbjct  166  GGEPIIPGLSPSGGISIHGTSGNLENPEGFRMNDASRDRGDGGDDWDSDSEDDLQILLND  225

Query  478  NNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE-  302
            ++ GPM M+R G  GDD+D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE 
Sbjct  226  SDRGPMAMERGGLVGDDEDEP--PLVILGDND---QNQVMEEQEWGDDTVPTADGERKET  280

Query  301  -DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
             +AAK + G   APK+GYSN+GY  P+HSQ+K  R
Sbjct  281  GEAAKSSAGMVVAPKLGYSNYGY-RPFHSQYKYVR  314



>ref|XP_007204683.1| hypothetical protein PRUPE_ppa000270mg [Prunus persica]
 gb|EMJ05882.1| hypothetical protein PRUPE_ppa000270mg [Prunus persica]
Length=1369

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 14/109 (13%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDP----LVIVANSDDPSHQPMVEEQEWGDEL  332
            L+IVLNDN+HGPM M+R G  G+ +  D D     LVIVA+ +   +QPM EEQEWG++ 
Sbjct  187  LQIVLNDNDHGPMAMERGGIGGNAEGGDDDDDEDGLVIVADGE--LNQPM-EEQEWGEDG  243

Query  331  GNSADGERKE--DAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
              +A+GERKE  +A K  VG G     PK+GYSNHGY HP+HSQFK  R
Sbjct  244  AQAAEGERKEMGEAGKA-VGGGSVVAPPKVGYSNHGY-HPFHSQFKYVR  290



>ref|XP_011017996.1| PREDICTED: FIP1[V]-like protein isoform X2 [Populus euphratica]
Length=1159

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = -1

Query  499  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWG-----  341
            L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  158  LKIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  215

Query  340  -DELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGY-HHPYHSQFKVSR  200
               +G  A+GERKE  A         PKIGY+NHGY HHP+HSQFK  R
Sbjct  216  VAAVGGGAEGERKEGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVR  264



>ref|XP_011017995.1| PREDICTED: FIP1[V]-like protein isoform X1 [Populus euphratica]
Length=1343

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = -1

Query  499  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWG-----  341
            L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  158  LKIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  215

Query  340  -DELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGY-HHPYHSQFKVSR  200
               +G  A+GERKE  A         PKIGY+NHGY HHP+HSQFK  R
Sbjct  216  VAAVGGGAEGERKEGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVR  264



>ref|XP_008336909.1| PREDICTED: uncharacterized protein LOC103400008 [Malus domestica]
Length=616

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHG       GG G +D+DD D LVIVA+ +   +QPM ++QEWG+E   + 
Sbjct  191  LQIVLNDNNHG-AMAMERGGMGGEDEDDDDGLVIVADGE--PNQPM-DDQEWGEESAXTV  246

Query  319  DGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE       G G     PK+GYS+HGY HP+HSQFK  R
Sbjct  247  EGERKEMGEAGKTGAGSVVVPPKVGYSSHGY-HPFHSQFKYVR  288



>ref|XP_010275740.1| PREDICTED: filaggrin-like [Nelumbo nucifera]
Length=1492

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 87/153 (57%), Gaps = 19/153 (12%)
 Frame = -1

Query  610  SEHMIPGVSI-PGVSGVPETCGGRAMdeewdsdsd-----------ddDLRIVLNDNNHG  467
            SE +IPG+S  P + GV E+ G     +    D             +DDL+IVLNDN   
Sbjct  199  SEPIIPGLSSGPFIPGVLESQGNEEDMKASRRDDSGGAGDDWDSDSEDDLQIVLNDNVGP  258

Query  466  PmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAA  293
                       DD+D+DG+ LVIVA+ D   HQP VEEQEWGD+   + DGERKE  +A+
Sbjct  259  LGVDRNEAMGSDDEDEDGEDLVIVADGDQ-HHQP-VEEQEWGDDTAQAPDGERKEIGEAS  316

Query  292  KVNVGPGYA--PKIGYSNHGYHHPYHSQFKVSR  200
            KVN G   A   +IGYS HGY HP+HSQFK  R
Sbjct  317  KVNGGMVNAAGARIGYSGHGY-HPHHSQFKYVR  348



>ref|XP_008352094.1| PREDICTED: trichohyalin-like [Malus domestica]
Length=1355

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHG       GG G +D+DD D LVIVA+ +   +QPM ++QEWG+E   + 
Sbjct  191  LQIVLNDNNHG-AMAMERGGMGGEDEDDDDGLVIVADGE--PNQPM-DDQEWGEESAXTV  246

Query  319  DGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
            +GERKE       G G     PK+GYS+HGY HP+HSQFK  R
Sbjct  247  EGERKEMGEAGKTGAGSVVVPPKVGYSSHGY-HPFHSQFKYVR  288



>ref|XP_002324551.2| hypothetical protein POPTR_0018s11860g [Populus trichocarpa]
 gb|EEF03116.2| hypothetical protein POPTR_0018s11860g [Populus trichocarpa]
Length=1347

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  499  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWG-----  341
            L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  157  LQIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  214

Query  340  -DELGNSADGERKEDAAKVNVGPGYA-PKIGYSNHGY-HHPYHSQFKVSR  200
               +G  A+GERKE       G     PKIGY+NHGY HHP+HSQFK  R
Sbjct  215  VAAVGGGAEGERKEGGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVR  264



>gb|KJB82860.1| hypothetical protein B456_013G217400 [Gossypium raimondii]
Length=1305

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN HGP+ M+   M G+ DDDD+DGDPLVI+A+ D         EQEWG+E   
Sbjct  218  LQIVLNDN-HGPVAMETGGMIGEDDDDDEDGDPLVILADGD---GNQGTAEQEWGEERVQ  273

Query  325  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +A KV  G   APKIGYS+H Y HP+HSQFK  R
Sbjct  274  AADGEKKEGGEAGKVTSGGVLAPKIGYSSHLY-HPFHSQFKYVR  316



>gb|KJB82858.1| hypothetical protein B456_013G217400 [Gossypium raimondii]
Length=1379

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN HGP+ M+   M G+ DDDD+DGDPLVI+A+ D         EQEWG+E   
Sbjct  218  LQIVLNDN-HGPVAMETGGMIGEDDDDDEDGDPLVILADGD---GNQGTAEQEWGEERVQ  273

Query  325  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +A KV  G   APKIGYS+H Y HP+HSQFK  R
Sbjct  274  AADGEKKEGGEAGKVTSGGVLAPKIGYSSHLY-HPFHSQFKYVR  316



>gb|KJB82859.1| hypothetical protein B456_013G217400 [Gossypium raimondii]
Length=1200

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN HGP+ M+   M G+ DDDD+DGDPLVI+A+ D         EQEWG+E   
Sbjct  218  LQIVLNDN-HGPVAMETGGMIGEDDDDDEDGDPLVILADGD---GNQGTAEQEWGEERVQ  273

Query  325  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +A KV  G   APKIGYS+H Y HP+HSQFK  R
Sbjct  274  AADGEKKEGGEAGKVTSGGVLAPKIGYSSHLY-HPFHSQFKYVR  316



>ref|XP_007138264.1| hypothetical protein PHAVU_009G194000g [Phaseolus vulgaris]
 gb|ESW10258.1| hypothetical protein PHAVU_009G194000g [Phaseolus vulgaris]
Length=1323

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = -1

Query  583  IPGVSG-VPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDP  407
            IPG++G  P   GG   D + DS+ D   L+IVLN+NNH  M    M    + ++D  + 
Sbjct  125  IPGLAGEAPAEEGGEGDDWDTDSEDD---LKIVLNENNHMAMERGGMVEGDEGEEDGDEE  181

Query  406  LVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDAAKV-NVGPGYAPKIGYSNHGYH  233
            LVIVA  D P+    VEEQEWG+    +A +GERK+ A ++   G   APKIGYSNHGY 
Sbjct  182  LVIVAGGD-PNQ--GVEEQEWGENAAVAAGEGERKDAAGELAKAGGAVAPKIGYSNHGY-  237

Query  232  HPYHSQFK  209
            HP+HSQFK
Sbjct  238  HPFHSQFK  245



>ref|XP_010443517.1| PREDICTED: uncharacterized protein LOC104726372 [Camelina sativa]
Length=1212

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 7/73 (10%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE---LGNSADGERKEDAAKVNVGPGYAPKIGYSNHG  239
            PLVIVA++D   +QPM EEQ WG E    G   DG+   +A K   GPG APK GYS+HG
Sbjct  204  PLVIVADTD--PNQPM-EEQLWGGEDGLQGVEGDGKDGGEAGK-GTGPGSAPKAGYSSHG  259

Query  238  YHHPYHSQFKVSR  200
            +HHP+HSQFK  R
Sbjct  260  FHHPFHSQFKYVR  272



>ref|XP_009411336.1| PREDICTED: uncharacterized protein LOC103993109 [Musa acuminata 
subsp. malaccensis]
Length=1430

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 80/145 (55%), Gaps = 17/145 (12%)
 Frame = -1

Query  583  IPGVSGVPETCG---------GRAMdeewdsdsdddDLRIVLNDNNHGP---mgmdrmgg  440
            IPG+S  P   G         G+    E      +DDL+IVLND+NHGP      + +  
Sbjct  199  IPGLSAGPAPSGPLVGMNSEMGKLSQSEDYDSDSEDDLQIVLNDSNHGPPGAERSNIVEF  258

Query  439  dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNSADGERKE--DAAKVNVGPGY  269
            D +DD+D  + LVIV + D   H P +E Q+WG+E L  + +GERKE  DAAK     G 
Sbjct  259  DEEDDEDGEEDLVIVTDEDQHHHLPAMEVQDWGEETLQPTGEGERKEMVDAAKGIGATGT  318

Query  268  AP--KIGYSNHGYHHPYHSQFKVSR  200
            AP  +IGY+NHG H  +HS +K  R
Sbjct  319  APGARIGYNNHGIHTQHHSMYKYIR  343



>ref|XP_006473979.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X1 [Citrus sinensis]
 ref|XP_006473980.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X2 [Citrus sinensis]
Length=1346

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 85/158 (54%), Gaps = 29/158 (18%)
 Frame = -1

Query  598  IPGVSIPGVSGVPETCGGRAMdee---------wdsdsdddDLRIVLNDNNHGPmgmdrm  446
            +PG+ IPG+S       GR    E               +DDL+IVLN++NH PM +D  
Sbjct  111  VPGIEIPGISQNGVENSGRQNRNEGEVGEEAEDDWESDSEDDLQIVLNEDNHRPMLIDGG  170

Query  445  ggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGPG-  272
            GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G G 
Sbjct  171  GGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAAAQMGEGGAEKKEGTGE  226

Query  271  -------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
                          A KIGYSNH  YH+PYHSQFK  R
Sbjct  227  RANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>ref|XP_006473981.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X3 [Citrus sinensis]
Length=1342

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 85/158 (54%), Gaps = 29/158 (18%)
 Frame = -1

Query  598  IPGVSIPGVSGVPETCGGRAMdee---------wdsdsdddDLRIVLNDNNHGPmgmdrm  446
            +PG+ IPG+S       GR    E               +DDL+IVLN++NH PM +D  
Sbjct  111  VPGIEIPGISQNGVENSGRQNRNEGEVGEEAEDDWESDSEDDLQIVLNEDNHRPMLIDGG  170

Query  445  ggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGPG-  272
            GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G G 
Sbjct  171  GGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAAAQMGEGGAEKKEGTGE  226

Query  271  -------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
                          A KIGYSNH  YH+PYHSQFK  R
Sbjct  227  RANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>gb|KJB54929.1| hypothetical protein B456_009G054800 [Gossypium raimondii]
Length=1132

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 13/109 (12%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmgg--dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN+HG M M+R G   + DDDD+D DPLVIVA++D        EE EWG+E   
Sbjct  136  LQIVLNDNHHGLMDMERGGMIGEDDDDDEDEDPLVIVADAD---ANQGTEEHEWGEEGCQ  192

Query  325  SADGERKE--DAAK-----VNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +AAK        G   APKIGYSN+GY HP+HSQFK  R
Sbjct  193  AADGEKKEGGEAAKVSSAGGGGGSVVAPKIGYSNYGY-HPFHSQFKYVR  240



>gb|KJB54930.1| hypothetical protein B456_009G054800 [Gossypium raimondii]
Length=1021

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 13/109 (12%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmgg--dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN+HG M M+R G   + DDDD+D DPLVIVA++D        EE EWG+E   
Sbjct  136  LQIVLNDNHHGLMDMERGGMIGEDDDDDEDEDPLVIVADAD---ANQGTEEHEWGEEGCQ  192

Query  325  SADGERKE--DAAK-----VNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +AAK        G   APKIGYSN+GY HP+HSQFK  R
Sbjct  193  AADGEKKEGGEAAKVSSAGGGGGSVVAPKIGYSNYGY-HPFHSQFKYVR  240



>gb|KJB54928.1| hypothetical protein B456_009G054800 [Gossypium raimondii]
Length=1115

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 13/109 (12%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmgg--dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN+HG M M+R G   + DDDD+D DPLVIVA++D        EE EWG+E   
Sbjct  136  LQIVLNDNHHGLMDMERGGMIGEDDDDDEDEDPLVIVADAD---ANQGTEEHEWGEEGCQ  192

Query  325  SADGERKE--DAAK-----VNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +ADGE+KE  +AAK        G   APKIGYSN+GY HP+HSQFK  R
Sbjct  193  AADGEKKEGGEAAKVSSAGGGGGSVVAPKIGYSNYGY-HPFHSQFKYVR  240



>ref|XP_008790389.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103707618 
[Phoenix dactylifera]
Length=1258

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGP---mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--  335
            L+IVLNDN HGP      DR+G + DDD+D  + LVIV + D   H P +EEQ+WG E  
Sbjct  49   LQIVLNDN-HGPLGGERNDRVGDEEDDDEDGEEDLVIVTDEDQHHHLPAMEEQDWGGEEA  107

Query  334  LGNSADGERK-EDAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKVSR  200
            +  S DGE++  DAAK N   G AP  +IGYSNHG+H  +HS +K  R
Sbjct  108  IQPSGDGEKEMADAAKGNCPAGTAPAARIGYSNHGFHVQHHSTYKYIR  155



>dbj|BAF01390.1| hypothetical protein [Arabidopsis thaliana]
Length=316

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 61/105 (58%), Gaps = 14/105 (13%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  245
            PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  190  PLVIVADTD--PNQPM-EEQMWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  245

Query  244  HGYHHPYHSQFKVSRDVDTWGLCFLILFDQTMKCKLTYSCHVMWN  110
            HGYH P+HSQFKVS  VD   L  + L    + C+  Y   V  N
Sbjct  246  HGYH-PFHSQFKVS--VDATLLSLVRLLSTWVSCR--YPVLVFLN  285



>ref|XP_010936256.1| PREDICTED: FIP1[V]-like protein [Elaeis guineensis]
Length=1425

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = -1

Query  499  LRIVLNDNNHGP---mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--  335
            L+IVLNDN HGP      D +G + DDD+D  + LVIV + D   H P  EEQ+WG E  
Sbjct  218  LQIVLNDN-HGPLGGEKNDGVGDEEDDDEDGEEDLVIVTDEDQHHHLPATEEQDWGGEEA  276

Query  334  LGNSADGERK-EDAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKVSR  200
            +  S DGE++  DAAK N   G AP  +IGYSNHG+H  +HS +K  R
Sbjct  277  IQPSGDGEKEMADAAKGNCPAGTAPAARIGYSNHGFHVQHHSTYKYVR  324



>ref|XP_006453657.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
 gb|ESR66897.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
Length=1346

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>gb|KDO59420.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1299

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>gb|KDO59423.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1124

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>gb|KDO59422.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1258

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>ref|XP_006453658.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
 gb|ESR66898.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
Length=1171

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>gb|KDO59421.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1295

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>ref|XP_003535062.1| PREDICTED: uncharacterized protein LOC100803769 isoform X1 [Glycine 
max]
Length=1316

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -1

Query  607  EHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  428
            E +IPG+S    + VP    G   D + + D     L+IVLN+NNH  M    +    ++
Sbjct  131  ETVIPGLSGEAAAAVPPEGEGDDWDSDSEDD-----LKIVLNENNHMAMERGGVADGDEE  185

Query  427  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  260
            ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186  EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  259  IGYSNHGYHHPYHSQFKVSR  200
            IGYSNHGY HP+HS FK  R
Sbjct  242  IGYSNHGY-HPFHSPFKYVR  260



>gb|KDO59424.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1048

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  323
            L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153  LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  322  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKVSR  200
            A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFK  R
Sbjct  209  APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVR  264



>emb|CDX88655.1| BnaA03g09940D [Brassica napus]
Length=1046

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 60/100 (60%), Gaps = 10/100 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDN       DR    GD++DDD +PLVIV ++D   H  M E+Q WG+E   + 
Sbjct  120  LQIVLNDN-----VADRRARMGDNEDDDEEPLVIVTDADPNQH--MEEQQLWGEE---AV  169

Query  319  DGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GE KE    V        K GY++HGYHHP+HSQFK  R
Sbjct  170  EGESKEGGEAVKGSAAGPTKAGYNSHGYHHPFHSQFKYIR  209



>ref|XP_009132085.1| PREDICTED: uncharacterized protein LOC103856715 [Brassica rapa]
Length=1047

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 60/100 (60%), Gaps = 10/100 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDN       DR    GD++DDD +PLVIV ++D   H  M E+Q WG+E   + 
Sbjct  121  LQIVLNDN-----VADRRARMGDNEDDDEEPLVIVTDADPNQH--MEEQQLWGEE---AV  170

Query  319  DGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            +GE KE    V        K GY++HGYHHP+HSQFK  R
Sbjct  171  EGESKEGGEAVKGSAAGPTKAGYNSHGYHHPFHSQFKYIR  210



>ref|XP_006587147.1| PREDICTED: uncharacterized protein LOC100803769 isoform X2 [Glycine 
max]
Length=1318

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 76/137 (55%), Gaps = 14/137 (10%)
 Frame = -1

Query  607  EHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  428
            E +IPG+S    + VP    G   D + + D     L+IVLN+NNH  M    +    ++
Sbjct  131  ETVIPGLSGEAAAAVPPEGEGDDWDSDSEDD-----LKIVLNENNHMAMERGGVADGDEE  185

Query  427  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  260
            ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186  EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  259  IGYSNHGYHHPYHSQFK  209
            IGYSNHGY HP+HS FK
Sbjct  242  IGYSNHGY-HPFHSPFK  257



>ref|XP_006587148.1| PREDICTED: uncharacterized protein LOC100803769 isoform X3 [Glycine 
max]
Length=1132

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 76/137 (55%), Gaps = 14/137 (10%)
 Frame = -1

Query  607  EHMIPGVSIPGVSGVPETCGGRAMdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  428
            E +IPG+S    + VP    G   D + + D     L+IVLN+NNH  M    +    ++
Sbjct  131  ETVIPGLSGEAAAAVPPEGEGDDWDSDSEDD-----LKIVLNENNHMAMERGGVADGDEE  185

Query  427  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  260
            ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186  EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  259  IGYSNHGYHHPYHSQFK  209
            IGYSNHGY HP+HS FK
Sbjct  242  IGYSNHGY-HPFHSPFK  257



>ref|XP_008785688.1| PREDICTED: uncharacterized protein LOC103704249 [Phoenix dactylifera]
Length=1422

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 8/107 (7%)
 Frame = -1

Query  499  LRIVLNDNN--HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LG  329
            L+IVLNDN+   G    DR+G + DDD+D  + LVIV + D   H P +EEQ+WG+E + 
Sbjct  218  LQIVLNDNHVPLGGERNDRVGAEEDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQ  277

Query  328  NSADGERKE--DAAKVNVGPG--YAPKIGYSNHGYHHPYHSQFKVSR  200
             + DGERKE  D AK N GP    A +IGYS+HG+H  +HS +K  R
Sbjct  278  PAGDGERKEMADVAKGN-GPAGTSATRIGYSSHGFHMQHHSTYKYIR  323



>ref|XP_004513530.1| PREDICTED: trichohyalin-like [Cicer arietinum]
Length=1335

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 85/154 (55%), Gaps = 20/154 (13%)
 Frame = -1

Query  622  EAGGSEHMIPGVSIPGVSGVPETC-------GGRAMdeewdsdsdddDLRIVLNDNNHGP  464
            + GGSE +IPG+S  G  GV E         GG     +      DDDL+IVLND+NH  
Sbjct  123  DGGGSEPIIPGLS--GGEGVDEAFRRADEGGGGFDGGNDDWDSDSDDDLQIVLNDDNHM-  179

Query  463  mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKEDA--AK  290
            +       D DD++D+   LVIVA   +P+    +EEQEWG+     ADGERK+ A   K
Sbjct  180  VMEKGGVVDDDDNEDEDGGLVIVAG--EPNQ--GLEEQEWGETANVLADGERKDAAEPGK  235

Query  289  VNVGPG---YAPKIGYSNHGY-HHPYHSQFKVSR  200
               GPG     PKIGY NH + +HP+HSQFK  R
Sbjct  236  AVTGPGGVPVVPKIGYGNHVHGYHPFHSQFKYIR  269



>ref|XP_007154905.1| hypothetical protein PHAVU_003G157600g [Phaseolus vulgaris]
 gb|ESW26899.1| hypothetical protein PHAVU_003G157600g [Phaseolus vulgaris]
Length=1243

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 3/54 (6%)
 Frame = -1

Query  361  VEEQEWGDELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKVSR  200
            VEE++WG+      DGE+K+    V      APKIGYSN GYHHP+HSQFK  R
Sbjct  144  VEERDWGENSTQPVDGEKKDVGESVKA---VAPKIGYSNQGYHHPFHSQFKYVR  194



>ref|XP_010939298.1| PREDICTED: FIP1[V]-like protein isoform X1 [Elaeis guineensis]
Length=1430

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 7/107 (7%)
 Frame = -1

Query  499  LRIVLNDNN--HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LG  329
            L+IVLNDN+   G    DR G + DDD+D  + LVIV + D   H P +EEQ+WG+E + 
Sbjct  221  LQIVLNDNHVPLGGERNDRGGDEDDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQ  280

Query  328  NSADGERKE--DAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKVSR  200
             + DGERKE  D AK N   G AP  +IGYS+HG+   +HS +K  R
Sbjct  281  PAGDGERKEMADVAKGNGPAGTAPAARIGYSSHGFSMQHHSTYKYIR  327



>ref|XP_010939299.1| PREDICTED: FIP1[V]-like protein isoform X2 [Elaeis guineensis]
Length=1427

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 7/107 (7%)
 Frame = -1

Query  499  LRIVLNDNN--HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LG  329
            L+IVLNDN+   G    DR G + DDD+D  + LVIV + D   H P +EEQ+WG+E + 
Sbjct  221  LQIVLNDNHVPLGGERNDRGGDEDDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQ  280

Query  328  NSADGERKE--DAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKVSR  200
             + DGERKE  D AK N   G AP  +IGYS+HG+   +HS +K  R
Sbjct  281  PAGDGERKEMADVAKGNGPAGTAPAARIGYSSHGFSMQHHSTYKYIR  327



>ref|XP_010939301.1| PREDICTED: FIP1[V]-like protein isoform X3 [Elaeis guineensis]
Length=1232

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 7/107 (7%)
 Frame = -1

Query  499  LRIVLNDNN--HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LG  329
            L+IVLNDN+   G    DR G + DDD+D  + LVIV + D   H P +EEQ+WG+E + 
Sbjct  221  LQIVLNDNHVPLGGERNDRGGDEDDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQ  280

Query  328  NSADGERKE--DAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKVSR  200
             + DGERKE  D AK N   G AP  +IGYS+HG+   +HS +K  R
Sbjct  281  PAGDGERKEMADVAKGNGPAGTAPAARIGYSSHGFSMQHHSTYKYIR  327



>ref|XP_009396447.1| PREDICTED: uncharacterized protein LOC103981443 [Musa acuminata 
subsp. malaccensis]
Length=1406

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 5/105 (5%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNS  323
            L+IVLND++HG +G+DR    G DDDD  D LVIV + D   H P  +EQ  G+E + ++
Sbjct  222  LQIVLNDSDHGRLGVDRNDRIGIDDDDREDDLVIVTDEDQHRHVPATDEQNCGEEAMQST  281

Query  322  ADGERKE--DAAKVNVGPGYA--PKIGYSNHGYHHPYHSQFKVSR  200
             DGERKE  D AK+    G A   +IGY+ HG H  +HS +K  R
Sbjct  282  GDGERKEMVDVAKIASATGSALEARIGYNTHGSHPQHHSMYKYIR  326



>ref|XP_006598040.1| PREDICTED: uncharacterized protein LOC100799266 [Glycine max]
Length=1304

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLN+NNH  M    M    ++++D  + LVIVA  D P+     EE EWG+    +A
Sbjct  149  LKIVLNENNHMAMERGGMADGDEEEEDGDEELVIVAGGD-PNQ--GAEEPEWGENATLAA  205

Query  319  -DGERKEDAAKVNVGPGYA--PKIGYSNHGYHHPYHSQFK  209
             DGERK+ A ++    G A  PKIGYSN GY HP+HS FK
Sbjct  206  GDGERKDAAGELAKAGGAAVPPKIGYSNQGY-HPFHSPFK  244



>ref|XP_010687726.1| PREDICTED: FIP1[V]-like protein [Beta vulgaris subsp. vulgaris]
Length=1398

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = -1

Query  409  PLVIVANS--------DDPSHQPMVEEQEWGDELGNSADGERKEDAAKVNVGPGYAPKIG  254
            PLVIVA+              QP VE+QEWGDE G SA+G+   DAAK N G   APK G
Sbjct  226  PLVIVADDHTAAVAAAAAGGVQP-VEDQEWGDEAGQSAEGKDNADAAKANAGLATAPKSG  284

Query  253  YSNHGYHHPYHSQFKVSR  200
            Y+ +GY HP+HSQFK  R
Sbjct  285  YAPYGY-HPFHSQFKYVR  301



>ref|XP_011033462.1| PREDICTED: FIP1[V]-like protein isoform X1 [Populus euphratica]
Length=1336

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  499  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  326
            L+IVLNDN H  G MG+DR  GD DDDD+DGDPLVIVA+ D P+    +EEQ+WG     
Sbjct  152  LQIVLNDNTHPGGTMGIDREIGDDDDDDEDGDPLVIVADGDRPNQ--AMEEQDWGGGEDG  209

Query  325  SADGE------RKEDAAKVNVGPGYA-PKIGYSNHGY-HHPYHSQFKVSR  200
             A         RKE    V  G     PKIGYSNH Y HHP+HSQFK  R
Sbjct  210  VAAAGGGAEGERKEGGEAVGKGNAVVGPKIGYSNHVYHHHPFHSQFKYVR  259



>ref|XP_006279559.1| hypothetical protein CARUB_v10025759mg [Capsella rubella]
 gb|EOA12457.1| hypothetical protein CARUB_v10025759mg [Capsella rubella]
Length=1204

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  245
            PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  189  PLVIVADTD--PNQPM-EEQHWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  244

Query  244  HGYHHPYHSQFKVSR  200
            HGY HP+HSQFK  R
Sbjct  245  HGY-HPFHSQFKYVR  258



>dbj|BAB10995.1| unnamed protein product [Arabidopsis thaliana]
Length=1189

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  245
            PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  190  PLVIVADTD--PNQPM-EEQMWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  245

Query  244  HGYHHPYHSQFKVSR  200
            HGY HP+HSQFK  R
Sbjct  246  HGY-HPFHSQFKYVR  259



>ref|NP_200612.2| FIP1 [V]-like protein [Arabidopsis thaliana]
 sp|F4KDH9.1|FIPS5_ARATH RecName: Full=FIP1[V]-like protein; Short=AtFIP1(V); AltName: 
Full=Factor interacting with poly(A) polymerase 1-like 5; Short=AtFIPS5; 
AltName: Full=Protein HOMOLOG OF YEAST FIP1 [V] 
[Arabidopsis thaliana]
 gb|AED96990.1| FIP1 [V]-like protein [Arabidopsis thaliana]
Length=1196

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  245
            PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  190  PLVIVADTD--PNQPM-EEQMWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  245

Query  244  HGYHHPYHSQFKVSR  200
            HGY HP+HSQFK  R
Sbjct  246  HGY-HPFHSQFKYVR  259



>ref|XP_002864546.1| hypothetical protein ARALYDRAFT_495910 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40805.1| hypothetical protein ARALYDRAFT_495910 [Arabidopsis lyrata subsp. 
lyrata]
Length=1205

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  245
            PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  193  PLVIVADTD--PNQPM-EEQLWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  248

Query  244  HGYHHPYHSQFKVSR  200
            HGY HP+HSQFK  R
Sbjct  249  HGY-HPFHSQFKYVR  262



>ref|XP_002523498.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF38837.1| ATP binding protein, putative [Ricinus communis]
Length=1365

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 43/81 (53%), Gaps = 15/81 (19%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGD-----------ELGNSADGERKEDAAKVNVGPGYAP  263
            PLVIVA+ D  ++Q M+EEQ+WG            E      G         NV  G  P
Sbjct  208  PLVIVADGD--ANQAMMEEQDWGSVGEDAAAATGAEGERKEGGGETAGGKGGNVIAG--P  263

Query  262  KIGYSNHGYHHPYHSQFKVSR  200
            KIGYSNH YHHP+HSQFK  R
Sbjct  264  KIGYSNHVYHHPFHSQFKYVR  284



>ref|XP_007011968.1| FIP1, putative isoform 1 [Theobroma cacao]
 gb|EOY29587.1| FIP1, putative isoform 1 [Theobroma cacao]
Length=1356

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 73/107 (68%), Gaps = 11/107 (10%)
 Frame = -1

Query  499  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  320
            L+IVLNDNNHGPM M+R G  G+DDD+DGD LVIVA+ D       VEEQEWG+E G  A
Sbjct  186  LQIVLNDNNHGPMAMERGGMMGEDDDEDGDALVIVADGD---ANQGVEEQEWGEEGGQVA  242

Query  319  DGERKEDAAKVNVGPGYA-------PKIGYSNHGYHHPYHSQFKVSR  200
            DGERKE      VG G +       PK+GYSNHGY HP+HSQFK  R
Sbjct  243  DGERKEGGEAGKVGGGASGGGSVVPPKVGYSNHGY-HPFHSQFKYVR  288



>ref|XP_006401136.1| hypothetical protein EUTSA_v10012479mg [Eutrema salsugineum]
 gb|ESQ42589.1| hypothetical protein EUTSA_v10012479mg [Eutrema salsugineum]
Length=1200

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKEDA-AKVNVGPGYAP---KIGYSNH  242
            PLVIVA++D   +QPM EEQ WG++     DG+ K+   A    GPG A    K GYS+H
Sbjct  193  PLVIVADAD--PNQPM-EEQMWGEDGLQVVDGDGKDGGEAGKGSGPGGASGQSKTGYSSH  249

Query  241  GYHHPYHSQFKVSR  200
            GY HP+HSQFK  R
Sbjct  250  GY-HPFHSQFKYVR  262



>ref|XP_010483368.1| PREDICTED: uncharacterized protein LOC104761899 [Camelina sativa]
Length=1216

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE----DAAKVNVGPGYAPKIGYSNH  242
            PLVIVA++D   +QPM EEQ WG++     +G+ K+           G    PK GYS+H
Sbjct  207  PLVIVADTD--PNQPM-EEQLWGEDGLQGVEGDGKDGGEAGKGTGPGGATGPPKAGYSSH  263

Query  241  GYHHPYHSQFKVSR  200
            GYHHP+HSQFK  R
Sbjct  264  GYHHPFHSQFKYVR  277



>gb|KEH37870.1| Fip1 [V]-like protein [Medicago truncatula]
Length=1152

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 15/111 (14%)
 Frame = -1

Query  499  LRIVLNDNNH---GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  329
            L+IVLND+NH          +G D D+DDD+   LVIVA   +P+    +E+QEWG+   
Sbjct  157  LQIVLNDDNHMAMAMEKGGVVGDDDDEDDDEDGGLVIVAG--EPNQ--GLEDQEWGESAN  212

Query  328  NSADGERKE--DAAKVNVGPG-----YAPKIGYSNHGY-HHPYHSQFKVSR  200
               DGERK+  +  K   GP        PK+GY NH + +HP+HSQFK  R
Sbjct  213  IPVDGERKDAVEPGKPVAGPAAGGIPVVPKVGYGNHAHGYHPFHSQFKYIR  263



>gb|KEH37869.1| Fip1 [V]-like protein [Medicago truncatula]
Length=1328

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 15/111 (14%)
 Frame = -1

Query  499  LRIVLNDNNH---GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  329
            L+IVLND+NH          +G D D+DDD+   LVIVA   +P+    +E+QEWG+   
Sbjct  157  LQIVLNDDNHMAMAMEKGGVVGDDDDEDDDEDGGLVIVAG--EPNQ--GLEDQEWGESAN  212

Query  328  NSADGERKE--DAAKVNVGPG-----YAPKIGYSNHGY-HHPYHSQFKVSR  200
               DGERK+  +  K   GP        PK+GY NH + +HP+HSQFK  R
Sbjct  213  IPVDGERKDAVEPGKPVAGPAAGGIPVVPKVGYGNHAHGYHPFHSQFKYIR  263



>gb|KFK27337.1| hypothetical protein AALP_AA8G370000 [Arabis alpina]
Length=1172

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = -1

Query  409  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGYHH  230
            PLVIVA++D  ++QPM EEQ WG++     DG+ KE        P    K GYS HGY H
Sbjct  170  PLVIVADAD--TNQPM-EEQFWGEDGLQGVDGDGKEGGEAGKGIPTGPVKAGYSGHGY-H  225

Query  229  PYHSQFKVSR  200
            P+HSQ+K  R
Sbjct  226  PFHSQYKYVR  235



>emb|CDY43886.1| BnaC09g33570D [Brassica napus]
Length=1161

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = -1

Query  499  LRIVLNDNN-HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--LG  329
            L+IVLNDNN        R     +DDDDD +PLVIV ++D   +QPM E+Q WG++   G
Sbjct  131  LQIVLNDNNVMMGGDNRRSRMGDNDDDDDEEPLVIVTDTD--QNQPM-EDQLWGEDGLQG  187

Query  328  NSADGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
               +G+     A    GPG A   PK GYS+HGY HP+HSQFK  R
Sbjct  188  VEGEGKEGGGEALKGSGPGGAVGPPKAGYSSHGY-HPFHSQFKYVR  232



>ref|XP_009120319.1| PREDICTED: filaggrin isoform X1 [Brassica rapa]
Length=1172

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 63/109 (58%), Gaps = 13/109 (12%)
 Frame = -1

Query  499  LRIVLNDNN----HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-  335
            L+IVLNDNN               + DDDDDD +PLVIV ++D   +QPM E+Q WG++ 
Sbjct  139  LQIVLNDNNVMMGGDNRRSRMGDNEADDDDDDEEPLVIVTDTD--QNQPM-EDQLWGEDG  195

Query  334  -LGNSADGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKVSR  200
              G   +G+     A    GPG A   PK GYS+HGY HP+HSQFK  R
Sbjct  196  LQGVEGEGKEGGGEALKGSGPGGAVGPPKAGYSSHGY-HPFHSQFKYVR  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441662578200