BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4501

Length=797
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002285008.1|  PREDICTED: probable serine/threonine-protein...    129   3e-30   Vitis vinifera
emb|CBI20299.3|  unnamed protein product                                129   3e-30   Vitis vinifera
ref|XP_012084963.1|  PREDICTED: probable serine/threonine-protein...    126   5e-29   Jatropha curcas
ref|XP_006370257.1|  hypothetical protein POPTR_0001s41040g             125   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011029485.1|  PREDICTED: probable serine/threonine-protein...    125   1e-28   Populus euphratica
ref|XP_011004643.1|  PREDICTED: probable serine/threonine-protein...    125   1e-28   Populus euphratica
ref|XP_002533553.1|  Cell division protein kinase, putative             122   8e-28   
gb|KDO62492.1|  hypothetical protein CISIN_1g004999mg                   119   1e-26   Citrus sinensis [apfelsine]
ref|XP_006464753.1|  PREDICTED: probable serine/threonine-protein...    119   1e-26   Citrus sinensis [apfelsine]
ref|XP_006451848.1|  hypothetical protein CICLE_v10007617mg             119   1e-26   Citrus clementina [clementine]
ref|XP_007021485.1|  Kinase superfamily protein                         117   7e-26   
gb|KHN28061.1|  Putative serine/threonine-protein kinase                116   1e-25   Glycine soja [wild soybean]
ref|XP_003540463.1|  PREDICTED: probable serine/threonine-protein...    116   2e-25   Glycine max [soybeans]
ref|XP_008226629.1|  PREDICTED: probable serine/threonine-protein...    112   2e-24   Prunus mume [ume]
ref|XP_007214536.1|  hypothetical protein PRUPE_ppa002182mg             112   3e-24   Prunus persica
ref|XP_008366989.1|  PREDICTED: probable serine/threonine-protein...    110   2e-23   
ref|XP_010112974.1|  putative serine/threonine-protein kinase           110   2e-23   
ref|XP_007149459.1|  hypothetical protein PHAVU_005G071900g             109   3e-23   Phaseolus vulgaris [French bean]
ref|XP_009784583.1|  PREDICTED: probable serine/threonine-protein...    109   4e-23   Nicotiana sylvestris
ref|XP_004296506.1|  PREDICTED: probable serine/threonine-protein...    108   6e-23   Fragaria vesca subsp. vesca
ref|XP_006592612.1|  PREDICTED: probable serine/threonine-protein...    107   2e-22   Glycine max [soybeans]
ref|XP_006592611.1|  PREDICTED: probable serine/threonine-protein...    107   2e-22   Glycine max [soybeans]
ref|XP_003540111.1|  PREDICTED: probable serine/threonine-protein...    107   2e-22   Glycine max [soybeans]
ref|XP_009356808.1|  PREDICTED: probable serine/threonine-protein...    106   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_009604687.1|  PREDICTED: probable serine/threonine-protein...    105   5e-22   Nicotiana tomentosiformis
ref|XP_010272444.1|  PREDICTED: probable serine/threonine-protein...    105   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008456032.1|  PREDICTED: probable serine/threonine-protein...    105   5e-22   Cucumis melo [Oriental melon]
ref|XP_004146248.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   Cucumis sativus [cucumbers]
ref|XP_010260204.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010260205.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_003596750.1|  Serine/threonine protein kinase cdk9               103   3e-21   Medicago truncatula
ref|XP_006582174.1|  PREDICTED: probable serine/threonine-protein...    100   4e-20   Glycine max [soybeans]
ref|XP_003527250.1|  PREDICTED: probable serine/threonine-protein...    100   4e-20   Glycine max [soybeans]
ref|XP_006582173.1|  PREDICTED: probable serine/threonine-protein...    100   4e-20   Glycine max [soybeans]
ref|XP_006582172.1|  PREDICTED: probable serine/threonine-protein...    100   4e-20   Glycine max [soybeans]
ref|XP_004487708.1|  PREDICTED: probable serine/threonine-protein...    100   5e-20   Cicer arietinum [garbanzo]
gb|KJB45710.1|  hypothetical protein B456_007G322800                  99.8    6e-20   Gossypium raimondii
ref|XP_008386179.1|  PREDICTED: probable serine/threonine-protein...  99.8    6e-20   
gb|KJB45709.1|  hypothetical protein B456_007G322800                  99.4    8e-20   Gossypium raimondii
ref|XP_003543242.1|  PREDICTED: probable serine/threonine-protein...  98.6    2e-19   Glycine max [soybeans]
ref|XP_004244231.1|  PREDICTED: probable serine/threonine-protein...  98.6    2e-19   Solanum lycopersicum
ref|XP_009341042.1|  PREDICTED: probable serine/threonine-protein...  97.8    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_006348252.1|  PREDICTED: probable serine/threonine-protein...  97.4    4e-19   Solanum tuberosum [potatoes]
ref|XP_010060566.1|  PREDICTED: probable serine/threonine-protein...  91.3    5e-17   Eucalyptus grandis [rose gum]
gb|EYU26381.1|  hypothetical protein MIMGU_mgv1a002080mg              88.6    3e-16   Erythranthe guttata [common monkey flower]
gb|KJB81951.1|  hypothetical protein B456_013G168700                  86.7    1e-15   Gossypium raimondii
gb|KHG22910.1|  hypothetical protein F383_06618                       86.7    1e-15   Gossypium arboreum [tree cotton]
ref|XP_010535099.1|  PREDICTED: probable serine/threonine-protein...  83.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_006303920.1|  hypothetical protein CARUB_v10008475mg           75.9    4e-12   
ref|XP_006392837.1|  hypothetical protein EUTSA_v10011275mg           74.3    1e-11   Eutrema salsugineum [saltwater cress]
gb|AAO42182.1|  putative cell division-related protein                73.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175713.1|  putative serine/threonine protein kinase            73.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545831.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010500934.1|  PREDICTED: probable serine/threonine-protein...  70.5    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010035763.1|  PREDICTED: probable serine/threonine-protein...  69.3    5e-10   Eucalyptus grandis [rose gum]
ref|XP_010694981.1|  PREDICTED: probable serine/threonine-protein...  69.3    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694982.1|  PREDICTED: probable serine/threonine-protein...  69.3    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002274225.1|  PREDICTED: probable serine/threonine-protein...  68.9    7e-10   
ref|XP_010089557.1|  putative serine/threonine-protein kinase         67.4    2e-09   Morus notabilis
ref|XP_010462163.1|  PREDICTED: probable serine/threonine-protein...  66.6    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011098308.1|  PREDICTED: probable serine/threonine-protein...  65.9    8e-09   Sesamum indicum [beniseed]
ref|XP_004505574.1|  PREDICTED: probable serine/threonine-protein...  61.6    1e-08   
ref|XP_004303108.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-08   Fragaria vesca subsp. vesca
ref|XP_010479840.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-08   Camelina sativa [gold-of-pleasure]
gb|KHG15886.1|  hypothetical protein F383_23532                       63.9    3e-08   Gossypium arboreum [tree cotton]
gb|KJB31671.1|  hypothetical protein B456_005G200800                  63.5    4e-08   Gossypium raimondii
ref|XP_008337487.1|  PREDICTED: probable serine/threonine-protein...  63.2    7e-08   
ref|XP_008342901.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-07   
ref|XP_009341988.1|  PREDICTED: probable serine/threonine-protein...  61.2    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009341987.1|  PREDICTED: probable serine/threonine-protein...  61.2    3e-07   
ref|XP_009336211.1|  PREDICTED: probable serine/threonine-protein...  61.2    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009336210.1|  PREDICTED: probable serine/threonine-protein...  61.2    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_002517906.1|  ATP binding protein, putative                    60.1    6e-07   Ricinus communis
ref|XP_009618010.1|  PREDICTED: probable serine/threonine-protein...  59.7    7e-07   Nicotiana tomentosiformis
ref|XP_008229000.1|  PREDICTED: probable serine/threonine-protein...  60.1    7e-07   Prunus mume [ume]
ref|XP_011100264.1|  PREDICTED: probable serine/threonine-protein...  59.7    9e-07   Sesamum indicum [beniseed]
ref|XP_007043608.1|  ATP binding protein, putative                    59.7    9e-07   
ref|XP_009802541.1|  PREDICTED: probable serine/threonine-protein...  58.9    1e-06   Nicotiana sylvestris
gb|KJB77256.1|  hypothetical protein B456_012G128100                  58.9    1e-06   Gossypium raimondii
gb|KHG29152.1|  hypothetical protein F383_15438                       58.9    2e-06   Gossypium arboreum [tree cotton]
gb|KJB77258.1|  hypothetical protein B456_012G128100                  58.2    3e-06   Gossypium raimondii
gb|EYU24917.1|  hypothetical protein MIMGU_mgv1a002276mg              57.8    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_006859032.1|  PREDICTED: probable serine/threonine-protein...  55.5    2e-05   
ref|XP_008448301.1|  PREDICTED: probable serine/threonine-protein...  54.7    4e-05   Cucumis melo [Oriental melon]
ref|XP_008448300.1|  PREDICTED: probable serine/threonine-protein...  54.7    4e-05   Cucumis melo [Oriental melon]
ref|XP_008448297.1|  PREDICTED: probable serine/threonine-protein...  54.7    5e-05   Cucumis melo [Oriental melon]
ref|XP_012088269.1|  PREDICTED: probable serine/threonine-protein...  54.3    5e-05   
ref|XP_003539929.1|  PREDICTED: probable serine/threonine-protein...  54.3    6e-05   Glycine max [soybeans]
ref|XP_007198826.1|  hypothetical protein PRUPE_ppa002174mg           54.3    6e-05   Prunus persica
ref|XP_006447296.1|  hypothetical protein CICLE_v10014434mg           54.3    6e-05   Citrus clementina [clementine]
gb|KDO53901.1|  hypothetical protein CISIN_1g005111mg                 53.9    7e-05   Citrus sinensis [apfelsine]
ref|XP_003539536.1|  PREDICTED: probable serine/threonine-protein...  53.9    8e-05   Glycine max [soybeans]
ref|XP_007132719.1|  hypothetical protein PHAVU_011G119100g           53.9    8e-05   Phaseolus vulgaris [French bean]
ref|XP_011656948.1|  PREDICTED: probable serine/threonine-protein...  52.0    3e-04   Cucumis sativus [cucumbers]
emb|CDP14791.1|  unnamed protein product                              52.0    4e-04   Coffea canephora [robusta coffee]
ref|XP_006357474.1|  PREDICTED: probable serine/threonine-protein...  51.6    4e-04   Solanum tuberosum [potatoes]
ref|XP_006376478.1|  hypothetical protein POPTR_0013s13360g           51.6    4e-04   
emb|CDY25738.1|  BnaC03g69370D                                        51.6    5e-04   Brassica napus [oilseed rape]



>ref|XP_002285008.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=713

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDSRESPRERLS KAS +LRV   A+ RREEAYR KD  + ND +TMLI
Sbjct  2    MGCICCKPSAIEDSRESPRERLSSKASSNLRVAGPASSRREEAYRVKDRFDSNDGRTMLI  61

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQANGSVRL      +R+ E+GEY+V      HPG+ ++PKA E
Sbjct  62   EKQANGSVRLHGE-NVERKRERGEYVVAQ----HPGLGSIPKAME  101



>emb|CBI20299.3| unnamed protein product [Vitis vinifera]
Length=712

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDSRESPRERLS KAS +LRV   A+ RREEAYR KD  + ND +TMLI
Sbjct  1    MGCICCKPSAIEDSRESPRERLSSKASSNLRVAGPASSRREEAYRVKDRFDSNDGRTMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQANGSVRL      +R+ E+GEY+V      HPG+ ++PKA E
Sbjct  61   EKQANGSVRLHGE-NVERKRERGEYVVAQ----HPGLGSIPKAME  100



>ref|XP_012084963.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Jatropha curcas]
 gb|KDP27060.1| hypothetical protein JCGZ_20995 [Jatropha curcas]
Length=713

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS K S DLRV+   + RREEAYR KD  + ND + MLI
Sbjct  1    MGCVCCKPSAIEDSKESPRERLSSKVSADLRVSRATSSRREEAYRVKDRYDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +K +NGSVRL  +  ++R+ EK EY V      HPGM T+PKATE
Sbjct  61   DKHSNGSVRLHGSENAERKREKMEYAVAQ----HPGMGTIPKATE  101



>ref|XP_006370257.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
 gb|ERP66826.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
Length=713

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS K S DLRV+   + RREEAYRAKD  + ND +TMLI
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSSKPSSDLRVSRATSSRREEAYRAKDQYDSNDGRTMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGS+R+      DR+ +K EY V      HPGM ++PKATE
Sbjct  61   DKQVNGSLRVHGVEHVDRKRDKSEYAVLH----HPGMGSIPKATE  101



>ref|XP_011029485.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=714

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS KAS DLRV+   + RREEAYRAKD  + ND +TMLI
Sbjct  2    MGCICCKPSAIEDSKESPRERLSSKASSDLRVSRATSSRREEAYRAKDRCDGNDGRTMLI  61

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGS+R+      +R+ +K EY V      HPGM ++PKATE
Sbjct  62   DKQVNGSLRVHGGEHVERKRDKSEYAVVH----HPGMGSIPKATE  102



>ref|XP_011004643.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
 ref|XP_011004644.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=713

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS K S DLRV+   + RREEAYRAKD  + ND +TMLI
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSSKPSSDLRVSRATSSRREEAYRAKDQYDSNDGRTMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGS+R       DR+ +K EY V      HPGM ++PKATE
Sbjct  61   DKQVNGSLRGHGGEHVDRKRDKSEYAVLH----HPGMGSIPKATE  101



>ref|XP_002533553.1| Cell division protein kinase, putative [Ricinus communis]
 gb|EEF28833.1| Cell division protein kinase, putative [Ricinus communis]
Length=649

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS++SP ERLS KAS DLRV+   + RREEAYR KD  + ND + MLI
Sbjct  1    MGCVCCKPSAIEDSKDSPGERLSSKASSDLRVSRATSSRREEAYRVKDRYDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +K +NGSVRL     +DR+ EK EY V     PHPG  T+PKA E
Sbjct  61   DKHSNGSVRLHGGENADRKREKMEYAVA---QPHPGKGTVPKAIE  102



>gb|KDO62492.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=720

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+C KPSAIEDS+ESPRERLS KAS DL   R  + RREE YR KD  + ND + MLI
Sbjct  1    MGCICFKPSAIEDSKESPRERLSSKASSDLRGSRATSSRREEVYRVKDRFDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVRL      DR+ EK EY+V      HPGM ++PKA+E
Sbjct  61   DKQVNGSVRLHGE-NFDRKREKMEYVVAQH---HPGMGSIPKASE  101



>ref|XP_006464753.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
 gb|KDO62493.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
 gb|KDO62494.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=709

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+C KPSAIEDS+ESPRERLS KAS DL   R  + RREE YR KD  + ND + MLI
Sbjct  1    MGCICFKPSAIEDSKESPRERLSSKASSDLRGSRATSSRREEVYRVKDRFDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVRL      DR+ EK EY+V      HPGM ++PKA+E
Sbjct  61   DKQVNGSVRLHGE-NFDRKREKMEYVVAQH---HPGMGSIPKASE  101



>ref|XP_006451848.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451849.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451850.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65088.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65089.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65090.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
Length=709

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+C KPSAIEDS+ESPRERLS KAS DL   R  + RREE YR KD  + ND + MLI
Sbjct  1    MGCICFKPSAIEDSKESPRERLSSKASSDLRGSRATSSRREEVYRVKDRFDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVRL      DR+ EK EY+V      HPGM ++PKA+E
Sbjct  61   DKQVNGSVRLHGE-NFDRKREKMEYVVAQH---HPGMGSIPKASE  101



>ref|XP_007021485.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY13010.1| Kinase superfamily protein [Theobroma cacao]
Length=707

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRER S KAS D+RV+   + RREEAYRAKD  + N+ +TMLI
Sbjct  2    MGCICCKPSAIEDSKESPRERPSSKASSDVRVSRATSSRREEAYRAKDRYDNNEGRTMLI  61

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NG+VR+      +R+ +K EY+V+     HPGM ++PKATE
Sbjct  62   DKQVNGAVRVHGE-NLERKRDKMEYVVSQ----HPGMGSVPKATE  101



>gb|KHN28061.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=708

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATG---RREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS KA  DLRV+ G   RREEA+R KD  + ND +T LI
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSSKAVSDLRVSRGASSRREEAFRVKDRYDNNDGRTALI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVR+Q     +R+ EK EY V      HPG+ ++PKA E
Sbjct  61   DKQGNGSVRVQGE-SFERKREKMEYTVAQ----HPGIGSVPKAME  100



>ref|XP_003540463.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=708

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATG---RREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPRERLS KA  DLRV+ G   RREEA+R KD  + ND +T LI
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSSKAVSDLRVSRGASSRREEAFRVKDRYDNNDGRTALI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVR+Q     +R+ EK EY V      HPG+ ++PKA E
Sbjct  61   DKQGNGSVRVQGE-SFERKREKMEYAVAQ----HPGIGSVPKAME  100



>ref|XP_008226629.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=704

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS++SPRERLS KA+ D    RVA+ RREEAYRAKD  + ND +TMLI
Sbjct  1    MGCIYCKPSAIEDSKDSPRERLSSKAASDSRATRVASSRREEAYRAKDRYDSNDGRTMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NG+VR  +    +R+ EK EY+       HPGM ++PKA E
Sbjct  61   DKQLNGNVR-SHGENFERKREKMEYVAAQ----HPGMGSIPKAVE  100



>ref|XP_007214536.1| hypothetical protein PRUPE_ppa002182mg [Prunus persica]
 gb|EMJ15735.1| hypothetical protein PRUPE_ppa002182mg [Prunus persica]
Length=704

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS++SPRERLS KA+ D    RVA+ RREEAYRAKD  + ND +TMLI
Sbjct  1    MGCIYCKPSAIEDSKDSPRERLSSKAASDSRATRVASSRREEAYRAKDRYDSNDGRTMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NG+VR  +    +R+ EK EY+       HPGM ++PKA E
Sbjct  61   DKQLNGNVR-SHGENFERKREKMEYVAAQ----HPGMGSVPKAVE  100



>ref|XP_008366989.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
 ref|XP_008366997.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=704

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS+ESPRERLS K + D    RVA+ RREE+YRAKD  + ND + MLI
Sbjct  1    MGCIFCKPSAIEDSKESPRERLSNKGASDSRTTRVASSRREESYRAKDRYDGNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NG VRL      +R+ EK EY+V      HPG+  +PKA E
Sbjct  61   DKQVNGPVRLXGE-NFERKREKMEYVVAQ----HPGIGIIPKAAE  100



>ref|XP_010112974.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC35133.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=897

 Score =   110 bits (275),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAI+DS+ESPRERLS KAS D+R+A   + RREE Y+AKD  + ND + MLI
Sbjct  1    MGCICCKPSAIDDSKESPRERLSSKASSDVRIARVTSSRREEGYQAKDQYDTNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +K  NG  RL      +R+ EK EY+    +  HPG  ++PKA+E
Sbjct  61   DKHTNGEARLHRE-NVERKREKMEYV----FAQHPGTGSIPKASE  100



>ref|XP_007149459.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
 gb|ESW21453.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
Length=708

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATG---RREEAYRAKDPLECNDVKTMLI  660
            MG +CCKPSAIEDS+ESPRERLS KA  DLRV+ G   RREE +R KD  + N+ +T LI
Sbjct  1    MGGMCCKPSAIEDSKESPRERLSSKAVSDLRVSRGTSSRREEVFRVKDRYDNNEGRTALI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVR+Q +   +R+ EK EY V      HPG+ ++PKA E
Sbjct  61   DKQGNGSVRVQGD-SIERKREKMEYAVAQ----HPGIGSVPKAME  100



>ref|XP_009784583.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=712

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 8/106 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREE-AYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDSR+SPRERLS K++  L   R  + RREE AYR KD L+  D K ML
Sbjct  1    MGCVCGKPSAIEDSRDSPRERLSSKSAASLRGPRAGSSRREESAYRVKDRLDSIDGKAML  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ EK E+IV T    HPG+  LPK +E
Sbjct  61   IDKQVNGSVRLQSE-NYERKREKQEFIVATH---HPGIGILPKGSE  102



>ref|XP_004296506.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
 ref|XP_011462384.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
Length=705

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS+ESPRERLS KA+ D    RVA+ RREEAYRAKD  + ND + MLI
Sbjct  1    MGCMYCKPSAIEDSKESPRERLSNKAASDSRAARVASSRREEAYRAKDRYDSNDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +K +NG+ R  +    +R+ EK EY+       HPGM ++PKA E
Sbjct  61   DKHSNGAAR-SHGENYERKREKMEYVTAL----HPGMGSIPKAAE  100



>ref|XP_006592612.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X3 [Glycine max]
Length=710

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKA-SVDLRVATG---RREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S KA S+D RV+ G   RRE+AYR KD  + NDV+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKAASLDSRVSRGASLRREDAYRGKDRYDGNDVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQDE-NIERKRERMECVVAA--QQHPGAGSVPKAME  103



>ref|XP_006592611.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=711

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKA-SVDLRVATG---RREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S KA S+D RV+ G   RRE+AYR KD  + NDV+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKAASLDSRVSRGASLRREDAYRGKDRYDGNDVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQDE-NIERKRERMECVVAA--QQHPGAGSVPKAME  103



>ref|XP_003540111.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 gb|KHN44914.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=710

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKA-SVDLRVATG---RREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S KA S+D RV+ G   RRE+AYR KD  + NDV+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKAASLDSRVSRGASLRREDAYRGKDRYDGNDVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQDE-NIERKRERMECVVAA--QQHPGAGSVPKAME  103



>ref|XP_009356808.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
 ref|XP_009356809.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 71/105 (68%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR---VATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS+ESPRERLS   + D R   VA+ RREE+YRAKD  +  D + MLI
Sbjct  1    MGCIFCKPSAIEDSKESPRERLSNMGASDSRTTWVASSRREESYRAKDRYDGTDGRAMLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NG VRL N    +R+ EK EY+V      HPG+  +PKA E
Sbjct  61   DKQVNGPVRL-NGENFERKREKMEYVVAQ----HPGIGIIPKAAE  100



>ref|XP_009604687.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=712

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 8/106 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREE-AYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDSR+SPR+RLS K +  L   R  + RRE+ AYR KD L+  D K ML
Sbjct  1    MGCVCGKPSAIEDSRDSPRDRLSSKNAATLRGPRAGSSRREDAAYRVKDRLDSIDGKAML  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ +   +R+ EK E+IV T    HPG+  LPK +E
Sbjct  61   IDKQVNGSVRLQGD-NYERKREKQEFIVATH---HPGIGILPKGSE  102



>ref|XP_010272444.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
 ref|XP_010272445.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
 ref|XP_010272446.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
Length=708

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 71/105 (68%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            M C+CCK SAIEDSRESPRERLS K+S DLRV    + RREEA+R KD  +  + K  L+
Sbjct  1    MSCICCKASAIEDSRESPRERLSNKSSSDLRVPRAVSSRREEAFRGKDRPDGREGKATLV  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQ NGS+RL + G  +R+ EK EY        HP M ++PKATE
Sbjct  61   EKQGNGSIRL-HGGNFERKREKAEYAFVH----HPVMGSIPKATE  100



>ref|XP_008456032.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
Length=707

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPR+R+S K S DLRVA   +  REEAYRAKD  + ND +  LI
Sbjct  1    MGCVCCKPSAIEDSKESPRDRVSSKTSSDLRVARLTSSSREEAYRAKDQYDGNDARVTLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQ NGS RL      +R+ EK E++       HP M  +PKA E
Sbjct  61   EKQVNGSGRLPGE-NFERKREKMEHMTAQ----HPSMGRIPKAAE  100



>ref|XP_004146248.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis sativus]
 gb|KGN57623.1| hypothetical protein Csa_3G232950 [Cucumis sativus]
Length=707

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 70/105 (67%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS+ESPR+R+S K S DLRVA   +  REEAYRAKD  + ND +  LI
Sbjct  1    MGCVCCKPSAIEDSKESPRDRVSSKTSSDLRVARLTSSSREEAYRAKDQYDGNDARVTLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGS RL      +R+ EK E++       HP M  +PKA E
Sbjct  61   DKQVNGSGRLPGE-NCERKREKMEHMTAQ----HPSMGRIPKAAE  100



>ref|XP_010260204.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nelumbo nucifera]
Length=714

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+C K SAIEDSRESPRERLS KAS DLRV    + RREE +R KD ++  D +  LI
Sbjct  1    MGCICFKASAIEDSRESPRERLSSKASSDLRVPRATSSRREEVFRGKDRVDSRDGRVTLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQ NGS+RL       +R EK EY+V       P + ++PKA E
Sbjct  61   EKQGNGSIRLHGENFEKKR-EKAEYVVVQ----QPAVGSIPKAME  100



>ref|XP_010260205.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nelumbo nucifera]
Length=713

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+C K SAIEDSRESPRERLS KAS DLRV    + RREE +R KD ++  D +  LI
Sbjct  1    MGCICFKASAIEDSRESPRERLSSKASSDLRVPRATSSRREEVFRGKDRVDSRDGRVTLI  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            EKQ NGS+RL       +R EK EY+V       P + ++PKA E
Sbjct  61   EKQGNGSIRLHGENFEKKR-EKAEYVVVQ----QPAVGSIPKAME  100



>ref|XP_003596750.1| Serine/threonine protein kinase cdk9 [Medicago truncatula]
 gb|AES67001.1| cyclin-dependent kinase [Medicago truncatula]
Length=712

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 11/108 (10%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATG---RREEAYRAKDPLE-CNDVKTML  657
            MGC+CCKPSAIEDS++SPRERLS K  +D RV+ G   RREEAYR KD  +  ND +  L
Sbjct  1    MGCMCCKPSAIEDSKDSPRERLSNKPVLDSRVSRGASSRREEAYRVKDRNDNNNDARMAL  60

Query  658  IEK--QANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+K  Q NGSVR+  +   +R+ EK EY++     PHPG+ ++PKA E
Sbjct  61   IDKHGQGNGSVRVHGD-NFERKREKMEYVIA----PHPGIGSVPKAME  103



>ref|XP_006582174.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X4 [Glycine max]
Length=709

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCK-ASVDL---RVATGRREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S K AS+D    R A+ RRE+AYR KD  + N+V+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKSASLDSCVPRGASLRREDAYRVKDRYDGNNVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQSE-NVERKRERMECVVAA--QQHPGAGSVPKALE  103



>ref|XP_003527250.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
Length=710

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCK-ASVDL---RVATGRREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S K AS+D    R A+ RRE+AYR KD  + N+V+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKSASLDSCVPRGASLRREDAYRVKDRYDGNNVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQSE-NVERKRERMECVVAA--QQHPGAGSVPKALE  103



>ref|XP_006582173.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X3 [Glycine max]
Length=710

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCK-ASVDL---RVATGRREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S K AS+D    R A+ RRE+AYR KD  + N+V+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKSASLDSCVPRGASLRREDAYRVKDRYDGNNVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQSE-NVERKRERMECVVAA--QQHPGAGSVPKALE  103



>ref|XP_006582172.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=711

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCK-ASVDL---RVATGRREEAYRAKDPLECNDVKTML  657
            MG +CCKPSAIEDS+ESPRER+S K AS+D    R A+ RRE+AYR KD  + N+V+T L
Sbjct  1    MGGVCCKPSAIEDSKESPRERMSTKSASLDSCVPRGASLRREDAYRVKDRYDGNNVRTAL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ+    +R+ E+ E +V      HPG  ++PKA E
Sbjct  61   IDKQGNGSVRLQSE-NVERKRERMECVVAA--QQHPGAGSVPKALE  103



>ref|XP_004487708.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=712

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 12/109 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATG---RREE-AYRAKDPLE-CNDVKTM  654
            MGC+CCKPSAIEDS+ESPRERLS KA ++ RV+ G   RREE AYR KD  +  ND +T 
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSNKAVLESRVSRGASSRREELAYRVKDRCDNNNDARTA  60

Query  655  LIEK--QANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            LI+K  Q NGSVR+  +   +R+ EK EY+V      HPG+ ++PKA E
Sbjct  61   LIDKQGQGNGSVRVHGD-NFERKREKMEYVVAQ----HPGLGSVPKAME  104



>gb|KJB45710.1| hypothetical protein B456_007G322800 [Gossypium raimondii]
Length=663

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 12/105 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSA +D+++ PR+R S KAS D+RV    + RREEAYRAKD  E     TMLI
Sbjct  2    MGCICCKPSAFDDNKDCPRDRPSSKASSDVRVPRATSSRREEAYRAKDRHE----NTMLI  57

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ   SVRL +    DR+ EK EY+V      HPGM ++PKAT+
Sbjct  58   DKQVTDSVRLHSENL-DRKREKMEYVVVQ----HPGMGSVPKATQ  97



>ref|XP_008386179.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=703

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS+ESPRERLS K + D    RVA+ RREE YR KD  + N  + ML 
Sbjct  1    MGCIYCKPSAIEDSKESPRERLSNKGASDSRTTRVASSRREETYRPKDRYDGNGGRAMLT  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            + Q NG VR Q     +R+ EK EY+V      HPG+  +PKA E
Sbjct  61   DTQVNGPVRSQGE-NFERKREKMEYVVAQ----HPGIGIIPKAAE  100



>gb|KJB45709.1| hypothetical protein B456_007G322800 [Gossypium raimondii]
Length=700

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 12/105 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSA +D+++ PR+R S KAS D+RV    + RREEAYRAKD  E     TMLI
Sbjct  2    MGCICCKPSAFDDNKDCPRDRPSSKASSDVRVPRATSSRREEAYRAKDRHE----NTMLI  57

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ   SVRL +    DR+ EK EY+V      HPGM ++PKAT+
Sbjct  58   DKQVTDSVRLHSENL-DRKREKMEYVVVQ----HPGMGSVPKATQ  97



>ref|XP_003543242.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 ref|XP_006594767.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=712

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 11/108 (10%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERL---SCKASVDLRVATG---RREEAYRAKDPLECNDVKT  651
            MGC+CCKPSAIEDS+ESPRERL   S K+  DLRV+ G   RREEA+  KD  + ND + 
Sbjct  1    MGCMCCKPSAIEDSKESPRERLSSKSDKSVSDLRVSRGTSSRREEAFWLKDRYDNNDGRA  60

Query  652  MLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             LI+KQ NGSVR+Q     +R+ EK EY V      HPG+ ++PKA E
Sbjct  61   ALIDKQGNGSVRVQGE-SFERKREKMEYTVAQ----HPGIGSVPKAME  103



>ref|XP_004244231.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=705

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 69/106 (65%), Gaps = 16/106 (15%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV----ATGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDSR+SPRERLS K++  LR      + RREEAYR KD L+  D KTML
Sbjct  1    MGCVCGKPSAIEDSRDSPRERLSSKSAASLRGPRTGGSSRREEAYRVKDRLDSIDGKTML  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ     +R+ EK E I            TLPK++E
Sbjct  61   IDKQVNGSVRLQTE-NYERKREKQELI-----------GTLPKSSE  94



>ref|XP_009341042.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 8/105 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+ CKPSAIEDS+ESPRERLS K + D    RVA+ RREE YR KD  + +  + ML 
Sbjct  1    MGCIYCKPSAIEDSKESPRERLSNKGASDSRTTRVASSRREETYRPKDRYDGDGGRAMLT  60

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            + Q NG VR Q     +R+ EK EY+V      HPG+  +PKA E
Sbjct  61   DTQVNGPVRSQGE-NFERKREKMEYVVAQ----HPGIGIIPKAAE  100



>ref|XP_006348252.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348253.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 16/106 (15%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDSR+SPRERLS K++  LR      + RREEAYR KD L+  D K ML
Sbjct  1    MGCVCGKPSAIEDSRDSPRERLSSKSAASLRGPRTGGSSRREEAYRVKDRLDSIDGKAML  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+KQ NGSVRLQ     +R+ EK E I            TLPK++E
Sbjct  61   IDKQVNGSVRLQTENH-ERKREKQELI-----------GTLPKSSE  94



>ref|XP_010060566.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 ref|XP_010060567.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW67346.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
 gb|KCW67347.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
Length=713

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 10/107 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAY-RAKDPL-ECNDVKTM  654
            MGC+CCKPSAIEDS+ESPRERLS K S DLR++     RREE Y R KD     +D + +
Sbjct  1    MGCVCCKPSAIEDSKESPRERLSSKTSSDLRLSRTVLPRREEGYHRVKDRYGSGDDGRAI  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             I+KQ NGS+RLQ +   +R  EK E+IV      HP   ++PKA E
Sbjct  61   SIDKQMNGSLRLQAD-NLERSREKMEHIVAQ----HPSTGSVPKAME  102



>gb|EYU26381.1| hypothetical protein MIMGU_mgv1a002080mg [Erythranthe guttata]
Length=718

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRV---ATGRREEAYRAKDPLE--CNDVKTM  654
            MGC C KP AI+DS++SP ERL  +A  DLR     + RREE Y+AKD  +    D + +
Sbjct  1    MGCACGKPYAIDDSKDSPVERLPSRAVSDLRAPRPVSSRREEIYQAKDRSDNGSYDGRMI  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            L++KQ NGSVRL      DR+ EKGEY     +HP  GM  +P+A+E
Sbjct  61   LMDKQVNGSVRLHGE-NFDRKREKGEYTSVVHHHPRAGM--VPRASE  104



>gb|KJB81951.1| hypothetical protein B456_013G168700 [Gossypium raimondii]
Length=703

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 12/105 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS++SP    + K S+D+RV+   + RRE++ R KD    ++ +TMLI
Sbjct  1    MGCICCKPSAIEDSKQSP----TSKVSLDVRVSMATSSRREDSQRTKDRYGNSEGRTMLI  56

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVR+      DR+ EK E +V      HPG  ++PKA E
Sbjct  57   DKQVNGSVRIHGE-NLDRKREKVECVVRQ----HPGRGSVPKAIE  96



>gb|KHG22910.1| hypothetical protein F383_06618 [Gossypium arboreum]
Length=691

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 12/105 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+CCKPSAIEDS++SP    + K S+D+RV+   + RRE++ R KD    ++ +TMLI
Sbjct  1    MGCICCKPSAIEDSKQSP----TSKVSLDVRVSMATSSRREDSQRTKDRYGNSEGRTMLI  56

Query  661  EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            +KQ NGSVR+      DR+ EK E +V      HPG  ++PKA E
Sbjct  57   DKQVNGSVRIHGE-NLDRKREKVECVVRQ----HPGRGSVPKAIE  96



>ref|XP_010535099.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010535100.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=677

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+CCKPSAIEDS+ESPR+RLS K++ + R    VA+ RREE+ R K+  +   V+ +L
Sbjct  1    MGCICCKPSAIEDSKESPRDRLSNKSASEFRVSRTVASSRREESLRTKERSDVIGVRPVL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             +KQAN  + L     + ++   G    +     HP M ++PKATE
Sbjct  61   SDKQANPMMHLHGESLNRKKVRMGNIASS-----HPAMGSVPKATE  101



>ref|XP_006303920.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 ref|XP_006303921.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 gb|EOA36818.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 gb|EOA36819.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
Length=694

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPRER S K+S + R    VA+ RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRERFSSKSSSEFRVSRPVASSRREETLRIKERPDVVSVRPVL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
              KQAN S+ L+    S RR +K E +  T+  P     T+ KATE
Sbjct  61   SNKQANVSMNLRGENLS-RREKKIENVAATS--PLAMSITIAKATE  103



>ref|XP_006392837.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
 gb|ESQ30123.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
Length=700

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 7/107 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA----TGRREEAYRAKDPLECNDVKTML  657
            MGC+ CKPSAIEDS++SPRER S K+S + RV+    + RREE  R K+  +   V+ +L
Sbjct  1    MGCVWCKPSAIEDSKDSPRERFSNKSSSEFRVSRPVTSSRREEPIRTKERPDVVSVRPVL  60

Query  658  IE-KQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             + KQAN S+ L+    S RR +K    V T+Y P  G+ T+ KA E
Sbjct  61   SDNKQANVSMHLRGENLSSRREKKKIENVATSYLPM-GI-TIAKAAE  105



>gb|AAO42182.1| putative cell division-related protein [Arabidopsis thaliana]
Length=694

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPRER S K+S + R    VA+ RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRERFSSKSSSEFRVSRPVASSRREEPLRIKERSDVVSVRPVL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
              KQ+N S+ L+    S RR ++ E +  T+  P     T+ KATE
Sbjct  61   SNKQSNVSLHLRGENLS-RREKRIENVAATS--PLAMSITIAKATE  103



>ref|NP_175713.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAF87863.1|AC022520_7 similar to cdc2 protein kinase [Arabidopsis thaliana]
 gb|AEE32884.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=694

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPRER S K+S + R    VA+ RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRERFSSKSSSEFRVSRPVASSRREEPLRIKERSDVVSVRPVL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
              KQ+N S+ L+    S RR ++ E +  T+  P     T+ KATE
Sbjct  61   SNKQSNVSLHLRGENLS-RREKRIENVAATS--PLAMSITIAKATE  103



>ref|XP_010545831.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010545832.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=679

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 15/107 (14%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRES-PRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTM  654
            MGC+CCKPSAIEDS+ES PRERLS K++ ++R    V + RREE+ R K+  +   V+ +
Sbjct  1    MGCVCCKPSAIEDSKESPPRERLSSKSAAEVRASGAVTSSRREESLRTKERSDGTSVRPV  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            L +KQ N  +R     + +  + KGE +          M ++PKATE
Sbjct  61   LSDKQGNPPMRF----RGEDFNRKGERMAKI------AMGSIPKATE  97



>ref|XP_010500934.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=696

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA----TGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPRER S K+S + RV+    + RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRERFSSKSSSEFRVSRPVTSSRREETLRIKERSDVVSVRPVL  60

Query  658  I-EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
               KQAN S+ L+    S RR +K E +  T+  P     T+ KATE
Sbjct  61   SNNKQANVSLNLRGENLS-RREKKIENVAATS--PLAMSITIAKATE  104



>ref|XP_010035763.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW47225.1| hypothetical protein EUGRSUZ_K01034 [Eucalyptus grandis]
Length=709

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD----LRVATGRREEAYRAKDPLECNDVKTML  657
            MGC+  K SA++DSRESP++R+S    +      R+ + RRE  +RA+D  +  DV  ML
Sbjct  1    MGCMYSKSSAVDDSRESPKDRVSSSRRLSEVKTSRLDSSRRENGFRARD--KVGDVSVML  58

Query  658  IEKQANGSVRL---QNNGKSDR-RSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+K+ NGS R    Q   KSDR + ++ E         HPG   +PKA E
Sbjct  59   IDKKVNGSARFCDDQIEKKSDRLQKQRRERAEAAAAADHPGAGRVPKAVE  108



>ref|XP_010694981.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=744

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 57/104 (55%), Gaps = 20/104 (19%)
 Frame = +1

Query  484  YRMGCLCCKPSAIED-SRESPRERLSCKASVDLRVATGRREEAYRAKDPLEC--------  636
            ++MGC+CCKPSAIED S+ESPRERLS K  V  R A+ RRE+     +  +         
Sbjct  5    FKMGCICCKPSAIEDDSKESPRERLSTKTLVSSRTASLRREDRNNNNNHHQINVNNNNNN  64

Query  637  ----------NDVKTMLIEKQA-NGSVRLQNNGKSDRRSEKGEY  735
                      N+ K MLI+KQ  NGSVRL       +R +K EY
Sbjct  65   TNNIEGGDNNNEEKVMLIDKQVNNGSVRLHGESFERKREKKPEY  108



>ref|XP_010694982.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=743

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 57/104 (55%), Gaps = 20/104 (19%)
 Frame = +1

Query  484  YRMGCLCCKPSAIED-SRESPRERLSCKASVDLRVATGRREEAYRAKDPLEC--------  636
            ++MGC+CCKPSAIED S+ESPRERLS K  V  R A+ RRE+     +  +         
Sbjct  5    FKMGCICCKPSAIEDDSKESPRERLSTKTLVSSRTASLRREDRNNNNNHHQINVNNNNNN  64

Query  637  ----------NDVKTMLIEKQA-NGSVRLQNNGKSDRRSEKGEY  735
                      N+ K MLI+KQ  NGSVRL       +R +K EY
Sbjct  65   TNNIEGGDNNNEEKVMLIDKQVNNGSVRLHGESFERKREKKPEY  108



>ref|XP_002274225.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
 ref|XP_010656972.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
 ref|XP_010656973.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=710

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 18/107 (17%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATGRREEAYRAKDPLECNDVKTMLIEKQ  669
            MGC+  KPSAI+DSRESPRER   K S + R   G+R  + R +   E  DVK +LI+++
Sbjct  1    MGCIVGKPSAIKDSRESPRERFPNKESAEAR---GQRLNSLRRE---ESGDVKVVLIDRK  54

Query  670  ANGSVRLQNNG----KSDR-RSEKGEYIVTTTYHPHPGMATLPKATE  795
            AN SVR+ +      K  R RSE G          HPGM  +PKA+E
Sbjct  55   ANSSVRVYDEDYKLEKEKRERSEVGGV-------NHPGMGRVPKASE  94



>ref|XP_010089557.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38003.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=708

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (64%), Gaps = 10/108 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSC--KASVDLRVA---TGRREEAYRAKDPLECNDVKTM  654
            MGC C K SA+EDSR SPR+R S   K   +L+V+   + RREE  R K+ L+  DVK M
Sbjct  1    MGCACSKTSAVEDSRASPRKRSSSSSKHYSELKVSRHNSSRREEGVRIKERLDGGDVKVM  60

Query  655  LIEKQANGSVRLQNNGKSDR-RSEKGEYIVTTTYHPHPGMATLPKATE  795
            LI+K+ANGS R   + +++R ++EK E IV      HPG   +PKAT+
Sbjct  61   LIDKKANGSRRSYGDHETERKKAEKAEVIVPN----HPGFGRIPKATQ  104



>ref|XP_010462163.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=691

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA----TGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPR+R S K+S + RV+    + RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRDRFSSKSSSEFRVSRPVTSSRREETLRIKERSDVVSVRPVL  60

Query  658  I-EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
               KQAN S  L       RR +K E +  T+  P     T+ KATE
Sbjct  61   SNNKQANVSFNL------SRREKKIENVAATS--PLAMSITIAKATE  99



>ref|XP_011098308.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
 ref|XP_011098309.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=708

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLE--CNDVKTM  654
            MGC+C K  AI+  +ESP ERLS K   DL   R  + RREE+Y AKD L+   N+ + +
Sbjct  1    MGCVCGKAYAIDGDKESPGERLSNKGISDLRASRSVSSRREESYLAKDRLDNGGNEGRVV  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            LI+KQ NGS RL+     +R+ EK EY  T+  H HPG   + +ATE
Sbjct  61   LIDKQVNGSARLRGE-NFERKREKAEY--TSAVH-HPGAGMVLRATE  103



>ref|XP_004505574.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=145

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 15/112 (13%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD-----LRVATGRREEAYRAKD-PLECNDVKT  651
            MGC+C K SA+EDS ES  ++    ++       LR+ + +R E  R KD  L+  D K 
Sbjct  1    MGCICSKGSAVEDSNESNSKKFQSNSTRPSELNVLRLNSSKRVEGGRVKDLSLDRGDAKA  60

Query  652  M--LIEKQANGSVRLQN--NGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
               LIEK++NGS++L +  NG+  ++ EK E  V      HPG  ++PKA E
Sbjct  61   KASLIEKKSNGSMKLYDDQNGRK-KKIEKAELTVID----HPGFGSVPKAIE  107



>ref|XP_004303108.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
Length=703

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 59/111 (53%), Gaps = 14/111 (13%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKAS---VDLRV--ATGRREEAYRAKDPLE-----CN  639
            MG +C KPSA+EDSRESP +R S  +S    D+++      + E  R+KD L+       
Sbjct  1    MGLICGKPSAVEDSRESPPKRSSLASSKRHSDIKIPRLNSSKREVVRSKDRLDGGAAAGA  60

Query  640  DVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKAT  792
             VK MLI+K  NGSVRL ++    ++ E     V      HPG   +PK T
Sbjct  61   AVKVMLIDKAINGSVRLYDDQNKSKKIENAGITVLD----HPGSRRIPKVT  107



>ref|XP_010479840.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=689

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 15/107 (14%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA----TGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPSAIEDS++SPR+R S K+S + RV+    + RREE  R K+  +   V+ +L
Sbjct  1    MGCVCGKPSAIEDSKDSPRDRFSSKSSSEFRVSRPVTSSRREETLRIKERSDVVSVRPVL  60

Query  658  I-EKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
               KQAN S+         RR +K E +  T+  P     T+ KATE
Sbjct  61   SNHKQANVSL--------SRREKKIENVAATS--PLAMSITIAKATE  97



>gb|KHG15886.1| hypothetical protein F383_23532 [Gossypium arboreum]
Length=703

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 14/107 (13%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A++DSRE+ ++RL+ K S+D    R  +  REE  R+KD     DVK +L+
Sbjct  1    MGCMSSKSAALKDSRENQKKRLTRKGSLDKLVQRANSSGREEVVRSKDKKGGGDVKVLLV  60

Query  661  EKQANGSVRLQNNG--KSDRRSEKGEYI---------VTTTYHPHPG  768
             K++NGS R   N   K+ R  +K E +         VT   H HPG
Sbjct  61   NKKSNGSSRFSYNDQVKNKRILDKFEVVVKNEVEKCGVTIAGHHHPG  107



>gb|KJB31671.1| hypothetical protein B456_005G200800 [Gossypium raimondii]
Length=703

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 14/107 (13%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD---LRVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A++DSRE+ ++RL+ K S+D    R  +  REE  R+KD     DVK +L+
Sbjct  1    MGCMSSKSAAVQDSRENQKKRLTRKGSLDKLVQRANSSGREEVVRSKDKKGGGDVKVLLV  60

Query  661  EKQANGSVRLQNNGKSD--RRSEKGEYI---------VTTTYHPHPG  768
             K++NGS R   N + +  R  +K E +         VT   H HPG
Sbjct  61   NKKSNGSSRFSYNDQVENKRILDKFEVVVKNEVEKCGVTIAGHHHPG  107



>ref|XP_008337487.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=704

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 12/108 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C K SA+EDSRESP +R   +S +   +L+V+   + +REE    KD L    DVK
Sbjct  1    MGLICTKASAVEDSRESPPKRVASISSRQHSELKVSRFNSSKREEPVWTKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKAT  792
             ML++K+ NGS+R  +  KS ++ +K E  +      HPG   +P AT
Sbjct  61   IMLVDKKVNGSIRSYDVTKS-KKMDKAEVALLD----HPGSRRIPNAT  103



>ref|XP_008342901.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=710

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 12/108 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C KPSA+EDSRESP +R   +S +   +L+V+   + +RE+    KD L    DVK
Sbjct  1    MGLICTKPSAVEDSRESPPKRTSSISRRHHSELKVSRFGSSKREDPVWIKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKAT  792
             ML++K+ NGS+R  +  KS ++ +K E     T+  H G   +P AT
Sbjct  61   VMLVDKKVNGSMRSYDQTKS-KKIDKAE----ATFLDHLGSRRIPNAT  103



>ref|XP_009341988.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Pyrus x bretschneideri]
Length=710

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C KPSA+EDSRESP +R   +S +   +L+V+   + +RE+    KD L    DVK
Sbjct  1    MGLICTKPSAVEDSRESPPKRTSSISSRRHSELKVSRFGSSKREDPVWIKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             ML++K+ NGS+R  +  KS ++ ++ E     T+  H G   +P A
Sbjct  61   VMLVDKKVNGSMRSYDQTKS-KKIDRAE----ATFLDHLGSGRIPNA  102



>ref|XP_009341987.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Pyrus x bretschneideri]
Length=711

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C KPSA+EDSRESP +R   +S +   +L+V+   + +RE+    KD L    DVK
Sbjct  1    MGLICTKPSAVEDSRESPPKRTSSISSRRHSELKVSRFGSSKREDPVWIKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             ML++K+ NGS+R  +  KS ++ ++ E     T+  H G   +P A
Sbjct  61   VMLVDKKVNGSMRSYDQTKS-KKIDRAE----ATFLDHLGSGRIPNA  102



>ref|XP_009336211.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Pyrus x bretschneideri]
Length=710

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C KPSA+EDSRESP +R   +S +   +L+V+   + +RE+    KD L    DVK
Sbjct  1    MGLICTKPSAVEDSRESPPKRTSSISSRRHSELKVSRFGSSKREDPVWIKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             ML++K+ NGS+R  +  KS ++ ++ E     T+  H G   +P A
Sbjct  61   VMLVDKKVNGSMRSYDQTKS-KKIDRAE----ATFLDHLGSGRIPNA  102



>ref|XP_009336210.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Pyrus x bretschneideri]
Length=711

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRER---LSCKASVDLRVA---TGRREEAYRAKDPL-ECNDVK  648
            MG +C KPSA+EDSRESP +R   +S +   +L+V+   + +RE+    KD L    DVK
Sbjct  1    MGLICTKPSAVEDSRESPPKRTSSISSRRHSELKVSRFGSSKREDPVWIKDRLGGGGDVK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             ML++K+ NGS+R  +  KS ++ ++ E     T+  H G   +P A
Sbjct  61   VMLVDKKVNGSMRSYDQTKS-KKIDRAE----ATFLDHLGSGRIPNA  102



>ref|XP_002517906.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44424.1| ATP binding protein, putative [Ricinus communis]
Length=734

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K       ++SP+ERLS K S+D RVA   + RREE  R+K   +  DV+ MLI
Sbjct  1    MGCISSKDIK---QKKSPKERLSRKGSLDRRVAHVNSSRREEGVRSKSKSDIGDVRVMLI  57

Query  661  EKQANGSVRLQNN  699
            +K+ NGS+RL ++
Sbjct  58   DKKKNGSIRLYDD  70



>ref|XP_009618010.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=434

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (58%), Gaps = 10/107 (9%)
 Frame = +1

Query  490  MGCLCCKPS-AIEDSRESPRERLSCK----ASVDLRVATGRREEAYRAKDPLECNDVKTM  654
            MGC+C K S A +D R+  ++R   K    AS   RV + +REE++R KD LE  DVK  
Sbjct  1    MGCVCGKSSPAAKDRRDGQKKRDFTKGANVASHVPRVVSSKREESFRMKDMLENGDVKLG  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            LI+++ NGS +++++   ++  EK   IV      HPG   +PKA E
Sbjct  61   LIDRKNNGSRKVRDD-HYEQIKEKLGLIVNG----HPGYGVVPKALE  102



>ref|XP_008229000.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=707

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 63/111 (57%), Gaps = 18/111 (16%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSC---------KASVDLRVATGRREEAYRAKDPL-ECN  639
            MG +C KPSA+EDSRESP +R S          KAS   R+ + +R+ A   KD L   +
Sbjct  1    MGLICSKPSAVEDSRESPPKRSSSSLSKQGSERKAS---RLNSSKRKAAVWTKDKLGGGS  57

Query  640  DVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKAT  792
            DVK ML++K+ +GS+RL +  KS ++ EK +  V      HPG   +  AT
Sbjct  58   DVKVMLMDKKVSGSMRLYDQNKS-KKIEKADVAVLD----HPGSRRIVNAT  103



>ref|XP_011100264.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=700

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 16/109 (15%)
 Frame = +1

Query  490  MGCLCCKPS-AIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPS A++ S ESP++R   K + +LR A   + +R+E+   K+ LE  D+K  L
Sbjct  1    MGCVCGKPSSAVKASEESPKQRELIKKTSELREARAISSKRDESLSRKEKLETGDIKIGL  60

Query  658  IEKQANGSVRLQNN---GKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+++ +GS R++++    K D   + G +         PG+  LPKA E
Sbjct  61   IDRKVSGSRRVRDDYYEKKRDSSEDVGNF---------PGLRNLPKAIE  100



>ref|XP_007043608.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOX99439.1| ATP binding protein, putative [Theobroma cacao]
Length=728

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A+EDSRE+ +ERL+ K S+D    R  + RRE+A R+K+  +  DVK +LI
Sbjct  1    MGCMSSKSAAVEDSRENHKERLTRKGSLDKLVPRANSSRREQAVRSKE-YDGGDVKVLLI  59

Query  661  EKQANGSVRLQNNGKSDRR  717
            +K+ +GS R   N + +++
Sbjct  60   DKKTSGSNRFCYNDQVEKK  78



>ref|XP_009802541.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=714

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 10/107 (9%)
 Frame = +1

Query  490  MGCLCCKPS-AIEDSRESPRERLSCK----ASVDLRVATGRREEAYRAKDPLECNDVKTM  654
            MGC+C KPS A +D R+  ++R   K    AS   R  + +REE++R KD LE  DVK  
Sbjct  1    MGCVCGKPSLAAKDRRDVQKKRDFTKGANVASRAPRAISSKREESFRVKDMLENGDVKLG  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            LI+++ NGS R++++   ++  EK   IV       PG   +PKA E
Sbjct  61   LIDRKNNGSRRVRDD-HYEQIKEKLGLIVNGG----PGYGVVPKALE  102



>gb|KJB77256.1| hypothetical protein B456_012G128100 [Gossypium raimondii]
Length=727

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 20/113 (18%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A+EDSRE+ +E+L  K S+D    R  + RRE++  +KD  +  DVK +LI
Sbjct  1    MGCMSSKSAAVEDSRENHKEKLRRKGSLDKLVPRADSSRREDSVGSKDKYDGGDVKVLLI  60

Query  661  EKQANGSVRLQNNGKS--DRRSEKGEYIVTTT---------------YHPHPG  768
            +K+ +GS R   N ++  +R  +K E I T                 +H HPG
Sbjct  61   DKKTSGSNRYCYNDRAEKERIIDKFEVIETINKVENCEVANTITVGHHHLHPG  113



>gb|KHG29152.1| hypothetical protein F383_15438 [Gossypium arboreum]
Length=727

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 20/113 (18%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A+EDSRE+ +E+L  K S+D    R  + RRE++  +KD  +  DVK +LI
Sbjct  1    MGCMSSKSAAVEDSRENHKEKLRRKGSLDKLVPRADSSRREDSVGSKDKYDGGDVKVLLI  60

Query  661  EKQANGSVRLQNNGKS--DRRSEKGEYIVTTT---------------YHPHPG  768
            +K+ +GS R   N ++  +R  +K E I T                 +H HPG
Sbjct  61   DKKTSGSNRYCYNDRAEKERIIDKFEVIETINKVENCEVANTITVGHHHLHPG  113



>gb|KJB77258.1| hypothetical protein B456_012G128100 [Gossypium raimondii]
Length=662

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDL---RVATGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K +A+EDSRE+ +E+L  K S+D    R  + RRE++  +KD  +  DVK +LI
Sbjct  1    MGCMSSKSAAVEDSRENHKEKLRRKGSLDKLVPRADSSRREDSVGSKDKYDGGDVKVLLI  60

Query  661  EKQANGSVRLQNNGKSDR  714
            +K+ +GS R   N ++++
Sbjct  61   DKKTSGSNRYCYNDRAEK  78



>gb|EYU24917.1| hypothetical protein MIMGU_mgv1a002276mg [Erythranthe guttata]
Length=692

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +1

Query  490  MGCLCCKPS-AIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTML  657
            MGC+C KPS A+++S +SP++R   + + +LRVA   + +R+E++  K+  E  D+K  L
Sbjct  1    MGCVCGKPSSAVKNSGDSPKQRELMRKTSELRVARAISSKRDESFSLKERFEKVDMKIGL  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            ++K+ NGS+R + +    +R    + +        P M  +P+A E
Sbjct  61   VDKKMNGSLRGRPDYYEKKRGSSADMV------NFPVMGNIPRAVE  100



>ref|XP_006859032.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Amborella trichopoda]
 gb|ERN20499.1| hypothetical protein AMTR_s00068p00177220 [Amborella trichopoda]
Length=699

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 6/106 (6%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATGRREEAYRAKDPLECNDVKTMLIEKQ  669
            MGC C K S IEDS ESP+ER+S K+S    V   +R+E +  +      +V      KQ
Sbjct  1    MGCRCSKASVIEDSNESPQERVSSKSSARQIVTPLKRDEFFENEG--NKGEVIVRFPVKQ  58

Query  670  ANGSVRLQNNGKSDRRSEK----GEYIVTTTYHPHPGMATLPKATE  795
             NG + +     ++R+ E+    G   +    +PHP + ++P+  E
Sbjct  59   GNGLLHIYGEETTERKRERNNQHGGQRIAYAVNPHPRIGSIPRDAE  104



>ref|XP_008448301.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Cucumis melo]
Length=708

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 23/122 (19%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERL--------------------SCKASVDLRVATGRREEA  609
            MGC C KPS  ED +    E+                     S K   D+R+ + +R ++
Sbjct  1    MGCQCSKPSVDEDGKNRATEKFPSRKASRVNLLRKGDDLGLNSLKRDEDVRINSSQRSDS  60

Query  610  YRAKDPLECNDVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             R+K   +  D+K   ++K+ NGS R+ ++    ++ E+ E  ++  Y   PG  ++PKA
Sbjct  61   IRSKVKTDGGDIKLAYLDKRVNGSNRVHDDQIEKKKRERLEVAISVNY---PGKGSIPKA  117

Query  790  TE  795
             E
Sbjct  118  ME  119



>ref|XP_008448300.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Cucumis melo]
Length=716

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 23/122 (19%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERL--------------------SCKASVDLRVATGRREEA  609
            MGC C KPS  ED +    E+                     S K   D+R+ + +R ++
Sbjct  1    MGCQCSKPSVDEDGKNRATEKFPSRKASRVNLLRKGDDLGLNSLKRDEDVRINSSQRSDS  60

Query  610  YRAKDPLECNDVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             R+K   +  D+K   ++K+ NGS R+ ++    ++ E+ E  ++  Y   PG  ++PKA
Sbjct  61   IRSKVKTDGGDIKLAYLDKRVNGSNRVHDDQIEKKKRERLEVAISVNY---PGKGSIPKA  117

Query  790  TE  795
             E
Sbjct  118  ME  119



>ref|XP_008448297.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
 ref|XP_008448298.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
 ref|XP_008448299.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
Length=724

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 23/122 (19%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERL--------------------SCKASVDLRVATGRREEA  609
            MGC C KPS  ED +    E+                     S K   D+R+ + +R ++
Sbjct  1    MGCQCSKPSVDEDGKNRATEKFPSRKASRVNLLRKGDDLGLNSLKRDEDVRINSSQRSDS  60

Query  610  YRAKDPLECNDVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             R+K   +  D+K   ++K+ NGS R+ ++    ++ E+ E  ++  Y   PG  ++PKA
Sbjct  61   IRSKVKTDGGDIKLAYLDKRVNGSNRVHDDQIEKKKRERLEVAISVNY---PGKGSIPKA  117

Query  790  TE  795
             E
Sbjct  118  ME  119



>ref|XP_012088269.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Jatropha curcas]
 gb|KDP24118.1| hypothetical protein JCGZ_25775 [Jatropha curcas]
Length=722

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 7/73 (10%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K S     +++P+ER+S K S+D RVA   + RREE  R+    +  DVK MLI
Sbjct  1    MGCISSKDSI----KDTPKERISRKGSLDRRVAHVNSSRREEGVRSNSKSDSGDVKVMLI  56

Query  661  EKQANGSVRLQNN  699
            +K+  GS RL ++
Sbjct  57   DKKTYGSNRLYDD  69



>ref|XP_003539929.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
 gb|KHN35228.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=695

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 10/108 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD-----LRVATGRREEAYRAKDPLEC-NDVKT  651
            MGC+C K SA+EDS+E+  E+    ++       LR+ + RR +    KD L     VK 
Sbjct  1    MGCICSKASAVEDSKEAVTEKFQSYSTRPSELNVLRLNSTRRVDEGGVKDVLIVGGHVKG  60

Query  652  MLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             LI+K+ANGS +L  +  + ++ EK E  V      H G   +PKA E
Sbjct  61   SLIDKKANGSGQLYGDHDAKKKLEKLELTVVD----HIGPGRVPKAIE  104



>ref|XP_007198826.1| hypothetical protein PRUPE_ppa002174mg [Prunus persica]
 gb|EMJ00025.1| hypothetical protein PRUPE_ppa002174mg [Prunus persica]
Length=706

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 18/103 (17%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSC---------KASVDLRVATGRREEAYRAKDPL-ECN  639
            MG +C KPSA+EDSRESP +R S          KAS   R+ + +R+EA   KD L    
Sbjct  1    MGLICSKPSAVEDSRESPPKRSSSSLSKQRSERKAS---RLNSSKRKEAVWTKDKLGGGG  57

Query  640  DVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPG  768
            DVK ML++K+ +GS+RL +  KS ++ EK +  V      HPG
Sbjct  58   DVKVMLMDKKVSGSMRLYDQNKS-KKIEKADVAVLD----HPG  95



>ref|XP_006447296.1| hypothetical protein CICLE_v10014434mg [Citrus clementina]
 ref|XP_006494946.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
 gb|ESR60536.1| hypothetical protein CICLE_v10014434mg [Citrus clementina]
Length=714

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATGRREEAYRAKDPLECNDVKTMLIEKQ  669
            MG  C KP+A+EDSRE    +         RV++ RREE  R K   +  DVK +LI+K+
Sbjct  1    MGGKCAKPTAVEDSRERLNRKEESLNKHVARVSSSRREEVVRPKGKGDNTDVKVLLIDKR  60

Query  670  ANGSVRLQNNGKSDR  714
             NGS R  ++ K ++
Sbjct  61   VNGSNRYYDHHKIEK  75



>gb|KDO53901.1| hypothetical protein CISIN_1g005111mg [Citrus sinensis]
Length=714

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVATGRREEAYRAKDPLECNDVKTMLIEKQ  669
            MG  C KP+A+EDSRE    +         RV++ RREE  R K   +  DVK +LI+K+
Sbjct  1    MGGKCAKPTAVEDSRERLNRKEESLNKHVARVSSSRREEVVRPKGKGDNTDVKVLLIDKR  60

Query  670  ANGSVRLQNNGKSDR  714
             NGS R  ++ K ++
Sbjct  61   VNGSNRYYDHHKIEK  75



>ref|XP_003539536.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
 gb|KHN27895.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=696

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 11/109 (10%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRES-PRERLSC--KASVDLRVATG---RREEAYRAKDP-LECNDVK  648
            MGC+  K +A+EDSRE   RE  S   +A+  ++V+     +R +    KD  L+  D+K
Sbjct  1    MGCIASKSAAVEDSREGVAREFTSSSKRATAKMKVSASNSEKRVDGVWGKDKVLDGVDMK  60

Query  649  TMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
              LI+K+++GS+R  +N    ++ +K E  V      HPG+  +PKA E
Sbjct  61   ASLIDKESSGSMRSSDNKNGRKKKQKPELAVLD----HPGVGRVPKALE  105



>ref|XP_007132719.1| hypothetical protein PHAVU_011G119100g [Phaseolus vulgaris]
 ref|XP_007132720.1| hypothetical protein PHAVU_011G119100g [Phaseolus vulgaris]
 gb|ESW04713.1| hypothetical protein PHAVU_011G119100g [Phaseolus vulgaris]
 gb|ESW04714.1| hypothetical protein PHAVU_011G119100g [Phaseolus vulgaris]
Length=699

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVD-----LRVATGRREEAYRAKDP-LECNDVKT  651
            MGCLC K SA+EDS+    ++L   ++       LR+ + RR +   AKD  +E   VK 
Sbjct  1    MGCLCSKSSAVEDSKVGVTKKLQSYSTRPSELNVLRLNSTRRVDEGGAKDVIIEGGHVKG  60

Query  652  MLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
             LI+K+ANGS +L  +    ++ EK E  VT   H  PG   +PKA E
Sbjct  61   SLIDKKANGSGQLYVDHDGKKKIEKPE--VTVVDHLGPG--RIPKAVE  104



>ref|XP_011656948.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis sativus]
 ref|XP_011656949.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis sativus]
Length=716

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 23/122 (19%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERL--------------------SCKASVDLRVATGRREEA  609
            MGC C KPS  ED +    E+                     S K   D+R+ + +R ++
Sbjct  1    MGCQCSKPSVDEDGKNRATEKFPSRKASRVNLLRKGDDMGLNSLKRDEDVRINSLQRSDS  60

Query  610  YRAKDPLECNDVKTMLIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKA  789
             R+K   +  D+K   ++K+ NGS R+ ++    ++ E+ E  ++  Y   PG  ++PKA
Sbjct  61   IRSKVKTDGGDMKLAYLDKRVNGSNRVHDDQIEKKKRERLEAAISANY---PGKGSIPKA  117

Query  790  TE  795
             E
Sbjct  118  ME  119



>emb|CDP14791.1| unnamed protein product [Coffea canephora]
Length=699

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = +1

Query  490  MGCLCCKPSA-IEDSRESPRERLSCKAS--VDL-RVATGRREEAYRAKDPLECNDVKTML  657
            MG LC K S+ I+D  ESP  R   KAS   DL R  + RR+E++R K      ++K  +
Sbjct  1    MGNLCGKSSSTIKDGGESPNGRKLAKASSQTDLTRAVSSRRDESFRLKKKFNSGEIKIHM  60

Query  658  IEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            I+++ +GS R++++     +   G       Y+P PG  ++PK  E
Sbjct  61   IDRKLSGSRRVRDDYYDKNKENSG---ALGNYYPGPG--SVPKGLE  101



>ref|XP_006357474.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=716

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 61/107 (57%), Gaps = 10/107 (9%)
 Frame = +1

Query  490  MGCLCCKPS-AIEDSRE-SPRERLSCKASV---DLRVATGRREEAYRAKDPLECNDVKTM  654
            MG +C KPS  +++ R+   R   +  A+V    LR  + +REE++R KD LE  DVK  
Sbjct  1    MGGVCGKPSEPVQNRRDRQKRSEFTKGATVVSRPLRAVSTKREESFRVKDKLENGDVKLG  60

Query  655  LIEKQANGSVRLQNNGKSDRRSEKGEYIVTTTYHPHPGMATLPKATE  795
            L+++++NGS +++++   ++  EK   IV       PG   +PKA E
Sbjct  61   LVDRKSNGSRKVRDD-HYEQIKEKLGLIVNGC----PGNGVVPKALE  102



>ref|XP_006376478.1| hypothetical protein POPTR_0013s13360g [Populus trichocarpa]
 gb|ERP54275.1| hypothetical protein POPTR_0013s13360g [Populus trichocarpa]
Length=726

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLRVA---TGRREEAYRAKDPLECNDVKTMLI  660
            MGC+  K    E+S++S RERLS K S+D RV+   + R ++  R+KD     DVK ML 
Sbjct  1    MGCIASK----ENSQDSHRERLSRKGSLDRRVSHVNSLRTDDGVRSKDKRNSGDVKVMLT  56

Query  661  EKQANGSVRLQNNGKSDRRSE  723
            +K+  GS R   +    RR E
Sbjct  57   DKKTRGSRRYHGDQIEKRRVE  77



>emb|CDY25738.1| BnaC03g69370D [Brassica napus]
Length=659

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 16/93 (17%)
 Frame = +1

Query  490  MGCLCCKPSAIEDSRESPRERLSCKASVDLR----VATGRREEAYRAKDPLECNDVKTML  657
            MGC+ CKPSAIED   SP+ERLS K S ++R    V + RREE+ R K   E +DV +++
Sbjct  1    MGCVWCKPSAIED---SPKERLSIKPSSEIRVTRPVGSSRREESVRTK---ERSDVVSVV  54

Query  658  IEKQANGSVR---LQNNGKSD---RRSEKGEYI  738
                +N S R   L+N         ++ +GEY+
Sbjct  55   RPVLSNSSRREKKLENVATPHFPIAKAAEGEYV  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272