BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4458

Length=1279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                442   5e-151   Nicotiana sylvestris
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                442   9e-151   Solanum lycopersicum
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           440   4e-150   Nicotiana tomentosiformis
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           440   7e-150   Nicotiana sylvestris
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           439   1e-149   Solanum tuberosum [potatoes]
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                438   3e-149   Nicotiana tomentosiformis
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           436   2e-148   Nicotiana tomentosiformis
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           436   2e-148   
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           436   3e-148   Solanum tuberosum [potatoes]
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           434   1e-147   Nicotiana sylvestris
ref|NP_001274803.1|  uncharacterized protein LOC102577675               433   2e-147   Solanum tuberosum [potatoes]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                433   3e-147   Solanum lycopersicum
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                432   8e-147   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     431   2e-146   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                431   2e-146   Prunus mume [ume]
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           430   4e-146   Sesamum indicum [beniseed]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     429   2e-145   
gb|KJB71614.1|  hypothetical protein B456_011G133700                    428   2e-145   Gossypium raimondii
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                428   3e-145   Eucalyptus grandis [rose gum]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           428   3e-145   
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         427   4e-145   Pyrus x bretschneideri [bai li]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         427   5e-145   Prunus mume [ume]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           426   2e-144   Nelumbo nucifera [Indian lotus]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         426   3e-144   Pyrus x bretschneideri [bai li]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             424   7e-144   Prunus persica
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   424   8e-144   
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                424   8e-144   Fragaria vesca subsp. vesca
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         424   9e-144   Malus domestica [apple tree]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                424   2e-143   Pyrus x bretschneideri [bai li]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           423   3e-143   Fragaria vesca subsp. vesca
emb|CDP18434.1|  unnamed protein product                                424   3e-143   Coffea canephora [robusta coffee]
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     425   5e-143   Eucalyptus grandis [rose gum]
ref|XP_002524859.1|  ribosomal protein L5, putative                     422   5e-143   Ricinus communis
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  421   1e-142   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           421   1e-142   Citrus sinensis [apfelsine]
emb|CBI24704.3|  unnamed protein product                                422   1e-142   Vitis vinifera
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                421   2e-142   Erythranthe guttata [common monkey flower]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             420   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           421   3e-142   
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             420   3e-142   Citrus clementina [clementine]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           420   3e-142   
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             423   5e-142   
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         420   5e-142   Tarenaya hassleriana [spider flower]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   419   5e-142   
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                419   6e-142   Populus euphratica
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    419   6e-142   Elaeis guineensis
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                419   7e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           420   1e-141   Glycine max [soybeans]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                418   2e-141   
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           419   2e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           418   2e-141   Citrus sinensis [apfelsine]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   418   2e-141   Citrus sinensis [apfelsine]
emb|CDP17898.1|  unnamed protein product                                421   2e-141   Coffea canephora [robusta coffee]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           418   2e-141   Phoenix dactylifera
ref|XP_012075400.1|  PREDICTED: 60S ribosomal protein L5                418   3e-141   Jatropha curcas
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                417   3e-141   Malus domestica [apple tree]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    417   5e-141   Glycine max [soybeans]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             417   5e-141   Phaseolus vulgaris [French bean]
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                417   5e-141   Cucumis melo [Oriental melon]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    417   6e-141   
gb|ADR71225.1|  60S ribosomal protein L5A                               417   6e-141   Hevea brasiliensis [jebe]
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   417   7e-141   Phaseolus vulgaris [French bean]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           417   8e-141   Glycine max [soybeans]
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           416   1e-140   Cicer arietinum [garbanzo]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           416   1e-140   Tarenaya hassleriana [spider flower]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    416   1e-140   Gossypium raimondii
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             416   2e-140   Phaseolus vulgaris [French bean]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                416   2e-140   Vitis vinifera
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           416   2e-140   Populus euphratica
gb|ADR71226.1|  60S ribosomal protein L5B                               416   2e-140   Hevea brasiliensis [jebe]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           416   2e-140   Glycine max [soybeans]
gb|KHN36792.1|  60S ribosomal protein L5                                416   2e-140   Glycine soja [wild soybean]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           416   2e-140   Phoenix dactylifera
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           415   3e-140   Glycine max [soybeans]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     415   3e-140   Eucalyptus grandis [rose gum]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              415   3e-140   Tarenaya hassleriana [spider flower]
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           418   4e-140   
gb|ACU23594.1|  unknown                                                 414   1e-139   Glycine max [soybeans]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   416   1e-139   
gb|KJB84072.1|  hypothetical protein B456_N001600                       414   1e-139   Gossypium raimondii
gb|AHA84189.1|  60S ribosomal protein L5                                414   1e-139   Phaseolus vulgaris [French bean]
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         413   3e-139   Brachypodium distachyon [annual false brome]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             412   3e-139   Phaseolus vulgaris [French bean]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    413   4e-139   
gb|AFK36106.1|  unknown                                                 412   4e-139   Lotus japonicus
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                413   5e-139   Sesamum indicum [beniseed]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   412   6e-139   
ref|XP_002524558.1|  ribosomal protein L5, putative                     412   7e-139   Ricinus communis
gb|ACJ85054.1|  unknown                                                 412   8e-139   Medicago truncatula
gb|ABK95722.1|  unknown                                                 411   9e-139   Populus trichocarpa [western balsam poplar]
gb|ABK93596.1|  unknown                                                 411   1e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           411   1e-138   Sesamum indicum [beniseed]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             411   1e-138   Populus trichocarpa [western balsam poplar]
gb|AFK46994.1|  unknown                                                 411   2e-138   Lotus japonicus
ref|NP_001267659.1|  60S ribosomal protein L5                           410   2e-138   Cucumis sativus [cucumbers]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    410   3e-138   Phoenix dactylifera
gb|ABK93902.1|  unknown                                                 410   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           409   6e-138   Cicer arietinum [garbanzo]
gb|AFK41086.1|  unknown                                                 409   7e-138   Medicago truncatula
gb|AEV92989.1|  60S ribosomal protein L5                                409   9e-138   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         409   1e-137   Setaria italica
gb|AFK34395.1|  unknown                                                 409   1e-137   Lotus japonicus
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           408   2e-137   Populus euphratica
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    408   3e-137   
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              407   3e-137   Brachypodium distachyon [annual false brome]
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           407   4e-137   Cucumis melo [Oriental melon]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         407   5e-137   Brachypodium distachyon [annual false brome]
gb|KJB22668.1|  hypothetical protein B456_004G060400                    407   6e-137   Gossypium raimondii
dbj|BAJ89012.1|  predicted protein                                      407   7e-137   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012084278.1|  PREDICTED: 60S ribosomal protein L5                406   8e-137   Jatropha curcas
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           407   8e-137   Cucumis sativus [cucumbers]
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         407   8e-137   Tarenaya hassleriana [spider flower]
gb|KHN27258.1|  60S ribosomal protein L5                                406   9e-137   Glycine soja [wild soybean]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           406   1e-136   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              406   1e-136   Zea mays [maize]
gb|ACR38045.1|  unknown                                                 406   1e-136   Zea mays [maize]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    405   2e-136   Gossypium raimondii
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         405   4e-136   Zea mays [maize]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          404   5e-136   Sorghum bicolor [broomcorn]
gb|ACG36552.1|  60S ribosomal protein L5-1                              404   5e-136   Zea mays [maize]
gb|AFK39593.1|  unknown                                                 404   7e-136   Lotus japonicus
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         404   1e-135   Tarenaya hassleriana [spider flower]
gb|KHN15970.1|  60S ribosomal protein L5                                403   2e-135   Glycine soja [wild soybean]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           403   2e-135   Nelumbo nucifera [Indian lotus]
gb|KJB84073.1|  hypothetical protein B456_N001600                       402   3e-135   Gossypium raimondii
ref|NP_001151284.1|  60S ribosomal protein L5-1                         402   3e-135   Zea mays [maize]
ref|XP_010101365.1|  60S ribosomal protein L5                           402   8e-135   
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             401   1e-134   Eutrema salsugineum [saltwater cress]
gb|EMT04099.1|  60S ribosomal protein L5-2                              401   1e-134   
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               399   6e-134   Erythranthe guttata [common monkey flower]
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    398   2e-133   Oryza brachyantha
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    398   3e-133   
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         397   3e-133   Camelina sativa [gold-of-pleasure]
ref|NP_566767.1|  60S ribosomal protein L5-1                            397   3e-133   Arabidopsis thaliana [mouse-ear cress]
gb|AES74307.2|  60S ribosomal protein L5-2                              397   4e-133   Medicago truncatula
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             397   4e-133   Arabidopsis lyrata subsp. lyrata
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                397   5e-133   Nelumbo nucifera [Indian lotus]
ref|XP_003604056.1|  60S ribosomal protein L5                           398   6e-133   
ref|NP_001045083.1|  Os01g0896800                                       397   6e-133   
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                396   9e-133   Elaeis guineensis
dbj|BAD82173.1|  putative ribosomal protein L5                          396   9e-133   Oryza sativa Japonica Group [Japonica rice]
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        396   1e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              396   1e-132   
gb|KJB22669.1|  hypothetical protein B456_004G060400                    395   1e-132   Gossypium raimondii
ref|NP_198790.1|  60S ribosomal protein L5-2                            395   1e-132   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52294.1|  BnaA03g57870D                                          397   2e-132   Brassica napus [oilseed rape]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         395   3e-132   
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         395   3e-132   Oryza brachyantha
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    395   3e-132   Camelina sativa [gold-of-pleasure]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    395   4e-132   Arabis alpina [alpine rockcress]
gb|AAM64753.1|  ribosomal protein, putative                             394   5e-132   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    394   5e-132   Gossypium raimondii
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             395   6e-132   
ref|XP_011628715.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     393   1e-131   Amborella trichopoda
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         393   2e-131   Brassica rapa
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    393   2e-131   Brassica rapa
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             393   2e-131   Capsella rubella
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    392   3e-131   Arabis alpina [alpine rockcress]
emb|CDY15088.1|  BnaC03g44490D                                          393   4e-131   Brassica napus [oilseed rape]
emb|CDY27889.1|  BnaA07g04790D                                          392   5e-131   Brassica napus [oilseed rape]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             392   5e-131   
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         392   5e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         392   5e-131   Camelina sativa [gold-of-pleasure]
emb|CDY52293.1|  BnaA03g57860D                                          392   6e-131   Brassica napus [oilseed rape]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             392   6e-131   Capsella rubella
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            390   7e-131   
ref|XP_011628714.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     391   7e-131   Amborella trichopoda
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         391   1e-130   Brassica rapa
emb|CDY50258.1|  BnaC07g47930D                                          391   1e-130   Brassica napus [oilseed rape]
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         390   2e-130   Camelina sativa [gold-of-pleasure]
gb|EMT23062.1|  60S ribosomal protein L5-2                              390   2e-130   
emb|CDY15089.1|  BnaC03g44500D                                          390   3e-130   Brassica napus [oilseed rape]
gb|EMT20601.1|  60S ribosomal protein L5-2                              389   5e-130   
gb|EMS59984.1|  60S ribosomal protein L5-2                              389   5e-130   Triticum urartu
emb|CDX86312.1|  BnaA06g30290D                                          389   6e-130   
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           390   7e-130   Elaeis guineensis
ref|XP_002876523.1|  predicted protein                                  389   9e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    387   4e-129   
gb|KJB71615.1|  hypothetical protein B456_011G133700                    384   2e-128   Gossypium raimondii
emb|CDX85331.1|  BnaC07g26420D                                          389   2e-128   
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             385   3e-128   Eutrema salsugineum [saltwater cress]
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      385   3e-128   Oryza sativa Japonica Group [Japonica rice]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        385   3e-128   
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   383   5e-128   Citrus sinensis [apfelsine]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             382   1e-127   
gb|ABK21084.1|  unknown                                                 383   2e-127   Picea sitchensis
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             382   2e-127   Capsella rubella
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  379   1e-126   Citrus sinensis [apfelsine]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     374   5e-124   Eucalyptus grandis [rose gum]
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   365   9e-121   Phaseolus vulgaris [French bean]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          365   9e-121   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         362   8e-120   Camelina sativa [gold-of-pleasure]
ref|XP_001759628.1|  predicted protein                                  362   1e-119   
ref|XP_001783620.1|  predicted protein                                  360   1e-118   
ref|XP_001767871.1|  predicted protein                                  360   1e-118   
ref|XP_001783411.1|  predicted protein                                  359   2e-118   
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    356   2e-117   
gb|EPS61271.1|  hypothetical protein M569_13526                         351   7e-116   Genlisea aurea
dbj|BAB33422.1|  putative senescence-associated protein                 349   9e-115   Pisum sativum [garden pea]
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             344   2e-112   Selaginella moellendorffii
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             342   1e-111   Selaginella moellendorffii
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           337   4e-110   
gb|KJB84074.1|  hypothetical protein B456_N001600                       337   4e-110   Gossypium raimondii
gb|EMS47485.1|  60S ribosomal protein L5-1                              317   2e-102   Triticum urartu
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             315   3e-101   
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             311   7e-101   
gb|KJB10809.1|  hypothetical protein B456_001G226000                    311   1e-100   Gossypium raimondii
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   310   4e-100   Citrus sinensis [apfelsine]
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    308   1e-99    
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              308   1e-99    
gb|KJB22671.1|  hypothetical protein B456_004G060400                    303   1e-97    Gossypium raimondii
gb|KJB22672.1|  hypothetical protein B456_004G060400                    303   1e-97    Gossypium raimondii
gb|EPS64989.1|  hypothetical protein M569_09790                         302   2e-97    Genlisea aurea
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              302   5e-96    Chlorella variabilis
ref|XP_011399144.1|  60S ribosomal protein L5-1                         297   3e-94    Auxenochlorella protothecoides
gb|KDD76608.1|  ribosomal L18p/L5e                                      291   1e-91    Helicosporidium sp. ATCC 50920
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    278   1e-87    
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           279   4e-87    Suberites domuncula
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   273   5e-85    Coptotermes formosanus
ref|XP_005643753.1|  60S ribosomal protein L5                           273   6e-85    Coccomyxa subellipsoidea C-169
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 272   2e-84    Ixodes scapularis [blacklegged tick]
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             272   3e-84    Emiliania huxleyi CCMP1516
ref|XP_001634531.1|  predicted protein                                  271   4e-84    Nematostella vectensis
emb|CDS19989.1|  ribosomal protein l5                                   271   5e-84    Echinococcus granulosus
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           270   9e-84    Ceratitis capitata [medfly]
emb|CDI98331.1|  ribosomal protein l5                                   270   1e-83    Echinococcus multilocularis
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  270   1e-83    Daphnia pulex
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           269   3e-83    Aplysia californica
gb|EPZ34992.1|  60S ribosomal protein L5                                269   3e-83    Rozella allomycis CSF55
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           269   3e-83    Caenorhabditis briggsae
ref|XP_002109848.1|  expressed hypothetical protein                     269   4e-83    Trichoplax adhaerens
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       269   4e-83    Necator americanus
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                269   5e-83    Bactrocera dorsalis [papaya fruit fly]
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      269   5e-83    Caenorhabditis briggsae
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                269   5e-83    Zeugodacus cucurbitae [melon fruit fly]
gb|ADQ73874.1|  60S ribosomal protein L5                                268   5e-83    Laodelphax striatella
gb|ACZ13335.1|  60S ribosomal protein L5                                268   1e-82    Bursaphelenchus xylophilus [pine wilt nematode]
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     268   1e-82    Ancylostoma ceylanicum
gb|KJH44233.1|  ribosomal L18p/L5e family protein                       268   1e-82    Dictyocaulus viviparus
ref|NP_495811.1|  Protein RPL-5                                         268   1e-82    Caenorhabditis elegans [roundworm]
gb|KDO24705.1|  hypothetical protein SPRG_10239                         268   1e-82    Saprolegnia parasitica CBS 223.65
ref|XP_003856228.1|  60S ribosomal protein L5                           267   2e-82    Zymoseptoria tritici IPO323
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      267   2e-82    Caenorhabditis brenneri
gb|KDR11979.1|  60S ribosomal protein L5                                267   3e-82    Zootermopsis nevadensis
dbj|BAN20290.1|  ribosomal protein L5                                   267   3e-82    Riptortus pedestris
emb|CCQ18634.1|  60S ribosomal protein L5                               266   3e-82    Sycon ciliatum
gb|KGG50093.1|  60S ribosomal protein L5-2                              268   3e-82    Mitosporidium daphniae
gb|KJB84075.1|  hypothetical protein B456_N001600                       263   3e-82    Gossypium raimondii
ref|XP_001639289.1|  predicted protein                                  266   3e-82    Nematostella vectensis
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        266   4e-82    Microcosmus squamiger
ref|XP_002675028.1|  predicted protein                                  266   6e-82    Naegleria gruberi strain NEG-M
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           266   7e-82    Helianthus annuus
gb|EPB80490.1|  ribosomal L18p/L5e family protein                       265   2e-81    Ancylostoma ceylanicum
ref|XP_008605837.1|  50S ribosomal protein L5e                          264   2e-81    Saprolegnia diclina VS20
gb|ABO26701.1|  ribosomal protein l5                                    263   3e-81    Haliotis discus discus
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           264   3e-81    Crassostrea gigas
ref|NP_001104213.1|  uncharacterized protein LOC100126642               264   3e-81    Xenopus laevis [clawed frog]
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           264   4e-81    Lysiphlebus testaceipes
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                263   5e-81    Tribolium castaneum [rust-red flour beetle]
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    263   6e-81    Drosophila melanogaster
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           263   7e-81    Saccoglossus kowalevskii
gb|EUB56475.1|  60S ribosomal protein L5                                263   7e-81    Echinococcus granulosus
gb|EME50014.1|  hypothetical protein DOTSEDRAFT_31141                   263   7e-81    Dothistroma septosporum NZE10
ref|NP_001187210.1|  ribosomal protein L5b                              263   8e-81    Ictalurus punctatus
ref|XP_004337717.1|  ribosomal L18p/L5e family                          263   8e-81    Acanthamoeba castellanii str. Neff
gb|ACB37346.1|  Ts5 protein                                             262   9e-81    Taenia solium [pig tapeworm]
gb|KFM66007.1|  60S ribosomal protein L5-A                              261   1e-80    Stegodyphus mimosarum
gb|ADV40159.1|  putative 60S ribosomal protein L5                       261   2e-80    Latrodectus hesperus [black widow]
gb|KKA70810.1|  ribosomal protein                                       262   2e-80    
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                262   2e-80    Ciona intestinalis [sea vase]
ref|XP_002066772.1|  GK24660                                            261   3e-80    Drosophila willistoni
ref|XP_002023101.1|  GL21177                                            261   3e-80    Drosophila persimilis
gb|EMF17397.1|  60S ribosomal protein L5                                261   5e-80    Sphaerulina musiva SO2202
ref|XP_005188116.1|  PREDICTED: 60S ribosomal protein L5                261   5e-80    Musca domestica
ref|XP_004349238.1|  ribosomal protein L5                               261   5e-80    Capsaspora owczarzaki ATCC 30864
ref|XP_001973913.1|  GG21448                                            261   7e-80    
gb|AAN73355.1|  ribosomal protein L5                                    259   8e-80    Branchiostoma lanceolatum [common lancelet]
ref|XP_003117386.1|  CRE-RPL-5 protein                                  260   8e-80    Caenorhabditis remanei
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     260   9e-80    Haemonchus contortus [red stomach worm]
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              260   9e-80    
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           260   1e-79    
gb|EHJ70750.1|  ribosomal protein L5                                    260   1e-79    
ref|NP_001037008.1|  60S ribosomal protein L5                           260   1e-79    
ref|XP_002044351.1|  GM26730                                            261   1e-79    
gb|EFN62403.1|  60S ribosomal protein L5                                261   1e-79    
emb|CAD91421.1|  ribosomal protein L5                                   258   1e-79    
ref|XP_003743796.1|  PREDICTED: 60S ribosomal protein L5-like           259   2e-79    
gb|AAV34814.1|  ribosomal protein L5                                    259   2e-79    
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5                259   2e-79    
ref|XP_001648896.1|  AAEL004325-PA                                      259   2e-79    
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   259   2e-79    
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           259   3e-79    
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5           258   4e-79    
ref|XP_008474018.1|  PREDICTED: 60S ribosomal protein L5                259   4e-79    
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     258   5e-79    
gb|AFM89421.1|  ribosomal protein L5                                    258   6e-79    
ref|XP_005706768.1|  60S ribosomal protein L5e                          258   6e-79    
ref|XP_003283302.1|  60S ribosomal protein L5                           258   8e-79    
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           259   8e-79    
emb|CEF66000.1|  60S ribosomal protein L5                               258   9e-79    
ref|NP_983506.1|  60S ribosomal protein L5                              258   9e-79    
ref|XP_001966910.1|  GF22760                                            258   9e-79    
ref|XP_011635705.1|  PREDICTED: 60S ribosomal protein L5                257   1e-78    
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   257   1e-78    
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                257   1e-78    
gb|AGO11355.1|  AaceriACR104Cp                                          257   1e-78    
emb|CAX78293.1|  putative ribosomal protein L5                          257   2e-78    
emb|CAX78299.1|  putative ribosomal protein L5                          257   2e-78    
gb|ACK44339.1|  ribosomal protein L5                                    255   2e-78    
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           257   2e-78    
ref|XP_009020629.1|  hypothetical protein HELRODRAFT_185715             257   2e-78    
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                258   2e-78    
gb|AAP06189.1|  similar to GenBank Accession Number L78668 60S ri...    257   2e-78    
emb|CAX78280.1|  putative ribosomal protein L5                          256   2e-78    
ref|NP_001079437.1|  60S ribosomal protein L5-B                         256   2e-78    
ref|XP_009830190.1|  hypothetical protein H257_06606                    257   2e-78    
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                256   3e-78    
gb|AFM85809.1|  ribosomal protein L5                                    256   3e-78    
gb|AFM88396.1|  ribosomal protein L5                                    256   3e-78    
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           256   3e-78    
gb|AFM88337.1|  ribosomal protein L5                                    256   3e-78    
ref|XP_004206528.1|  PREDICTED: 60S ribosomal protein L5-like           256   3e-78    
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                   256   3e-78    
ref|XP_007235270.1|  PREDICTED: 60S ribosomal protein L5-like           256   3e-78    
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5                256   3e-78    
ref|XP_008861011.1|  hypothetical protein H310_00139                    256   3e-78    
ref|XP_001951987.1|  PREDICTED: 60S ribosomal protein L5                256   3e-78    
ref|XP_009492195.1|  50S ribosomal protein L5e                          256   4e-78    
gb|KFY37418.1|  hypothetical protein V494_04756                         256   4e-78    
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                256   4e-78    
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        256   4e-78    
gb|AFM88682.1|  ribosomal protein L5                                    256   5e-78    
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          256   6e-78    
gb|KFY83677.1|  hypothetical protein V500_10007                         256   6e-78    
gb|EJK70557.1|  hypothetical protein THAOC_08069                        256   6e-78    
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           255   6e-78    
ref|NP_001079377.1|  60S ribosomal protein L5-A                         255   7e-78    
gb|ADO29334.1|  60S ribosomal protein l5                                255   7e-78    
gb|KFY58522.1|  hypothetical protein V496_06088                         255   7e-78    
emb|CAX78288.1|  putative ribosomal protein L5                          255   7e-78    
ref|XP_009046069.1|  hypothetical protein LOTGIDRAFT_224562             255   7e-78    
sp|Q5XUC7.1|RL5_TOXCI  RecName: Full=60S ribosomal protein L5           255   8e-78    
gb|AER35073.1|  60S ribosomal protein L5                                255   8e-78    
dbj|BAM19090.1|  ribosomal protein L5                                   255   9e-78    
gb|ADO28300.1|  60S ribosomal protein l5                                255   9e-78    
gb|AFM89559.1|  ribosomal protein L5                                    255   1e-77    
gb|ACY95338.1|  ribosomal protein L5                                    255   1e-77    
ref|XP_001854652.1|  60S ribosomal protein L5                           254   1e-77    
gb|AER57859.1|  60S ribosomal protein L5                                255   1e-77    
ref|XP_001547892.1|  60S ribosomal protein L5                           254   1e-77    
gb|AFM90058.1|  ribosomal protein L5                                    254   1e-77    
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     254   1e-77    
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                254   1e-77    
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           254   1e-77    
ref|NP_001279040.1|  ribosomal protein L5                               254   1e-77    
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    255   1e-77    
gb|EKC36296.1|  60S ribosomal protein L5                                261   1e-77    
ref|NP_001187035.1|  ribosomal protein L5a                              254   1e-77    
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5                254   1e-77    
gb|AFM87418.1|  60S ribosomal protein L5-B                              254   1e-77    
ref|XP_002588187.1|  hypothetical protein BRAFLDRAFT_113823             255   2e-77    
gb|AFM87698.1|  60S ribosomal protein L5-A                              254   2e-77    
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                255   2e-77    
gb|KFZ19673.1|  hypothetical protein V501_00580                         254   2e-77    
ref|XP_005536050.1|  60S ribosomal protein L5                           254   2e-77    
gb|ETP30123.1|  hypothetical protein F442_20806                         254   2e-77    
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                257   2e-77    
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               254   2e-77    
dbj|BAH20263.1|  AT3G25520                                              251   2e-77    
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                254   2e-77    
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       254   2e-77    
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           254   2e-77    
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5                254   2e-77    
emb|CAJ17229.1|  ribosomal protein L5e                                  254   2e-77    
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    254   2e-77    
ref|XP_005717676.1|  unnamed protein product                            254   2e-77    
emb|CCE29368.1|  probable 60S ribosomal protein L5                      254   2e-77    
gb|KFY79291.1|  hypothetical protein V499_01707                         255   3e-77    
gb|EKG20809.1|  Ribosomal protein L18/L5                                254   3e-77    
ref|NP_001189970.1|  60S ribosomal protein L5-1                         250   3e-77    
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                255   3e-77    
emb|CBX33183.1|  ribosomal protein L5                                   254   3e-77    
dbj|BAM17686.1|  ribosomal protein L5                                   253   3e-77    
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    253   3e-77    
gb|KFY16774.1|  hypothetical protein V492_01113                         253   3e-77    
ref|XP_007674186.1|  hypothetical protein BAUCODRAFT_146209             254   3e-77    
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        253   3e-77    
gb|ABU41033.1|  60S ribosomal protein L5                                253   3e-77    
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    253   4e-77    
gb|KFX88354.1|  hypothetical protein V490_07682                         253   4e-77    
gb|EPY76441.1|  60S ribosomal protein L5                                254   4e-77    
gb|ACO09827.1|  60S ribosomal protein L5                                253   4e-77    
gb|ETI32113.1|  hypothetical protein F443_20998                         253   4e-77    
ref|NP_956050.1|  ribosomal protein L5                                  253   4e-77    
gb|ETL25956.1|  hypothetical protein L916_20260                         253   4e-77    
ref|XP_008911988.1|  hypothetical protein PPTG_15526                    253   4e-77    
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             253   5e-77    
gb|ETO60855.1|  hypothetical protein F444_21002                         253   5e-77    
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                       254   5e-77    
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                254   5e-77    
gb|ADT80695.1|  ribosomal protein L5                                    253   5e-77    
gb|ETK72498.1|  hypothetical protein L915_20400                         253   5e-77    
gb|AFM86790.1|  60S ribosomal protein L5-A                              253   5e-77    
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                253   5e-77    
gb|AFK41626.1|  unknown                                                 250   5e-77    
gb|KJK77075.1|  60S ribosomal protein L5                                254   5e-77    
ref|XP_001912102.1|  hypothetical protein                               253   6e-77    
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           253   6e-77    
gb|EHL03541.1|  putative 60S ribosomal protein L5                       253   6e-77    
ref|XP_007568808.1|  PREDICTED: 60S ribosomal protein L5-like           253   6e-77    
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           253   6e-77    
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           253   6e-77    
gb|ELU16579.1|  hypothetical protein CAPTEDRAFT_164118                  253   6e-77    
gb|AFM86481.1|  ribosomal protein L5                                    253   6e-77    
gb|AAI09371.1|  Ribosomal protein L5                                    253   7e-77    
ref|XP_003437833.1|  PREDICTED: 60S ribosomal protein L5-like           253   7e-77    
gb|AFM86403.1|  60S ribosomal protein L5-A                              253   7e-77    
ref|XP_008277284.1|  PREDICTED: 60S ribosomal protein L5-like           253   7e-77    
ref|XP_002002621.1|  GI17484                                            265   7e-77    
ref|XP_003693438.1|  PREDICTED: 60S ribosomal protein L5-like           253   8e-77    
ref|XP_011691544.1|  PREDICTED: 60S ribosomal protein L5                253   8e-77    
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               253   8e-77    
gb|EFZ13276.1|  hypothetical protein SINV_12586                         253   8e-77    
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                   253   8e-77    
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           252   8e-77    
ref|XP_960578.1|  60s ribosomal protein l5                              253   9e-77    
ref|NP_001002106.1|  ribosomal protein L5                               252   9e-77    
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                254   9e-77    
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                252   9e-77    
gb|AEL28875.1|  ribosomal protein L5                                    252   9e-77    
ref|NP_988881.1|  ribosomal protein L5                                  252   9e-77    
emb|CAF96378.1|  unnamed protein product                                253   9e-77    
ref|XP_006786853.1|  PREDICTED: 60S ribosomal protein L5-like           252   1e-76    
ref|XP_001612181.1|  ribosomal L18p/L5e family protein                  253   1e-76    
ref|NP_989912.1|  60S ribosomal protein L5                              252   1e-76    
gb|AFM89515.1|  ribosomal protein L5                                    252   1e-76    
gb|KFY22525.1|  hypothetical protein V493_06526                         252   1e-76    
gb|KFD48731.1|  hypothetical protein M513_10361                         254   1e-76    
ref|XP_011867023.1|  PREDICTED: 60S ribosomal protein L5                252   1e-76    
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                252   1e-76    
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     252   1e-76    
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                252   1e-76    
ref|XP_010731643.1|  PREDICTED: 60S ribosomal protein L5-like           252   1e-76    
gb|EHH14955.1|  hypothetical protein EGK_00972                          252   1e-76    
ref|NP_001279541.1|  60S ribosomal protein L5-like                      252   1e-76    
gb|KEF55260.1|  60S ribosomal protein L5                                252   1e-76    
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     252   2e-76    
ref|NP_000960.2|  60S ribosomal protein L5                              252   2e-76    
dbj|BAD96324.1|  ribosomal protein L5 variant                           252   2e-76    
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     252   2e-76    
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                252   2e-76    
gb|EHK26573.1|  hypothetical protein TRIVIDRAFT_77851                   252   2e-76    
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|XP_001588768.1|  60S ribosomal protein L5                           251   2e-76    
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|NP_001182608.1|  60S ribosomal protein L5                           251   2e-76    
gb|KFY01844.1|  hypothetical protein O988_02499                         251   2e-76    
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     251   2e-76    
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                253   2e-76    
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
gb|KJK92729.1|  60S ribosomal protein L5                                251   2e-76    
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                251   2e-76    
ref|XP_010772541.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-76    
ref|XP_007290078.1|  60S ribosomal protein L5                           252   2e-76    
ref|XP_001837210.1|  60S ribosomal protein L5                           251   2e-76    
ref|XP_011147768.1|  PREDICTED: 60S ribosomal protein L5-like           251   3e-76    
dbj|GAA95426.1|  hypothetical protein E5Q_02080                         251   3e-76    
gb|KHJ35883.1|  putative 60s ribosomal protein l5                       251   3e-76    
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575             251   3e-76    
gb|AFM74205.1|  ribosomal protein L5                                    251   3e-76    
ref|XP_011746024.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    251   3e-76    
emb|CAG05644.1|  unnamed protein product                                251   3e-76    
ref|NP_001107756.1|  60S ribosomal protein L5                           251   3e-76    
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     251   3e-76    
ref|XP_012064562.1|  PREDICTED: 60S ribosomal protein L5                251   3e-76    
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5                253   3e-76    
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     251   3e-76    
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     251   3e-76    
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           251   3e-76    
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    251   3e-76    
dbj|BAE31169.1|  unnamed protein product                                251   3e-76    
ref|XP_008332274.1|  PREDICTED: 60S ribosomal protein L5                251   3e-76    
ref|XP_003975748.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     251   3e-76    
dbj|BAF98650.1|  ribosomal protein L5                                   251   3e-76    
ref|XP_005721069.1|  PREDICTED: 60S ribosomal protein L5-like           251   3e-76    
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                251   3e-76    
gb|ACN25149.1|  ribosomal-like protein                                  250   4e-76    
ref|XP_002176750.1|  predicted protein                                  251   4e-76    
gb|ACI69521.1|  60S ribosomal protein L5                                251   4e-76    
gb|AAN05603.1|  ribosomal protein L5                                    250   4e-76    
ref|XP_004570613.1|  PREDICTED: 60S ribosomal protein L5-like           251   4e-76    
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               251   4e-76    
emb|CDQ69914.1|  unnamed protein product                                251   4e-76    
ref|XP_007813241.1|  60S ribosomal protein L5                           251   4e-76    
ref|XP_004078696.1|  PREDICTED: 60S ribosomal protein L5-like           251   4e-76    
gb|EFN77280.1|  60S ribosomal protein L5                                252   4e-76    
ref|XP_007554751.1|  PREDICTED: 60S ribosomal protein L5                252   4e-76    



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   442 bits (1138),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 261/293 (89%), Positives = 281/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EA GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLEANGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHR YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+EAD +E +YK
Sbjct  181  GFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADGLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKS+KQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPTFKKSDKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   442 bits (1137),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 264/293 (90%), Positives = 280/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+E  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG EAD +E +YK
Sbjct  181  GFSKDSKQLDADVHRKYIYGGHVATYMQTLIEDEPEKYQTHFSQYIKKGFEADGLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   440 bits (1132),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 260/293 (89%), Positives = 283/293 (97%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNTEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EAD++E +YK
Sbjct  181  GFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   440 bits (1131),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 261/293 (89%), Positives = 283/293 (97%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EAD++E +YK
Sbjct  181  GFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   439 bits (1129),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 261/293 (89%), Positives = 280/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ+VSASIAGDMILASAYANELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+E  GEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG+EAD +E +YK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYQTHFSEYIKKGLEADGLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP PKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPCPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 258/293 (88%), Positives = 279/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+E  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNLEVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHR YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+EAD++E +YK
Sbjct  181  GFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADHLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKS+K PPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRADPTFKKSDKHPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   436 bits (1122),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 258/293 (88%), Positives = 279/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELP YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN++  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KDSK LDA+VHRKYIYGGHV+AYM +L EDEPEKYQ+HFS YIK G+EAD++E +YK
Sbjct  181  GFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFSEYIKTGLEADDLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS KKS+KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAAGN
Sbjct  241  KVHAAIRADPSSKKSDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   436 bits (1121),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 258/293 (88%), Positives = 279/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G++KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIK G+EADN+E +YK
Sbjct  181  GYSKDSKQLDAEVHRKYIYGGHVAAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPSPKKS KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  241  KVHAAIRADPSPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   436 bits (1120),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 259/293 (88%), Positives = 282/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EADN+E +YK
Sbjct  181  GFSKDSKQLDADVHRKYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKRGLEADNLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRA+PSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   434 bits (1116),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 256/293 (87%), Positives = 278/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN++  GEDYSVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KDSK LDA+VHRKYIYGGHV+AYM +L EDEPEKYQ+HF+ YIK G+EAD++E +YK
Sbjct  181  GFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFNEYIKTGLEADDLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS KK +KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAAGN
Sbjct  241  KVHAAIRADPSSKKFDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   433 bits (1114),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 255/293 (87%), Positives = 278/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFA
Sbjct  121  GNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G++KDSK LDAEVHRK+IYGGHV AYMN+L EDEPEKYQTHFS YIK G+EADN+E +YK
Sbjct  181  GYSKDSKQLDAEVHRKFIYGGHVTAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP PKKS KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  241  KVHAAIRADPCPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   433 bits (1113),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 259/293 (88%), Positives = 281/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EA+GEDYSVE  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFA
Sbjct  121  GNPEASGEDYSVELAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVA YM +L EDEPEKY +HFSGYIK+G+EADN+E +YK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYLSHFSGYIKRGLEADNLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRA+PSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  241  KVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   432 bits (1111),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 249/292 (85%), Positives = 273/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK+RAYFKR+QVKF+RRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L KLEMDQEYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAE HRKYIYGGHV+ YM +L EDEPEKYQTHFS Y+K+GI+AD +EALYK
Sbjct  181  GFSKDGKQLDAEAHRKYIYGGHVSGYMKTLMEDEPEKYQTHFSEYVKRGIDADGLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ K+SEK+ PK HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  241  KVHAAIRADPTAKQSEKEAPKTHKRYNLKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 273/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAE HRKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD +EALYK
Sbjct  181  GFSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS KKSEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  241  KVHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   431 bits (1108),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 256/291 (88%), Positives = 276/291 (95%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEADNIEA+YK
Sbjct  181  GFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KK EKQPPKEHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  241  KVHAAIRADPTAKKIEKQPPKEHKRYNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   430 bits (1106),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 254/293 (87%), Positives = 281/293 (96%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ+ SASIAGD +LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KL+MD+EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD+K LDAEVHRKYIYGGHV+AYMN+L EDEPEKYQ+HFS YIKK IE DNIEA+YK
Sbjct  181  GFSKDNKQLDAEVHRKYIYGGHVSAYMNTLMEDEPEKYQSHFSEYIKKSIEPDNIEAMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIERLNALNAAAGN
Sbjct  241  KVHAAIRADPTEKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
            AF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+ 
Sbjct  4    AFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDVT  63

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YEG
Sbjct  64   AQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYEG  123

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  NVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  183

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F+KD K LDAE HRKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD +EALYKK
Sbjct  184  FSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKK  243

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS KKSEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  244  VHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  294



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   428 bits (1101),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 246/293 (84%), Positives = 277/293 (95%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEADNIE+LYK
Sbjct  181  GFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KK+EK+PPK+HKRFN KKLTY+ER+AKLIERL+ LNAAAG+
Sbjct  241  KVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKAKLIERLHTLNAAAGD  293



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 247/292 (85%), Positives = 271/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D+ EALYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKS+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  241  KVHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  292



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   428 bits (1100),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 255/287 (89%), Positives = 272/287 (95%), Gaps = 0/287 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIEADNIE LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
            KVHAAIRADP+ KK+EKQPPKEHKR+N KKLT+DER+ KL+ERL A 
Sbjct  241  KVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   427 bits (1099),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 255/287 (89%), Positives = 272/287 (95%), Gaps = 0/287 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIEADNIE LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
            KVHAAIRADP+PKK+EKQPP EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  241  KVHAAIRADPTPKKTEKQPPTEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 249/293 (85%), Positives = 274/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD+K LD++VHRKYIYGGHVAAYM  L+EDEPEK+QTHFSGYIKKG+EA+ IE +YK
Sbjct  181  GFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSGYIKKGVEAEGIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ K +EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AAG+
Sbjct  241  KVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 277/292 (95%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LD EVHRKYIYGGHVA+YM +LNEDEPEKYQ+HFS YI KGI+ADNIE LY+
Sbjct  181  GFKKEEKQLDPEVHRKYIYGGHVASYMRALNEDEPEKYQSHFSEYINKGIDADNIEELYR  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ERR+KLIERLNALN+AAG
Sbjct  241  KVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   426 bits (1094),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 251/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYM +L +DEPEKYQ+HFS YIKKGIEADNIE LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKYQSHFSEYIKKGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N A 
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   424 bits (1091),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 247/293 (84%), Positives = 273/293 (93%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD+K LD++VHRKYIYGGHVAAYM  L+EDEPEK+QTHFS YIKKG+EA+ IE +YK
Sbjct  181  GFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSAYIKKGVEAEGIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ K +EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AAG+
Sbjct  241  KVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   424 bits (1090),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 252/292 (86%), Positives = 277/292 (95%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKY+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD++EALYK
Sbjct  181  GFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEK+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AAG
Sbjct  241  KVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  292



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   424 bits (1090),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LASAYA+ELP YGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVH KYIYGGHVAAYM +L EDEPEKYQTHFS Y+KKGIEADNIE +YK
Sbjct  181  GFSKDSKQLDAEVHHKYIYGGHVAAYMRTLMEDEPEKYQTHFSEYLKKGIEADNIEEVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKS K  P EHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  241  KVHAAIRADPTMKKSSKPQPSEHKRWNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   424 bits (1091),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYM +L +DEPEK+Q+HFS YIKKGIEADNIE LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKFQSHFSEYIKKGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N A 
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   424 bits (1089),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 250/287 (87%), Positives = 269/287 (94%), Gaps = 0/287 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEADNIE LYK
Sbjct  181  GFSKDSKQLDPEVHRKYIYGGHVAAYMRNLAEDEPEKYQSHFSEYIKKGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   423 bits (1087),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIK  K RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+YCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFA
Sbjct  121  GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK+LDAE HRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEA+ IE LYK
Sbjct  181  GFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP  KK+ K  PK+HKRFN KKLTY+ER+ KLIERLNA N+AA
Sbjct  241  KVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAA  291



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   424 bits (1090),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 250/287 (87%), Positives = 274/287 (95%), Gaps = 0/287 (0%)
 Frame = +3

Query  126  QKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  305
            QKT+AYFKR+QV+FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS
Sbjct  37   QKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  96

Query  306  ASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEAT  485
            ASIAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR+L++L+MD+EYEGNVEAT
Sbjct  97   ASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEAT  156

Query  486  GEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDS  665
            GEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF K+S
Sbjct  157  GEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFDKES  216

Query  666  KNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAI  845
            K LD EVHRKYIYGGHVAAYM +L EDEPE+YQ+HFS YIK+G+EADNIE LYKKVHAAI
Sbjct  217  KQLDPEVHRKYIYGGHVAAYMRTLIEDEPERYQSHFSEYIKRGLEADNIEELYKKVHAAI  276

Query  846  RADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            RAD S KKSEK+PPKEHKR+N KKLTY+ERRAKLIERLNALN+AAGN
Sbjct  277  RADSSAKKSEKEPPKEHKRYNLKKLTYEERRAKLIERLNALNSAAGN  323



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   425 bits (1092),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  66   VFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  125

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYEG
Sbjct  126  AQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYEG  185

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  186  NVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  245

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F+KDSK LDAEVHRKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D+ EALYKK
Sbjct  246  FSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKK  305

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+ KKS+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  306  VHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  356



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   422 bits (1085),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 251/289 (87%), Positives = 275/289 (95%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGL+VGLTNYAAAYCTGLLLARR L+ LEMD+EY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LD+EVHRKYIYGGHVAAYMN+L EDEPEKYQ+HFS YIK G+EAD+IEALYK
Sbjct  181  GFSKDGKQLDSEVHRKYIYGGHVAAYMNTLMEDEPEKYQSHFSKYIKSGVEADDIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADPSPKKSEKQPPKEHKR+N KKLTY+ER+AKLIERL ALN+
Sbjct  241  KVHAAIRADPSPKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLQALNS  289



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 274/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYK
Sbjct  181  GFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  241  KVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 274/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYK
Sbjct  181  GFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  241  KVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 278/306 (91%), Gaps = 0/306 (0%)
 Frame = +3

Query  57   LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  236
            + P  + L G  S  + M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  16   ICPLLSLLEGRGSRASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  75

Query  237  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  416
            YNTPKYRFVVRFTNKDI+AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGL
Sbjct  76   YNTPKYRFVVRFTNKDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGL  135

Query  417  llarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalk  596
            LLARR+L+ LEMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALK
Sbjct  136  LLARRVLKMLEMDGEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALK  195

Query  597  galdggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFS  776
            GALDGGLDIPHS+KRFAGF+KDSK LDAEVHRKYIYGGHV+AYM +L EDEPEKYQ+HFS
Sbjct  196  GALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFS  255

Query  777  GYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
             YIKKG+E D+IE +YKKVHAAIRA+P  KK EKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  256  EYIKKGVEPDDIEEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIER  315

Query  957  LNALNA  974
            LNALN+
Sbjct  316  LNALNS  321



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   421 bits (1083),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 244/293 (83%), Positives = 276/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QIVSA+I GD +LA+AYA+ELP +GLEVGL+NYAAAYCTGLLL+RR+L+ LEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ KD+K LD EVHRKYIYGGHVA+YMN+L EDEP+KYQ+HFS Y+KKG+EADNIE +YK
Sbjct  181  GYNKDNKQLDPEVHRKYIYGGHVASYMNTLMEDEPDKYQSHFSKYVKKGVEADNIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+PKKS+KQ PK+HKR+N KKLTY+ER+AKLIERLNALNAAAGN
Sbjct  241  KVHAAIRADPTPKKSDKQQPKQHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   420 bits (1080),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 249/293 (85%), Positives = 275/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYK
Sbjct  181  GFAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKL+ERLNALN+AA +
Sbjct  241  KVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSAADD  293



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   421 bits (1081),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 252/293 (86%), Positives = 270/293 (92%), Gaps = 1/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IEADNIE LYK
Sbjct  181  GFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKXIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N  AGN
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   420 bits (1080),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 247/290 (85%), Positives = 272/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  241  KVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   420 bits (1080),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 252/293 (86%), Positives = 270/293 (92%), Gaps = 1/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IEADNIE LYK
Sbjct  181  GFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKCIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N  AGN
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   423 bits (1087),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 247/296 (83%), Positives = 276/296 (93%), Gaps = 0/296 (0%)
 Frame = +3

Query  90   SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  269
            +S    MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  82   NSKVRAMAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR  141

Query  270  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  449
            FTNKDI+AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  142  FTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLE  201

Query  450  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPH  629
            MD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPH
Sbjct  202  MDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPH  261

Query  630  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  809
            S+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD 
Sbjct  262  SDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADG  321

Query  810  IEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  322  LEALYKKVHAAIRADPTTKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  377



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   420 bits (1079),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 249/292 (85%), Positives = 274/292 (94%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LASAY +ELPRYGLEVGLT+YAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+SK LD EVHRKYIYGGH+A YM  LNEDEPEKYQ+HFS YIK+GIEADN+EALYK
Sbjct  181  GFNKESKQLDPEVHRKYIYGGHIADYMRLLNEDEPEKYQSHFSEYIKRGIEADNMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS KKSEKQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  241  KVHAAIRADPSVKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   419 bits (1078),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 252/293 (86%), Positives = 277/293 (95%), Gaps = 1/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAA-YCTGlllarrllqklEMDQEY  464
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNYAAA YCTGLLLARR+L+KLEMD EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  465  EGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            EGNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
            AGF+KDSK LDAEVHRKY+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD++EALY
Sbjct  181  AGFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KKVHAAIRADP+ KKSEK+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AAG
Sbjct  241  KKVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  293



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   419 bits (1078),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 248/291 (85%), Positives = 273/291 (94%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYK
Sbjct  181  GYAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKSEKQP KEHKR+N KKLTY+ER+AKL+ERLNALN+AA
Sbjct  241  KVHAAIRADPTAKKSEKQPSKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   419 bits (1078),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 241/293 (82%), Positives = 269/293 (92%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHR YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D++E +YK
Sbjct  181  GFKKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP   KS K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  241  KVHAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  293



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   419 bits (1078),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 244/292 (84%), Positives = 270/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKR+QVK+KRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ HFS YIKKGI+ D++E +YK
Sbjct  181  GFKKDEKQLDAEVHRKYIFGGHVASYMKTLMEDEPEKYQAHFSEYIKKGIDPDDMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP   KS K PPKEHKR+N KKLTY+ER+AKLIERLNALNA+AG
Sbjct  241  KVHAAIRADPIAVKSTKPPPKEHKRYNLKKLTYEERKAKLIERLNALNASAG  292



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 255/310 (82%), Positives = 284/310 (92%), Gaps = 1/310 (0%)
 Frame = +3

Query  57   LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  236
            L+P+ET      S +A M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  26   LNPKETQALLPFSPSA-MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  84

Query  237  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  416
            YNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGL
Sbjct  85   YNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGL  144

Query  417  llarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalk  596
            LLARR+L+ LEMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALK
Sbjct  145  LLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALK  204

Query  597  galdggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFS  776
            GALDGGLDIPHS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS
Sbjct  205  GALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFS  264

Query  777  GYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
             YIK+GIEAD IEALYKKVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R
Sbjct  265  EYIKRGIEADGIEALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIAR  324

Query  957  LNALNAAAGN  986
            + A+N+AA N
Sbjct  325  VAAINSAADN  334



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K  K+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAE+HRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD+IE +YK
Sbjct  181  GFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N A 
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNDAG  291



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 241/292 (83%), Positives = 269/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AY KR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQ++SASIAGD++LASAYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF  D K LDAEVHR YI+GGHVA+YM +L EDEP+KYQTHFS YIKKGIE D+IE +YK
Sbjct  181  GFKNDEKQLDAEVHRNYIFGGHVASYMRALMEDEPDKYQTHFSEYIKKGIEPDDIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS  KS K+PP EHKR+N KKLTY+ER+AKLIERLNALNA+ G
Sbjct  241  KVHAAIRADPSAIKSTKEPPTEHKRYNLKKLTYEERKAKLIERLNALNASGG  292



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 272/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  241  KVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   418 bits (1074),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 272/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  241  KVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 287/321 (89%), Gaps = 6/321 (2%)
 Frame = +3

Query  42   PRSSYLSPQET----PL--RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRA  203
            P S  ++P  T    PL  R  + +   MAF+K QKT+AYFKR+QV FKRRREGKTDYRA
Sbjct  27   PLSPPIAPSTTHPQNPLTPRPPAPTAVAMAFVKAQKTKAYFKRYQVPFKRRREGKTDYRA  86

Query  204  RNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGL  383
            R RLINQDKNKYNTPKYRFVVRFT KDI+AQIVSASIAGD++LA+AY++ELP +GLEVGL
Sbjct  87   RVRLINQDKNKYNTPKYRFVVRFTKKDIIAQIVSASIAGDLVLAAAYSHELPHFGLEVGL  146

Query  384  TNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRT  563
            TNYAAAY TGLLLARR+L+KLEMD+EYEGNVEATGEDYSVEPG+SRRPFRALLDVGLIRT
Sbjct  147  TNYAAAYATGLLLARRVLKKLEMDEEYEGNVEATGEDYSVEPGDSRRPFRALLDVGLIRT  206

Query  564  TTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNE  743
            TTGNRVFGALKGALDGGLDIPHSEKRFAGF K++K LD EVHRKYI+GGHVAAYM +L E
Sbjct  207  TTGNRVFGALKGALDGGLDIPHSEKRFAGFDKETKQLDPEVHRKYIFGGHVAAYMRTLAE  266

Query  744  DEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLT  923
            DEPE+YQ+HFS Y K+G+EADN+E LYKKVHAAIRADP+PKKSEK PPKEHKR+N KKLT
Sbjct  267  DEPERYQSHFSEYHKRGLEADNLEELYKKVHAAIRADPTPKKSEKAPPKEHKRYNLKKLT  326

Query  924  YDERRAKLIERLNALNAAAGN  986
            Y+ER+A LIERLNALN+AAGN
Sbjct  327  YEERKASLIERLNALNSAAGN  347



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/290 (83%), Positives = 269/290 (93%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  KTRAY KRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHFS YI++GIE D++E LYK
Sbjct  181  GFNKDGKQLDAEVHRKYIFGGHVASYMRILMEDEPEKYQTHFSEYIQRGIEPDDLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRAD +  KS ++PPKEHKR+N KKLTY+ER+A+LIERLNALNA+
Sbjct  241  KVHAAIRADATMAKSTREPPKEHKRYNLKKLTYEERKARLIERLNALNAS  290



>ref|XP_012075400.1| PREDICTED: 60S ribosomal protein L5 [Jatropha curcas]
 gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   418 bits (1074),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 247/289 (85%), Positives = 272/289 (94%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR L+ LEMD EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GFTKD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQTHFS Y+K+GIE DN+EALYK
Sbjct  181  GFTKDNKQLDAEVHRKYIYGGHVAAYMKTLMEDEPEKYQTHFSEYVKRGIEPDNLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ KK EKQPPKEHKR+N +KLTY+ER+AKLIERL ALN+
Sbjct  241  KVHAAIRADPTLKKIEKQPPKEHKRYNLRKLTYEERKAKLIERLQALNS  289



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   417 bits (1073),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 244/288 (85%), Positives = 269/288 (93%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F K QK+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAE+HRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD+IE +YK
Sbjct  181  GFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL++RL A N
Sbjct  241  KVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVDRLKAFN  288



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   417 bits (1072),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 246/293 (84%), Positives = 273/293 (93%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
             VHAAIRADP+ KKS+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  241  NVHAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  293



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   417 bits (1072),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 244/292 (84%), Positives = 273/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIEAD +E LYK
Sbjct  181  GFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADCLEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEK+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AAG
Sbjct  241  KVHAAIRADPTFKKSEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   417 bits (1072),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+TK+S+ LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD++E LYK
Sbjct  181  GYTKNSQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADDLEGLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRA+P+ KKS+K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  241  KVHAAIRANPTVKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   417 bits (1072),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = +3

Query  114  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  293
            F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  5    FVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  64

Query  294  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  473
            QI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+GN
Sbjct  65   QIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQGN  124

Query  474  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  653
            VEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF
Sbjct  125  VEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGF  184

Query  654  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKV  833
             KD K LDAEVHR YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D++E +YKKV
Sbjct  185  KKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKV  244

Query  834  HAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            HAAIRADP   KS K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  245  HAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  295



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   417 bits (1071),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 247/289 (85%), Positives = 273/289 (94%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYM  L EDEPEKYQ HFS YIK+GIE D++E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMRMLMEDEPEKYQLHFSEYIKRGIEPDDMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ KKSEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  241  KVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   417 bits (1071),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 243/292 (83%), Positives = 272/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIEAD +E LYK
Sbjct  181  GFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KK EK+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AAG
Sbjct  241  KVHAAIRADPTFKKFEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   417 bits (1071),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 243/293 (83%), Positives = 275/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ +KS+KQPPKEHKR+N KKLTY+ER+AKL+ R+ A+N+AA N
Sbjct  241  KVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAADN  293



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 246/292 (84%), Positives = 273/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHV AYM +L EDEPEKYQTHFS YIK+G+EAD IE LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQTHFSEYIKRGVEADGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKS KQPPKEHKR+N KKLTY+ER+AKLI RL ALN+AAG
Sbjct  241  KVHAAIRADPTIKKSGKQPPKEHKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 248/292 (85%), Positives = 273/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+SK LDAEVHRKYIYG HVA YM  + EDEPEKYQ+HFS YIK+GIEADN+EALYK
Sbjct  181  GFNKESKQLDAEVHRKYIYGVHVADYMRVMMEDEPEKYQSHFSEYIKRGIEADNMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEKQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  241  KVHAAIRADPTIKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   416 bits (1069),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/292 (84%), Positives = 268/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHR YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEADNIE+LYK
Sbjct  181  GFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS KKSEK PPK+H RFN KKLTY+ER+AKLI+RL+ LNAAAG
Sbjct  241  KVHAAIRADPSAKKSEKAPPKQHMRFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+G+EAD +E LYK
Sbjct  181  GFDKDKKELDVDIHRKYVFGGHVASYMKTLMEDEPEKYQTHFSDYIKRGVEADGLEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKS K+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  241  KVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 271/289 (94%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHV+AYM +L EDEPEKYQ+HFS YIKKG+E D+IE +YK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRA+P  KK EKQPPKEHKR+N KKLTY+ER+AKLIERLNALN+
Sbjct  241  KVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  289



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 246/293 (84%), Positives = 272/293 (93%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA+ K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYK
Sbjct  181  GFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADCMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  241  KVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 246/289 (85%), Positives = 273/289 (94%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGN VFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ HFS YIK+GIE D++E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQLHFSEYIKRGIEPDDMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ KKSEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  241  KVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 274/291 (94%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ +KS+K+PPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  241  KVHAAIRADPTLRKSDKEPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 274/291 (94%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ +KS+KQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  241  KVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  KTRAYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATG+D+SVE  ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGDDFSVESAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHF  YIK+GIE D++E LYK
Sbjct  181  GFKKDEKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFIEYIKRGIEPDDMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+  KS K+PPKEHKRFN KKLTYDER+A+LIERLNALN++A
Sbjct  241  KVHAAIRADPTLVKSSKEPPKEHKRFNLKKLTYDERKARLIERLNALNSSA  291



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 246/293 (84%), Positives = 274/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L  LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKS+KQPPKEHKR+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  241  KVHAAIRADPTLKKSDKQPPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  293



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 242/292 (83%), Positives = 274/292 (94%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYK
Sbjct  181  GFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP  KKSEK+PPKEHKRFN +KLTY+ER+AKL+ERLNALN+A G
Sbjct  241  KVHAAIRADPILKKSEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  292



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 241/292 (83%), Positives = 269/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LD E HR YI+GGHVA YM  L EDEPEKYQTHFSGY+KKGIEADN+EA+YK
Sbjct  181  GFNKENKQLDPETHRNYIFGGHVANYMKVLTEDEPEKYQTHFSGYVKKGIEADNLEAMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEK  P EHKR+N KKLTY+ER+ +LIERL ALN+ AG
Sbjct  241  KVHAAIRADPTLKKSEKSAPTEHKRYNLKKLTYEERKERLIERLKALNSGAG  292



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   418 bits (1074),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 248/319 (78%), Positives = 280/319 (88%), Gaps = 10/319 (3%)
 Frame = +3

Query  27   LLRALPRSSYLSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR  206
            L R L  S Y  P           T   AF+K  K+RAY KR+QVK+KRRR+GKTDYRAR
Sbjct  65   LFRVLSVSDYTCP----------CTVYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRAR  114

Query  207  NRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLT  386
             RLINQDKNKYNTPKYR VVRF+NK IVAQI+SASIAGD++LA+AY++ELP YGLEVGLT
Sbjct  115  IRLINQDKNKYNTPKYRIVVRFSNKFIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLT  174

Query  387  NYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTT  566
            NYAAAYCTGLLLARR+L+KLEMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTT
Sbjct  175  NYAAAYCTGLLLARRVLKKLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTT  234

Query  567  TGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNED  746
            TGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LD +VHRKYIYGGHVAAYM +L ED
Sbjct  235  TGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAED  294

Query  747  EPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTY  926
            EPEKYQ+HFS YIK+G+EAD++E LYKKVHAAIRADP  KKSEK+PPKEHKRFN +KLTY
Sbjct  295  EPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKKSEKEPPKEHKRFNLRKLTY  354

Query  927  DERRAKLIERLNALNAAAG  983
            +ER+AKL+ERLNALN+A G
Sbjct  355  EERKAKLVERLNALNSAGG  373



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 247/293 (84%), Positives = 275/293 (94%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K +K++AYFKR++VKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPVESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  241  KVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  293



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   416 bits (1068),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/292 (82%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  177  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFA  236

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE DN+E LYK
Sbjct  237  GFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYK  296

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRAD   KKSE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  297  KVHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  348



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 240/292 (82%), Positives = 269/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YK
Sbjct  181  GFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  241  KVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+G+EAD +E LYK
Sbjct  181  GFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGVEADGLEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKS K+ PKEHKR+N KKLTY+ER+AKL+ RL A N+AA
Sbjct  241  KVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQAFNSAA  291



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   413 bits (1061),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 239/292 (82%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGL VGLTNYAAAYCTGLLLARR+L+  E+DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYIYGGHVA YM SL ++EPEK+Q+HFS YIKKGI AD++EALYK
Sbjct  181  GFKKDEKQLDAEVHRKYIYGGHVADYMRSLADEEPEKFQSHFSEYIKKGISADDMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS  KS K+PPK HKR+N KKLTYDER+A L++RLNALNA+AG
Sbjct  241  KVHAAIRADPSMAKSTKEPPKTHKRYNLKKLTYDERKASLVQRLNALNASAG  292



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   412 bits (1060),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 274/291 (94%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDA++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIE DN+E +YK
Sbjct  181  GFDKDKKELDADIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGIEPDNLEEVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKSEK+PPKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  241  KVHAAIRADPTFKKSEKEPPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  114  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  293
            ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVA
Sbjct  21   YVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVA  80

Query  294  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  473
            QI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  81   QIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGN  140

Query  474  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  653
            VEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF
Sbjct  141  VEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF  200

Query  654  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKV  833
             K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK V
Sbjct  201  DKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNV  260

Query  834  HAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            HAAIRADP+ KKS+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  261  HAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  311



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   412 bits (1060),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 267/289 (92%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADPS KKS K  PKEHKR+N KKLTYDER+ KLI RL ALN+
Sbjct  241  KVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNKLIARLQALNS  289



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   413 bits (1061),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 243/283 (86%), Positives = 270/283 (95%), Gaps = 0/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   MAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  78   IAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDDEYQ  137

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  138  GNLEATGEDYSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  197

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS Y+KKG+EADN+E LYK
Sbjct  198  GFSKDSKQLDAEVHRKYIYGGHVASYMTNLMEDEPEKYQSHFSKYVKKGLEADNLEELYK  257

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  258  KVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  300



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   412 bits (1058),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 237/291 (81%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
            A++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD++
Sbjct  4    AYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDLI  63

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYEG
Sbjct  64   AQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYEG  123

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFAG
Sbjct  124  NVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAG  183

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE DN+E LYKK
Sbjct  184  FNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKK  243

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRAD   KKSE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  244  VHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   412 bits (1058),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 242/293 (83%), Positives = 272/293 (93%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKTRAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ++ + I GD++LA+AY++ELP YGL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGEDYSVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNTEATGEDYSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+SK LD+EVHRKYIYGGHVAAYM  L EDEPEKYQ+HFS YIKKG++ DN+E +YK
Sbjct  181  GFNKESKQLDSEVHRKYIYGGHVAAYMRMLLEDEPEKYQSHFSEYIKKGVDPDNMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS KK+EKQPPKEHKR+N KKLTY+ER+AKLIERL ALN+AA +
Sbjct  241  KVHAAIRADPSAKKTEKQPPKEHKRYNLKKLTYEERKAKLIERLTALNSAADD  293



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   412 bits (1058),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 243/290 (84%), Positives = 272/290 (94%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA
Sbjct  241  KVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAA  290



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   411 bits (1057),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 243/293 (83%), Positives = 270/293 (92%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD +EALYK
Sbjct  181  GFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKSEK+P KEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  241  KVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 269/289 (93%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYK
Sbjct  181  GFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ KKSEKQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  241  KVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 243/283 (86%), Positives = 268/283 (95%), Gaps = 0/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASI GDM+LA+AYA+ELP YGLEVGL+NYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVA+YM +L EDEPEKYQ+HF  Y+KKG+E DN+E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYGGHVASYMTTLMEDEPEKYQSHFGLYVKKGLEPDNLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  241  KVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  283



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 270/289 (93%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYK
Sbjct  181  GFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ KKSEKQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  241  KVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 267/289 (92%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADPS KKS K  PKEHKR+N KKLTYDER+ +LI RL ALN+
Sbjct  241  KVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNELIARLQALNS  289



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ K+ + LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD +E LYK
Sbjct  181  GYAKNGQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADELEGLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRA+P  KKS+K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  241  KVHAAIRANPIAKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 236/292 (81%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD EVHRKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE DN+E +YK
Sbjct  181  GFKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            K HAAIRADP+  KS K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  241  KAHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  292



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   410 bits (1053),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 242/293 (83%), Positives = 270/293 (92%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD +EALYK
Sbjct  181  GFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+ KKSEK+P KEHK++N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  241  KVHAAIRADPTTKKSEKEPLKEHKKYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 241/290 (83%), Positives = 270/290 (93%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GED+SVEP ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADPS KKSEK P KEHKRFN KKLTY+ER+AKLI RL ALNAA
Sbjct  241  KVHAAIRADPSIKKSEKPPRKEHKRFNLKKLTYEERKAKLIARLQALNAA  290



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   409 bits (1052),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 242/290 (83%), Positives = 271/290 (93%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TT GNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADP+ KKSEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA
Sbjct  241  KVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAA  290



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   409 bits (1051),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 267/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKF+RRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D++EALYK
Sbjct  181  GFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  241  KVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD KNLDAE+HRKYIYGGHVA YM +L E+EPEKYQ HFS YIKKGIEAD++EALYKK
Sbjct  183  FKKDEKNLDAEIHRKYIYGGHVADYMRTLAEEEPEKYQAHFSEYIKKGIEADDMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIR +P+  K  KQPPKEHKR+N KKLTY++R+A L+ERLNALN++ G
Sbjct  243  VHAAIRGEPTMAKITKQPPKEHKRYNPKKLTYEQRKASLVERLNALNSSGG  293



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   409 bits (1050),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 245/292 (84%), Positives = 272/292 (93%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD +E LYK
Sbjct  181  GFEKEKKELDPEVHRKYIFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KK+EK+PPK+ KR+N KKLTY+ER+AKLI RL ALN+AAG
Sbjct  241  KVHAAIRADPTIKKAEKKPPKKSKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   408 bits (1048),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 241/289 (83%), Positives = 268/289 (93%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYK
Sbjct  181  GFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIR DP+ KKS KQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  241  KVHAAIREDPTAKKSGKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   408 bits (1048),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 235/291 (81%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAG
Sbjct  124  NIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAG  183

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD EVHRKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE DN+E +YKK
Sbjct  184  FKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKK  243

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
             HAAIRADP+  KS K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  244  AHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  294



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   407 bits (1047),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 235/292 (80%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVHRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA  +EALYK
Sbjct  181  GFKKDEKQLDAEVHRKYIYGGHVADYMKTLAEEEPEKYQSHFSEYIKKGIEAGGMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  241  KVHAAIRADPTLAKSTKEPPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   407 bits (1047),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 241/292 (83%), Positives = 269/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVS+SIAGDM+LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+K +  L+A+VHRKYI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE DNIE L K
Sbjct  181  GFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVH+AIRA+P  K +EKQPPK HKR+N KKLTY++R+AKL+ERLNALN+AAG
Sbjct  241  KVHSAIRAEPLAKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   407 bits (1046),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 265/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP   RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSGERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD+EVHRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGI AD+IE++YK
Sbjct  181  GFKKDEKQLDSEVHRKYIYGGHVADYMRSLADEEPEKYQSHFSEYIKKGISADDIESVYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K+ PK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  241  KVHAAIRADPTLVKSTKEAPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   407 bits (1045),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 238/292 (82%), Positives = 265/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D IE +YK
Sbjct  181  GFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  241  KVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   407 bits (1045),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEAD +EALYK
Sbjct  181  GFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADGMEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K+PPK HK++N KKLTY++R+A L+ERLNALN++ G
Sbjct  241  KVHAAIRADPTIAKSTKEPPKTHKKYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_012084278.1| PREDICTED: 60S ribosomal protein L5 [Jatropha curcas]
 gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   406 bits (1044),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 238/291 (82%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+ ++IAGD++LA+AY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ L+MD EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAGERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAE+HRKYIYGGHVAAYM  L EDEPEKYQ+HFS Y+K+GI+ADN+E LYK
Sbjct  181  GFSKDSKQLDAELHRKYIYGGHVAAYMRILMEDEPEKYQSHFSEYVKRGIDADNMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVH+AIRADP  KK+EKQPPKEHKR+N KKLTY+ER+ KLIERL ALN+AA
Sbjct  241  KVHSAIRADPITKKTEKQPPKEHKRYNLKKLTYEERKNKLIERLKALNSAA  291



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   407 bits (1045),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 240/292 (82%), Positives = 269/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVS+SIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLL+ARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFA
Sbjct  121  GNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+K +  L+A+VHRKYI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE DNIE L K
Sbjct  181  GFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVH+AIRA+P  K +EKQPPK HKR+N KKLTY++R+AKL+ERLNALN+AAG
Sbjct  241  KVHSAIRAEPLVKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   407 bits (1045),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 235/292 (80%), Positives = 268/292 (92%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGED+SVEP ++RRPFRALLDVGL+RTTTGNR+FGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNTEATGEDFSVEPTDTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE HR YI+GGHV +YM  + EDEPEKYQ+HFS Y KKGIEADN+EALYK
Sbjct  181  GFNKETKQLDAETHRNYIFGGHVGSYMKLMMEDEPEKYQSHFSEYAKKGIEADNLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKS+K  P EHKR+N KKLTY+ER+A+LIERL ALN+ AG
Sbjct  241  KVHAAIRADPTLKKSDKPAPTEHKRYNLKKLTYEERKARLIERLKALNSGAG  292



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   406 bits (1044),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 252/269 (94%), Gaps = 0/269 (0%)
 Frame = +3

Query  180  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  359
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  360  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRAL  539
            RYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGNVEATGEDYSVEP ESRRPFRAL
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEATGEDYSVEPAESRRPFRAL  147

Query  540  LDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVA  719
            LDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRKY++GGHVA
Sbjct  148  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  207

Query  720  AYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHK  899
            AYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ KKS+KQ PKEHK
Sbjct  208  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKKSDKQLPKEHK  267

Query  900  RFNQKKLTYDERRAKLIERLNALNAAAGN  986
            R+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  268  RYNLKKLTYEERKAKLIARVASLNSAADN  296



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   406 bits (1044),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 235/293 (80%), Positives = 268/293 (91%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+S+SIAGD++LASA+A+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+PHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDA+ HR YI+GGHVA+YM +L EDEPEKYQTHFS YIK+ +  D++E LYK
Sbjct  181  GFKKDEKQLDADFHRNYIFGGHVASYMRTLMEDEPEKYQTHFSDYIKRNVGPDDMEDLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS  KS K+PPKEHKR+N KKLTY+ER+AKLI+RLNALN+A  +
Sbjct  241  KVHAAIRADPSTVKSTKEPPKEHKRYNLKKLTYEERKAKLIDRLNALNSATAD  293



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKK
Sbjct  183  FKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  243  VHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA+ HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD IEALYKK
Sbjct  183  FKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  243  VHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   405 bits (1041),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 242/292 (83%), Positives = 265/292 (91%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHR YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEADNIE+LYK
Sbjct  181  GFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS KKSEK PPK+H R    KLTY+ER+AKLI+RL+ LNAAAG
Sbjct  241  KVHAAIRADPSAKKSEKAPPKQHMRL---KLTYEERKAKLIDRLHTLNAAAG  289



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   405 bits (1040),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 237/291 (81%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRF+VRFTNKDI+
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDII  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSASI GD+ILA+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   AQIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDFSVEPAEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA++HRKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD++EALYKK
Sbjct  183  FKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS K  PKEHKR+N KKLTY++R+A+L+ERLNALN++ G
Sbjct  243  VHAAIRADPSMAKSTKAQPKEHKRYNPKKLTYEQRKARLVERLNALNSSGG  293



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   404 bits (1039),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 239/290 (82%), Positives = 264/290 (91%), Gaps = 0/290 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  4    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  63

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  64   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  123

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  124  NVEATGEDFSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  183

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA++HRKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD++EALYKK
Sbjct  184  FKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKK  243

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            VHAAIRADPS  KS K PPKEHKR+N KKLTY++R+A L+ERLNALN++ 
Sbjct  244  VHAAIRADPSMAKSTKTPPKEHKRYNPKKLTYEQRKASLVERLNALNSSG  293



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   404 bits (1039),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  K+ AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKK
Sbjct  183  FKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  243  VHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   404 bits (1038),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M FIK QK RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+S++IAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+R PFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD +E LYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ KKSEK  PKEHKR+N KKLTYDER+ KLI RL ALN+AA
Sbjct  241  KVHAAIRADPTSKKSEKPQPKEHKRYNLKKLTYDERKNKLIARLQALNSAA  291



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 234/289 (81%), Positives = 266/289 (92%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K+RAYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSA+IAGD++L +AY++ELPRYGLE+GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+SK LDAE HR YI+GGHVA YM  LN+DEPEKYQTHFS Y+KKG++ADN+EALYK
Sbjct  181  GFNKESKQLDAETHRNYIFGGHVANYMKLLNDDEPEKYQTHFSEYLKKGMDADNLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVH AIRADP+ KKSEK  P EHKR+N KKLTY+ER+ +LIERL ALN+
Sbjct  241  KVHTAIRADPTLKKSEKPAPTEHKRYNLKKLTYEERKERLIERLKALNS  289



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 244/293 (83%), Positives = 271/293 (92%), Gaps = 6/293 (2%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKY++GGH+      L EDEPEKYQ+HFS YIK+GIEAD IEALYK
Sbjct  181  GFDKEKKELDAEVHRKYVFGGHI------LAEDEPEKYQSHFSEYIKRGIEADGIEALYK  234

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  235  KVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  287



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 266/291 (91%), Gaps = 1/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQ++ ASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+G
Sbjct  63   AQVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDY+VEP ESRRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDYAVEPTESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K+ K LD EVH KYIYGGHVA+YM +L EDEPEKYQ+HF  YIKKGIE DNIEALY+K
Sbjct  183  FKKEDKQLDPEVHHKYIYGGHVASYMMTLMEDEPEKYQSHFGEYIKKGIEPDNIEALYRK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRAD    KSEKQPPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  243  VHAAIRAD-PTMKSEKQPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   402 bits (1034),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 266/292 (91%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFA
Sbjct  118  GNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFA  177

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YK
Sbjct  178  GFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYK  237

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  238  KVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   402 bits (1034),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA+ HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EA+ IEALYKK
Sbjct  183  FKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEAEEIEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  243  VHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   402 bits (1032),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 272/291 (93%), Gaps = 3/291 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
             AF+K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSASIAGD++LA+AY+ ELP+YGLEVGLTNYAAAYCTGLL+ARR+L++LEMD EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  126  GNVEATGEDFSVEPTENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFA  185

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIYGGHVAAYM +L EDEPEK+  HFS Y+K+GI+ADN+E LYK
Sbjct  186  GFSKDSKQLDAEVHRKYIYGGHVAAYMRTLAEDEPEKFLAHFSEYLKRGIDADNLEELYK  245

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ +KSEKQPPKEHKR+N KKLTY+ER+AKLIERLNA N+AA
Sbjct  246  KVHAAIRADPTGRKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNAFNSAA  296



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 238/292 (82%), Positives = 264/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+SK LDAE+HR YIYGGHV+ YM  L EDEPEK+QTHFS Y+KKG++A+NIE LYK
Sbjct  181  GFNKESKQLDAEIHRNYIYGGHVSNYMKLLTEDEPEKFQTHFSQYVKKGVDAENIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+ K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTVKAAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 265/292 (91%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEADN+EALYK
Sbjct  178  GFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADNMEALYK  237

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  238  KVHAAIRADPTMAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  289



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   399 bits (1026),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 266/283 (94%), Gaps = 0/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QIVSA+I GD +LA+AYA+ELP +GL+VGL+NYAAAYCTGLLL+RR+L+KLEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ KD+K LD EVHRKYIYGGHVA+YMN+L EDEPEKYQ+HF  YIK+G+EADNIE +YK
Sbjct  181  GYNKDNKQLDPEVHRKYIYGGHVASYMNALMEDEPEKYQSHFKEYIKRGVEADNIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KVHAAIRADP+PKKS+KQ PKEHKR+N KKLTY+ER+AKLIER
Sbjct  241  KVHAAIRADPTPKKSDKQQPKEHKRYNLKKLTYEERKAKLIER  283



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 230/291 (79%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD KNLDA++HRKYI+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD +EALYKK
Sbjct  183  FKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  243  VHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  293



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 230/291 (79%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  65

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  66   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  125

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  126  NVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  185

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD KNLDA++HRKYI+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD +EALYKK
Sbjct  186  FKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKK  245

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  246  VHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  296



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 235/292 (80%), Positives = 263/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+ IE LYK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 236/292 (81%), Positives = 264/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYK
Sbjct  181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 239/292 (82%), Positives = 264/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAEVHRKYI+GGHVAAYM +L EDEPEKYQTHFS YIK+GIEAD IE LYK
Sbjct  181  GFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADPS KK EKQPPKEHKR+N KKLTY+ER+ KL+ RL ALN+AAG
Sbjct  241  KVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  292



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 265/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YK
Sbjct  181  GFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+EK  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTEKPAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   397 bits (1020),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 248/292 (85%), Positives = 275/292 (94%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADNIE LYK
Sbjct  181  GFKKEDKQLDPEVHRKYIYGGHVASYMRALMEDEPEKYQSHFSEYIKRGIEADNIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+ KKSEK+PPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  241  KVHAAIRADPTIKKSEKEPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   398 bits (1022),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 244/309 (79%), Positives = 270/309 (87%), Gaps = 1/309 (0%)
 Frame = +3

Query  57   LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  236
            +S Q T  RG       MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NK
Sbjct  16   VSIQSTDSRGRRCPFG-MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANK  74

Query  237  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  416
            Y TPKYR+VVR TNKDIV QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGL
Sbjct  75   YGTPKYRYVVRLTNKDIVCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGL  134

Query  417  llarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalk  596
            LLARR+L+ LEMD EYEGNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALK
Sbjct  135  LLARRVLKTLEMDDEYEGNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALK  194

Query  597  galdggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFS  776
            GALDGGLDIPHS+KRFAGF K+ K LDAEVHRKYI+GGHVAAYM +L EDEPEKYQTHFS
Sbjct  195  GALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFS  254

Query  777  GYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
             YIK+GIEAD IE LYKKVHAAIRADPS KK EKQPPKEHKR+N KKLTY+ER+ KL+ R
Sbjct  255  EYIKRGIEADGIEELYKKVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSR  314

Query  957  LNALNAAAG  983
            L ALN+AAG
Sbjct  315  LQALNSAAG  323



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 260/291 (89%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKK
Sbjct  183  FKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  243  VHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   396 bits (1018),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M ++K QKT+AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHFS YIK+GIE D++E LYK
Sbjct  181  GFSKDDKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFSEYIKRGIEPDDMEGLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+  KS K+PPKEHKR+N +KLTY+ER+AKLI+RLNALNA A
Sbjct  241  KVHAAIRADPTMVKSAKEPPKEHKRYNLRKLTYEERKAKLIDRLNALNARA  291



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   396 bits (1018),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 260/291 (89%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +E+LYKK
Sbjct  183  FKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  243  VHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 261/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AY+KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKK
Sbjct  183  FKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  243  VHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 263/288 (91%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYK
Sbjct  181  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+ K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  241  KVHAAIRADPNPKKTAKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  288



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/292 (80%), Positives = 262/292 (90%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  118  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  177

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D IE +YK
Sbjct  178  GFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYK  237

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  238  KVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/292 (80%), Positives = 264/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YK
Sbjct  181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA+P+ KK+EK  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRAEPNHKKTEKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/288 (81%), Positives = 265/288 (92%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  31   MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  90

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  91   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  150

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  151  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  210

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYK
Sbjct  211  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYK  270

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  271  KVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  318



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 230/293 (78%), Positives = 263/293 (90%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F++ QK  AY+KRFQV+FKRRR+GKTDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGDM+LASAY++ELPRYGLEVGL NYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+ VEP + RRPFRALLDVGLIRTTTGNRVF ALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFCVEPADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K LDAEVH KYIYGGHVA YM +L E+E EKYQ+HFS YIKKGI+AD++E LYK
Sbjct  181  GFKKDEKQLDAEVHHKYIYGGHVADYMRTLAEEEFEKYQSHFSEYIKKGIKADDVETLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADPS  KS K+PPKEHKR+N KKLT++ERR++L+ERLNALN+   +
Sbjct  241  KVHAAIRADPSVAKSTKEPPKEHKRYNSKKLTHEERRSRLVERLNALNSCGDD  293



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/291 (79%), Positives = 261/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
            AF+K+QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
             QI  A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEA GEDYSVEP + RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAG
Sbjct  123  NVEAAGEDYSVEPSDERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDAE+HRKYIYGGHVA YM SL E+EPEK+Q HFS YIK+GIEAD++EALYKK
Sbjct  183  FKKDEKQLDAEIHRKYIYGGHVADYMRSLAEEEPEKFQAHFSDYIKRGIEADDMEALYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRA+P+  KS K+PPK HKR+N KKLTY+ R+A L++RLNALN++AG
Sbjct  243  VHAAIRANPTMVKSTKEPPKTHKRYNLKKLTYEGRKASLVQRLNALNSSAG  293



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE LYK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKILAEDEPEKLQTHFSAYIKKGVEAEGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   395 bits (1014),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 230/289 (80%), Positives = 263/289 (91%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAE+HRKYIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +N+E +YK
Sbjct  181  GFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP  KKS+K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  241  KVHAAIRADPLAKKSDKETPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   394 bits (1013),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYK
Sbjct  181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA P+ +K+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRAXPNXRKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   394 bits (1012),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 264/292 (90%), Gaps = 4/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KDSK LD EVHRKYIYGGHVAAYM       PEKYQ+HFS YIK+GIE D+IE +YK
Sbjct  181  GFNKDSKQLDPEVHRKYIYGGHVAAYMKM----SPEKYQSHFSEYIKRGIEPDSIEGMYK  236

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP  KKS+K+PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  237  KVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  288



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   395 bits (1014),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 240/322 (75%), Positives = 274/322 (85%), Gaps = 12/322 (4%)
 Frame = +3

Query  21   FKLLRALPRSSYLSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYR  200
             +  R  P S + SPQ+T           M F+K  K+ AYFKR+QVKF+RRR GKTDYR
Sbjct  5    LRQFRLFP-SLHSSPQQT-----------MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYR  52

Query  201  ARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVG  380
            AR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGD++ ASAYA+ELP+YGL VG
Sbjct  53   ARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVG  112

Query  381  LTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIR  560
            LTNYAAAYCTGLLLARR+L+ LEMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIR
Sbjct  113  LTNYAAAYCTGLLLARRVLKMLEMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIR  172

Query  561  TTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLN  740
            TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K L+AE HR YIYGGHV+ YM  L 
Sbjct  173  TTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHRNYIYGGHVSNYMKMLA  232

Query  741  EDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKL  920
            EDEPEK QTHFS Y+KKG+EA++IE +YKKVHAAIRADP+PKK+EK  PK+HKR+N KKL
Sbjct  233  EDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKL  292

Query  921  TYDERRAKLIERLNALNAAAGN  986
            TY+ER+ KLIER+ ALN A G+
Sbjct  293  TYEERKNKLIERVKALNGAGGD  314



>ref|XP_011628715.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 240/293 (82%), Positives = 271/293 (92%), Gaps = 1/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI+SASIAGD++LAS+YA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G++KD K+LDAEVHRKYIYGGHVAAYM+ L EDEPEKYQ+HF  Y+K+ IE ++IE +YK
Sbjct  181  GYSKDDKSLDAEVHRKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPESIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVH AIRAD      +K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+AAG+
Sbjct  241  KVHTAIRAD-PSSVKKKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAGD  292



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 264/288 (92%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYK
Sbjct  181  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  241  KVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 263/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK
Sbjct  181  GFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
             VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A G
Sbjct  241  NVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  292



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 261/292 (89%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFSGYIKKG+EA+ IE +YK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSGYIKKGVEAEGIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRA+P+ KK+ K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRAEPNHKKTVKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 262/289 (91%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ K LDAE+HRKYIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +N+E +YK
Sbjct  181  GFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
             VHAAIRADP  KKS+K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  241  NVHAAIRADPLAKKSDKEAPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   393 bits (1010),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 231/287 (80%), Positives = 264/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIV
Sbjct  35   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  94

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEG
Sbjct  95   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  154

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  155  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  214

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKK
Sbjct  215  FNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKK  274

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            VHAAIRADP+PKK++K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  275  VHAAIRADPNPKKTKKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  321



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 263/288 (91%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  8    FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  67

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  68   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  127

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  128  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  187

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYK
Sbjct  188  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYK  247

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  248  KVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  295



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 258/295 (87%), Gaps = 3/295 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgg---ldIPHSEK  638
            GNV ATGED+S+EP ESRRPFRALLDVGLIRTTTGNRVFGALK         LDIPHS+K
Sbjct  121  GNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDK  180

Query  639  RFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEA  818
            RFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE 
Sbjct  181  RFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEE  240

Query  819  LYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            LYKKVHAAIRADP+PKK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  LYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  295



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE +YK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE +YK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   392 bits (1008),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 232/287 (81%), Positives = 264/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIV
Sbjct  26   VFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  85

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEG
Sbjct  86   AQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEG  145

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  146  NLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  205

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKK
Sbjct  206  FNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKK  265

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            VHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  266  VHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  312



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   392 bits (1006),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 233/293 (80%), Positives = 264/293 (90%), Gaps = 0/293 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K L+AE HR YIYGGHV+ YM  L EDEPEK QTHFS Y+KKG+EA++IE +YK
Sbjct  181  GFNKENKQLNAETHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            KVHAAIRADP+PKK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G+
Sbjct  241  KVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  293



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 251/264 (95%), Gaps = 0/264 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEADNIEA+YK
Sbjct  181  GFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYK  240

Query  828  KVHAAIRADpspkksekqppkeHK  899
            KV AAIRADP+ KK EKQPPKEHK
Sbjct  241  KVQAAIRADPTAKKIEKQPPKEHK  264



>ref|XP_011628714.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Amborella trichopoda]
Length=301

 Score =   391 bits (1005),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 239/292 (82%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  5    AFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  64

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGD++LAS+YA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EYEG
Sbjct  65   AQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYEG  124

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  125  NVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAG  184

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            ++KD K+LDAEVHRKYIYGGHVAAYM+ L EDEPEKYQ+HF  Y+K+ IE ++IE +YKK
Sbjct  185  YSKDDKSLDAEVHRKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPESIEEMYKK  244

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            VH AIRAD      +K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+AAG+
Sbjct  245  VHTAIRAD-PSSVKKKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAGD  295



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 264/288 (92%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LN DEPEK+QTHFS ++KKG++A+++E LYK
Sbjct  181  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNYDEPEKFQTHFSQHLKKGVDAESMEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  241  KVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 263/288 (91%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  9    WVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  68

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  69   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  128

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  129  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  188

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA++HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYK
Sbjct  189  GFNKENKQLDADIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYK  248

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  249  KVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  296



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 233/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYC GLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAESIEEIYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  241  KVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 228/292 (78%), Positives = 263/292 (90%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD++EA+YK
Sbjct  178  GFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYK  237

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  238  KVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 263/288 (91%), Gaps = 0/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  138  GNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  197

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYK
Sbjct  198  GFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYK  257

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALN  971
            KVHAAIRADP+PKK+EK  PK H R+N KKLTY+ER+ KLIER+ ALN
Sbjct  258  KVHAAIRADPNPKKTEKPAPKTHNRYNLKKLTYEERKNKLIERVKALN  305



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 228/292 (78%), Positives = 262/292 (90%), Gaps = 3/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M +IK QKTRAY KRFQVKFKRRR GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  118  GNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  177

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD++EA+YK
Sbjct  178  GFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYK  237

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  238  KVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 230/296 (78%), Positives = 266/296 (90%), Gaps = 4/296 (1%)
 Frame = +3

Query  96   STAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFT  275
            + AP+ +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   T
Sbjct  2    AAAPV-YIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---T  57

Query  276  NKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMD  455
            NKD+ AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D
Sbjct  58   NKDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLD  117

Query  456  QEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSE  635
            +EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+
Sbjct  118  EEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSD  177

Query  636  KRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIE  815
            KRFAGF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEKYQTHFS YIK+GI AD++E
Sbjct  178  KRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKYQTHFSEYIKRGISADDME  237

Query  816  ALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            A+YKKVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  238  AVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  293



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 231/289 (80%), Positives = 261/289 (90%), Gaps = 0/289 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIV
Sbjct  12   VFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIV  71

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEG
Sbjct  72   AQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEG  131

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  132  NAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAG  191

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK 
Sbjct  192  FNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKN  251

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  252  VHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  300



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   390 bits (1001),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 278/314 (89%), Gaps = 8/314 (3%)
 Frame = +3

Query  30   LRALPRSSYLSPQETPLRG*SSSTAP-----MAFIKVQKTRAYfkrfqvkfkrrrEGKTD  194
            + ALPR  + S   +PL   S   AP     M ++K QKT+AYFKRFQVKFKRRR+GKTD
Sbjct  1    MEALPRCFFCS---SPLPPKSDLGAPKRGSAMVYVKTQKTKAYFKRFQVKFKRRRQGKTD  57

Query  195  YRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLE  374
            YRAR RLINQDKNKYNTPKYRFVVRFTNKDI+AQI+SASIAGD++LA+AY++ELPRYGLE
Sbjct  58   YRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLE  117

Query  375  VGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGL  554
            VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL
Sbjct  118  VGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGL  177

Query  555  IRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNS  734
            +RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LD EVHRKYI+GGHV++YM  
Sbjct  178  VRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDEKQLDPEVHRKYIFGGHVSSYMRM  237

Query  735  LNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQK  914
            L EDEPEKYQTHFS Y+K+GIE D+IE LYKKVHAAIRADP+  KS K+PPKEHKRFN K
Sbjct  238  LMEDEPEKYQTHFSEYVKRGIEPDDIEELYKKVHAAIRADPNMVKSTKEPPKEHKRFNLK  297

Query  915  KLTYDERRAKLIER  956
            KLTY+ER+A+LIER
Sbjct  298  KLTYEERKARLIER  311



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   389 bits (998),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 226/292 (77%), Positives = 258/292 (88%), Gaps = 1/292 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  284
            M  +K Q +R Y  R+QVK++RRR+GKTDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  285  IVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEY  464
            I AQ+VSASIAGD+ILA+AYA+ELP+YGL VGLTNY+AAYCTGLLLARR+L+  EMD EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  465  EGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            EGN+EA+GED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  121  EGNLEASGEDFSVEPTENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
            AGF+K++K LD   H KYIYGGHVA YM +LNEDEPEK+QTHFS Y+KKGIEAD +EALY
Sbjct  181  AGFSKENKQLDFATHAKYIYGGHVADYMKTLNEDEPEKFQTHFSEYVKKGIEADEMEALY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KKVHAAIRADP  KK+ KQ  KEHKRFN KKLTY +R+A LI+R+  LN+AA
Sbjct  241  KKVHAAIRADPLAKKAGKQSLKEHKRFNLKKLTYKQRKANLIDRITTLNSAA  292



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 233/296 (79%), Positives = 263/296 (89%), Gaps = 4/296 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  468  GNVE----ATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSE  635
            GN E    ATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+
Sbjct  121  GNAEVRLIATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSD  180

Query  636  KRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIE  815
            KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E
Sbjct  181  KRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENME  240

Query  816  ALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
             +YK VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A G
Sbjct  241  EMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  296



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEADNIE+LYK
Sbjct  181  GFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKR  902
            KVHAAIRADP+ KK+EK+PPK+HKR
Sbjct  241  KVHAAIRADPTAKKTEKEPPKQHKR  265



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 261/289 (90%), Gaps = 0/289 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI+
Sbjct  94   VFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDII  153

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEG
Sbjct  154  AQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEG  213

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  214  NAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAG  273

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK 
Sbjct  274  FNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKN  333

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  334  VHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  382



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 227/290 (78%), Positives = 259/290 (89%), Gaps = 0/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK + YFKR+QVKF+RRREGKTDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QIVSA+I GD +LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EATGEDYSVEP E+RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNAEATGEDYSVEPTETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK
Sbjct  181  GFNKEGKNLDAEIHRKYIYGGHVADYMRLLMEDEPEKYQSHFSDYLKKDLAPENMEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            KVHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+ 
Sbjct  241  KVHAAIRADPSVKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSV  290



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 224/291 (77%), Positives = 257/291 (88%), Gaps = 3/291 (1%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  59

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  60   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  119

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            N+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  120  NIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  179

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKK
Sbjct  180  FKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKK  239

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  240  VHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  290



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 225/291 (77%), Positives = 257/291 (88%), Gaps = 3/291 (1%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG
Sbjct  123  NVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +E+LYKK
Sbjct  183  FKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKK  242

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  243  VHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   383 bits (983),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYK
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQ  911
            KVHAAIRADP+ KKSEK+PP EHKR+ Q
Sbjct  241  KVHAAIRADPNQKKSEKKPPAEHKRYGQ  268



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 216/259 (83%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = +3

Query  210  RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTN  389
            RLINQDKNKYNTPKYRFVVRF+NKDIVAQI SASI GD +LASAYA+ELPRYGLEVGLTN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  390  YAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTT  569
            YAAAYCTGLLLARRLL+ LEMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTT
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTT  149

Query  570  GNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDE  749
            GNRVFGALKGALDGGLDIPHSEKRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDE
Sbjct  150  GNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDE  209

Query  750  PEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYD  929
            PEKYQ+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KKSEK+P KEHKR+N KKLTY+
Sbjct  210  PEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYE  269

Query  930  ERRAKLIERLNALNAAAGN  986
            ER+ KL+ERLN  N+AA +
Sbjct  270  ERKEKLVERLNTFNSAADD  288



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 261/291 (90%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QKTRAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ A++AGD+++A+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD+EY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN EA+GEDYSVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNEEASGEDYSVEPNDARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ K+SK+LDA++HRKYI GGHVAAYM +L EDEPEKYQ+ FS Y KKGIE +NIE LYK
Sbjct  181  GYNKESKSLDADLHRKYILGGHVAAYMKTLREDEPEKYQSQFSEYHKKGIEPENIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRADP+ K SEK  PK  K +  +KLTY+ER+ KLI RLNALNA A
Sbjct  241  KVHAAIRADPTIKYSEKHVPKVQKHYLTRKLTYEERKNKLIARLNALNAGA  291



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 230/291 (79%), Positives = 259/291 (89%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASI GD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K L+AE+HR YI+GGHV+ YM  L EDEPEK QTHFS YIKKG+E ++IE +YK
Sbjct  181  GFNKENKQLNAEIHRNYIFGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEPESIEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVH AIRADP+PKK EK  PKEHKR N KKLTY+ER+ KLIER+ ALN A+
Sbjct  241  KVHLAIRADPNPKKCEKPAPKEHKRHNLKKLTYEERKNKLIERVKALNRAS  291



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 226/264 (86%), Positives = 249/264 (94%), Gaps = 0/264 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYK
Sbjct  181  GFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYK  240

Query  828  KVHAAIRADpspkksekqppkeHK  899
            KVHAAIRADP+ KKSEK  PKEHK
Sbjct  241  KVHAAIRADPTMKKSEKPAPKEHK  264



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   374 bits (959),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 222/267 (83%), Positives = 250/267 (94%), Gaps = 0/267 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYK
Sbjct  181  GFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFN  908
            KVHAAIRADP  KKSEK+PPKEHKR+ 
Sbjct  241  KVHAAIRADPILKKSEKEPPKEHKRWG  267



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   365 bits (938),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 257/291 (88%), Gaps = 0/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS++RFA
Sbjct  121  GNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G +KD K L  E HRKY++G  +  YM +L EDEP KYQT F  Y   G + +++E ++K
Sbjct  181  GISKDKKELGPEFHRKYVFGDWLRPYMKTLIEDEPGKYQTPFMDYFSGGKKPEDLEEVFK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAA  980
            KVHAAIRA+P+ KK EKQPPKE KR+N KKLTY+ER+AKL+ RL ALN AA
Sbjct  241  KVHAAIRANPTFKKVEKQPPKEPKRYNLKKLTYEERKAKLVARLQALNFAA  291



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   365 bits (938),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 227/246 (92%), Gaps = 0/246 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA+++E LYKK
Sbjct  183  FKKDDKQLDADIHRKYIYGGHVADYMKNLAEEEPEKYQSHFSDYIKKGIEAEDMEGLYKK  242

Query  831  VHAAIR  848
            VHAAIR
Sbjct  243  VHAAIR  248



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   362 bits (928),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 217/265 (82%), Positives = 241/265 (91%), Gaps = 0/265 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFA
Sbjct  121  GNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+ IE LYK
Sbjct  181  GFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYK  240

Query  828  KVHAAIRADpspkksekqppkeHKR  902
            KVHAAIRADP+PKK+ K  PK+HKR
Sbjct  241  KVHAAIRADPNPKKTVKPAPKQHKR  265



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 213/289 (74%), Positives = 253/289 (88%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G++K+ K+L+AE+HRKYI GGHVA YM  L EDEPEKYQ+HFSG+IK+GIEAD++  +Y 
Sbjct  181  GYSKEDKSLNAEIHRKYILGGHVADYMRLLKEDEPEKYQSHFSGFIKEGIEADDLADMYS  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP+ +K+ K+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  241  KVHAAIRADPTSQKTAKKAPAEKRKWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 214/289 (74%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF+K+ K+L+AE HRKYI GGHVA YM  L EDEPEKYQ+HF+ +IK+GIEAD +  +Y 
Sbjct  181  GFSKEDKSLNAETHRKYILGGHVADYMRLLKEDEPEKYQSHFNKFIKEGIEADELAEMYT  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
            KVHAAIRADP  +K+EK+ P E +++  +KLT++ER+A L++RLNA+NA
Sbjct  241  KVHAAIRADPDQQKTEKKAPAEKRKWKIQKLTFEERQAALVQRLNAINA  289



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G++K+ K+L+AE HRKYI GGH+A YM  L EDEPEKYQ+HFSG+IK G+EADN+  +Y 
Sbjct  181  GYSKEDKSLNAETHRKYILGGHIADYMRLLKEDEPEKYQSHFSGFIKAGVEADNLAEMYT  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
             VHAAIRADP+ +K+EK+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  241  SVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYEERQAALVKRLNAVNG  289



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 251/289 (87%), Gaps = 0/289 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  ++D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFA
Sbjct  121  GNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+ K+ K+L+AE+HRKYI GGHVA YM  L EDEPEKYQ+HFSG+IK G+EA+N+  +Y 
Sbjct  181  GYNKEDKSLNAEIHRKYILGGHVADYMKLLKEDEPEKYQSHFSGFIKAGVEAENLAEMYT  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
             VHAAIRADP+ +K+EK+ P E +++  +KLTYDER+A L++RLNA+N 
Sbjct  241  SVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYDERQAALVKRLNAING  289



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 224/291 (77%), Positives = 244/291 (84%), Gaps = 24/291 (8%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKK  830
            F K+                        L E+EPEKYQ+HFS YIKKG+EAD IEALYKK
Sbjct  183  FKKN------------------------LAEEEPEKYQSHFSAYIKKGVEADEIEALYKK  218

Query  831  VHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            VHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  219  VHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  269



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   351 bits (900),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 190/225 (84%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +3

Query  180  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  359
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSA+IAGD +LA+AYA+EL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  360  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRAL  539
             YGLEVGLTNYAAAYCTGLLL RR+L KL++DQEYEGNVEATGEDYSVEP ESRRPFRAL
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEATGEDYSVEPAESRRPFRAL  120

Query  540  LDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVA  719
            LDVGL+RTTTGNRVFGALKGALD G+DIPHS+KRFAGF+KD K LDA+VHRKYIYGGHVA
Sbjct  121  LDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGFSKDGKQLDAKVHRKYIYGGHVA  180

Query  720  AYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  854
            AYMN+L EDEPEKY+ HFS + K+ IEAD +E LY+KVHAAIRAD
Sbjct  181  AYMNTLAEDEPEKYERHFSEFAKREIEADGLEELYRKVHAAIRAD  225



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   349 bits (896),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 204/250 (82%), Positives = 225/250 (90%), Gaps = 1/250 (0%)
 Frame = +3

Query  228  KNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYC  407
            ++KYN P      RFTNKDIVAQIVSASIAGD++L +AYA+ELP YGLEVGLTNYAAAYC
Sbjct  22   QDKYNFPSI-VCCRFTNKDIVAQIVSASIAGDIVLCAAYAHELPHYGLEVGLTNYAAAYC  80

Query  408  TGlllarrllqklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFg  587
            TGLLLARR+L+ LEMD+EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFG
Sbjct  81   TGLLLARRVLKTLEMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFG  140

Query  588  alkgaldggldIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQT  767
            ALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRKYI+GGHV AYM +L EDEPEKYQT
Sbjct  141  ALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQT  200

Query  768  HFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKL  947
            HFS YIKKGIEAD IE LYKKVHAAIRADP+ KK+EKQPPKEHKR+N KKLTYDERR KL
Sbjct  201  HFSQYIKKGIEADGIEELYKKVHAAIRADPANKKAEKQPPKEHKRYNLKKLTYDERRTKL  260

Query  948  IERLNALNAA  977
            I RL ALN+A
Sbjct  261  IARLEALNSA  270



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 207/292 (71%), Positives = 251/292 (86%), Gaps = 2/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            GN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
            AG++K+ K+L+AEVHRKYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +++E LY
Sbjct  181  AGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELY  240

Query  825  KKVHAAIRADpspkksekqppk-eHKRFNQKKLTYDERRAKLIERLNALNAA  977
             KVHAAIRADPSP++   +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  241  TKVHAAIRADPSPREPPPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 250/292 (86%), Gaps = 2/292 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            GN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRF
Sbjct  121  GNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
            AG++K+ K+L+AEVHRKYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +++E LY
Sbjct  181  AGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELY  240

Query  825  KKVHAAIRADpspkksekqppk-eHKRFNQKKLTYDERRAKLIERLNALNAA  977
             KVHAAIR DPSP++   +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  241  TKVHAAIREDPSPREPPPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 205/292 (70%), Positives = 231/292 (79%), Gaps = 38/292 (13%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+K QKTRAY KRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTRAYSKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGDM+LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   TAQIISASIAGDMVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G                   F+  LD GL                     DIPHS+KRFA
Sbjct  121  GKC-----------------FQGALDGGL---------------------DIPHSDKRFA  142

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF++D K LDA+VHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIE D IE +YK
Sbjct  143  GFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIEPDGIEEMYK  202

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KVHA+IRADP+PKKSEK+PPK HKR N KKLTY+ER+AKLIERLNALN+AAG
Sbjct  203  KVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAAG  254



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = +3

Query  258  FVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrll  437
            FV     KDI+AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L
Sbjct  3    FVKAQKTKDIIAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTL  62

Query  438  qklEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggl  617
            ++LEMD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+
Sbjct  63   KQLEMDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGI  122

Query  618  dIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGI  797
            DIPHSEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GI
Sbjct  123  DIPHSEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGI  182

Query  798  EADNIEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
            EADN+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+A
Sbjct  183  EADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSA  242

Query  978  AG  983
            AG
Sbjct  243  AG  244



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 231/293 (79%), Gaps = 34/293 (12%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFV-VRFTNKD  284
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   F++ D
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVPYLFSSTD  60

Query  285  IVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEY  464
            ++  +                                 AYCTGLLLARR+L+  ++DQEY
Sbjct  61   LIRHV---------------------------------AYCTGLLLARRVLKCRDLDQEY  87

Query  465  EGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            EGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRF
Sbjct  88   EGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF  147

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
            AGF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D++EALY
Sbjct  148  AGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALY  207

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KKVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  208  KKVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYM  728
            GF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYM  728
            GF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFA
Sbjct  121  GNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEP  752
            GF KDSK LD EVHRKYIYGGHVAAYM +L EDEP
Sbjct  181  GFNKDSKQLDPEVHRKYIYGGHVAAYMKNLMEDEP  215



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFA
Sbjct  121  GHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYM  728
            GF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  181  GFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +3

Query  324  MILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSV  503
            M+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEGNVEATGED+SV
Sbjct  1    MVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEGNVEATGEDFSV  60

Query  504  EPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAE  683
            EP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA+
Sbjct  61   EPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDAD  120

Query  684  VHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp  863
             HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD IEALYKKVHAAIRADPS 
Sbjct  121  THRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSI  180

Query  864  kksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
             KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  181  VKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +3

Query  324  MILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSV  503
            M+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEGNVEATGED+SV
Sbjct  1    MVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEGNVEATGEDFSV  60

Query  504  EPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGFTKDSKNLDAE  683
            EP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA+
Sbjct  61   EPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDAD  120

Query  684  VHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp  863
            +HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKKVHAAIRADPS 
Sbjct  121  IHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSV  180

Query  864  kksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
             KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  181  VKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYM  728
            GF KD K LD EVHRKYIYGGHVAAYM
Sbjct  181  GFNKDGKQLDPEVHRKYIYGGHVAAYM  207



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFA
Sbjct  121  GNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFA  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYM  728
            GF KD K LD EVHRKYIYGGHVAAYM
Sbjct  181  GFNKDGKQLDPEVHRKYIYGGHVAAYM  207



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  114  FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  293
            F+K QK++AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  294  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  473
            QIVSA+IAGD +LA+AY++EL  YGLEVGLTNYAAAYCTGLLL RR+L+KL++DQEY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  474  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAGF  653
            VEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALD G+DIPHS+KRFAGF
Sbjct  121  VEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGF  180

Query  654  TKDSKNLDAEVHRKYIYGGHVAAYMN  731
            +KDSK LDAEVHRKYI+GGHVAAYMN
Sbjct  181  SKDSKQLDAEVHRKYIFGGHVAAYMN  206



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 228/291 (78%), Gaps = 1/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MA  KVQK  AYF R+QVK+KRRR GKTDYRAR R+  QDKNKYNTPKYR VVRFTN+ +
Sbjct  1    MALTKVQKGSAYFSRYQVKYKRRRAGKTDYRARLRMCTQDKNKYNTPKYRLVVRFTNRTV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V Q+  A++AGD ++ +AY++ELPRYGL+VGLTNYAAAYCTGLL+ARR+L KL +D+ YE
Sbjct  61   VCQVAYATMAGDKVICAAYSSELPRYGLKVGLTNYAAAYCTGLLVARRMLNKLGLDKHYE  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            GN E  GEDY+VE   ++ RPF+ +LD GL RT+TG++VF ALKGALDGGLDIPH+EKRF
Sbjct  121  GNTEDVGEDYNVEAEDDAPRPFQCILDAGLKRTSTGSKVFAALKGALDGGLDIPHNEKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             GF  DSK  DAEV RKYIYGGHV  YM  + E++PEKY  HF+ Y+K G+E+D++E +Y
Sbjct  181  VGFDPDSKEFDAEVLRKYIYGGHVGEYMEEMQEEDPEKYTAHFAEYLKAGLESDDLEDMY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
             KVH AIRADP+P+   +  P E KR+ + KLTY++R+ KL  +L+ L A 
Sbjct  241  TKVHDAIRADPAPQLKARSKPAESKRWKEVKLTYEQRKDKLKAKLSELMAG  291



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 227/291 (78%), Gaps = 1/291 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K  AY+ R+QVK++RRREGKTDYRAR RL  QDKNKYNTPKYRFVVRFTN D+
Sbjct  1    MPAVKVVKNSAYYSRYQVKYRRRREGKTDYRARLRLTTQDKNKYNTPKYRFVVRFTNSDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI  A++AGD++++SAY++ELP YGL  GLTNYAAAY TGLLLARR+L K  +D+ YE
Sbjct  61   ICQIAYATLAGDVVVSSAYSHELPAYGLTTGLTNYAAAYATGLLLARRVLTKFGLDKAYE  120

Query  468  GNVEATGEDYSVEPG-ESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            GN    GEDY+V+   E  RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHS+KRF
Sbjct  121  GNTGDVGEDYNVDAADEGPRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSDKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+++++K LD+EV RKYI GGHVA YM SL E+EPEKY+ HFS Y+K G+EA+ +E LY
Sbjct  181  VGYSRETKELDSEVLRKYILGGHVAEYMESLKEEEPEKYERHFSRYVKAGLEAEGLEELY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAA  977
              VHAAIRADP  K+ E++ P + K + + KLTY+ R+ KL  +L  L AA
Sbjct  241  TSVHAAIRADPVQKRKERKAPADKKAWKESKLTYEARKEKLKAKLAELTAA  291



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 225/290 (78%), Gaps = 1/290 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K  +Y+ R+QVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPAMKVVKNSSYYSRYQVKYRRRREGKTDYRARLRLVTQDKNKYNTPKYRMVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V Q+  +++AGD+++ASAY++ELP+YGL VGLTNYAAAY TGLLLARR+L K  + + Y 
Sbjct  61   VCQLAYSTLAGDVVVASAYSHELPKYGLTVGLTNYAAAYATGLLLARRVLSKYNLAKAYA  120

Query  468  GNVEATGEDYSVEPGES-RRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            GN E  GEDY+VE  E  +RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHSEKRF
Sbjct  121  GNTEDVGEDYNVEEIEGEKRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G++++SK+LD++V RKYI+GGHV  YM S+ E++ EK++ HFS YIK G+EAD +EALY
Sbjct  181  VGYSRESKSLDSDVLRKYIFGGHVGEYMESMAEEDEEKFKRHFSCYIKAGLEADGLEALY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNA  974
             KVHAAIRA P   K  +  P +   +   K TY+ER+ +L  +L  L A
Sbjct  241  TKVHAAIRASPEAAKKSRSKPAKAGSWKTPKSTYEERKERLKAKLAELMA  290



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  111  AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  290
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  291  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  470
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  471  NVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFAG  650
            NVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG
Sbjct  123  NVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAG  182

Query  651  FTKDSKNLDAEVHRKY  698
            F KD K LDA+ HR+Y
Sbjct  183  FKKDDKQLDADTHRRY  198



>sp|Q4KTI3.1|RL5_SUBDO RecName: Full=60S ribosomal protein L5 [Suberites domuncula]
 gb|AAX48835.1| L5 [Suberites domuncula]
Length=293

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 221/284 (78%), Gaps = 1/284 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKR+QVKF+RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DI
Sbjct  1    MPFVKVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI+ A I GD +L SAYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL  L +  +Y 
Sbjct  61   ICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYA  120

Query  468  GNVEATGEDYSVE-PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  +  GED++VE  G+  RPFRA LDVGL RTTTGNRVF A+KGA+DGG+DIPHS  RF
Sbjct  121  GQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHSPSRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+ ++S  L+A+  R+YI+GGHV+ YM  L E++ EKY+ HFS +IK+GI AD++E +Y
Sbjct  181  VGYDEESSQLEADKLRQYIFGGHVSDYMKYLQEEDEEKYKAHFSRFIKEGITADSMEQMY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            +  HA IRA+P+ +K + +     KR+N+ K++  ++R ++ ++
Sbjct  241  RDAHAKIRANPAHEKKQPRDGLVKKRWNRAKMSLKQKRDRVKQK  284



>gb|AGM32490.1| 60S ribosomal protein L5-like protein, partial [Coptotermes formosanus]
Length=280

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 178/279 (64%), Positives = 213/279 (76%), Gaps = 2/279 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKRFQVKFKRRREGKTDY AR RL  QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKNKQYFKRFQVKFKRRREGKTDYYARLRLTIQDKNKYNTPKYRLIVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V Q+  + I GDMIL +AY++ELPRYG++VGLTNYAAAYCTGLLLARRLL+KL +DQ Y 
Sbjct  61   VCQVAYSRIEGDMILCAAYSHELPRYGIKVGLTNYAAAYCTGLLLARRLLKKLGLDQLYI  120

Query  468  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VE  E     FR  LDVGL+RTTTG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GCTEVTGEEYNVEAVEDGPGAFRCYLDVGLMRTTTGARVFGAMKGAVDGGLNIPHSTKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  ++K  +AEVHRK+I+G HVA YM  L ED+ E Y+  FS YIK GIE D+IE++Y
Sbjct  181  PGYDAETKEFNAEVHRKHIFGQHVADYMRQLAEDDDEAYKRQFSNYIKLGIEPDSIESIY  240

Query  825  KKVHAAIRAD-pspkksekqppkeHKRFNQKKLTYDERR  938
            KK H AIRAD    KK +       KR+N+ KL+  ER+
Sbjct  241  KKAHEAIRADPARIKKQKDTTDIVKKRWNRAKLSLSERK  279



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 216/295 (73%), Gaps = 2/295 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K+  Y  R+QVK++RRREGKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MGHVKVVKSGPYHSRYQVKYRRRREGKTDYRARLRLTTQDKNKYNTPKYRFVVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + Q+  A++AGD+I+ASAY++EL  YGL VGLTNYAA Y TGLLLARR+L K  +   Y 
Sbjct  61   ICQVAYATVAGDVIVASAYSHELVNYGLSVGLTNYAATYATGLLLARRVLTKFGLADAYV  120

Query  468  GNVEATGEDYSVEPG-ESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  EATGEDY+VE   E  RPF ALLD GL RT+TG++VF ALKGALDGGLDIPHS+KRF
Sbjct  121  GQEEATGEDYNVEAAEEGPRPFTALLDTGLKRTSTGSKVFAALKGALDGGLDIPHSDKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G++ + K LD EV RK+IYGGHVA YM  + E+ PEKYQ+HF+ +I+  ++ ++IE LY
Sbjct  181  VGYSGEDKKLDPEVLRKHIYGGHVAEYMEEMQEEAPEKYQSHFAKWIEAEVDPEDIEELY  240

Query  825  KKVHAAIRADp-spkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAGN  986
            K VH  IR +P   KK   +P    K++   KLTY+ER+A L  +L  L     +
Sbjct  241  KGVHEKIRENPIGEKKERSKPETAQKKWKPSKLTYEERKAALKTKLAQLKEGGAD  295



>ref|XP_002434050.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
 gb|EEC05450.1| 60S ribosomal protein L5, putative [Ixodes scapularis]
Length=297

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 216/288 (75%), Gaps = 9/288 (3%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARRRLVVQDKNKYNTPKYRMIVRITNRDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + Q+  A I GD+I+ +AYA+ELPRYG+++GLTNYAAAYCTGLLLARR+LQK ++D+ Y+
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGVKLGLTNYAAAYCTGLLLARRMLQKFKLDEIYK  120

Query  468  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  632
            G  EA GEDY VE     PG     FR  LDVGL RTTTG R+FGALKGA+DGG+DIPHS
Sbjct  121  GQEEANGEDYCVESIDGQPG----AFRCFLDVGLARTTTGARIFGALKGAVDGGMDIPHS  176

Query  633  EKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNI  812
             KRF G+  +SK  +AEVHRK+IYG H+A YM  L +D+ E Y+  FS Y K G+ AD I
Sbjct  177  NKRFPGYDNESKEFNAEVHRKHIYGQHIAEYMKVLLDDDEEAYKRQFSRYNKLGVTADEI  236

Query  813  EALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            E +YKK HAAIR DP+ +    +P    KR+ + K+T  ERR ++ ++
Sbjct  237  EEIYKKAHAAIRKDPAHRAKGVRPGVVKKRWTRMKMTLSERRNRIAQK  284



>ref|XP_005781727.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
 gb|EOD29298.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
Length=304

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 200/249 (80%), Gaps = 0/249 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +K+ KT AY +R+QVK++RRREGKTDY AR RL+ QDKNKY +PKYR VVR TNKD+
Sbjct  1    MGHVKILKTAAYHQRYQVKYRRRREGKTDYLARKRLVVQDKNKYGSPKYRLVVRCTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI+ + I GD+ L +AY++ELP+YG+EVGLTNYAAAY TGLL ARRLLQKL +D++YE
Sbjct  61   ICQIMHSKIVGDVCLCAAYSHELPKYGIEVGLTNYAAAYATGLLCARRLLQKLGLDEQYE  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            GN +  GE + VE  +  RPF  +LDVGLIRTTTG +VFGALKGA+DGGL+IPHS+KRF 
Sbjct  121  GNDDPDGEHFLVEHEDGPRPFTCVLDVGLIRTTTGAKVFGALKGAVDGGLNIPHSDKRFP  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+  D+K LD E H+KYI+GGHVA YM  L E++P++YQT F+ YI+K IEAD++E +Y+
Sbjct  181  GYDPDAKELDGETHKKYIFGGHVAEYMELLEEEDPDRYQTQFANYIEKDIEADSLEEMYQ  240

Query  828  KVHAAIRAD  854
            K H AIR D
Sbjct  241  KAHEAIRED  249



>ref|XP_001634531.1| predicted protein [Nematostella vectensis]
 gb|EDO42468.1| predicted protein [Nematostella vectensis]
Length=296

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 217/293 (74%), Gaps = 2/293 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARKRLITQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  A + GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL KL + + Y 
Sbjct  61   TCQIAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYT  120

Query  468  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E  G++Y+VE  + S   FR  LDVGL RT+TG RVFGALKGA+DGGL+IPHS KRF
Sbjct  121  GTEEVNGDEYNVESIDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  +SK+  AEVHR +I+G HVA YM  L ED+ E ++  FS YIK GIEAD IEA+Y
Sbjct  181  PGYDSESKDFSAEVHRNHIFGQHVANYMRQLAEDDEEAFKRQFSLYIKHGIEADGIEAMY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            KK HAAIR +    K   +     KRF++KK++  +R  ++ ++  A   A G
Sbjct  241  KKAHAAIR-ESPEAKPAAKREVTVKRFHRKKMSRQQRVDRVKQKKAAFLRAQG  292



>emb|CDS19989.1| ribosomal protein l5 [Echinococcus granulosus]
Length=299

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 212/280 (76%), Gaps = 1/280 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G  E  GE+Y VE  E R  F+  LDVGL RT++G  +FGALKGA+DGGL+IPHS KRF 
Sbjct  121  GQTEVNGENYLVESKEKRGAFKCFLDVGLRRTSSGANIFGALKGAVDGGLNIPHSSKRFP  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G   +S   +AE HR  I+G H+A YM SL E+  E Y+  F  Y+K GIEAD+IE +Y+
Sbjct  181  GNDPESGEYNAEAHRARIFGQHIAEYMRSLKEESEEAYRRQFGAYLKLGIEADDIEPMYQ  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKL  947
            K HAAIR D      +++   +H+RFN+KKLT   RR ++
Sbjct  241  KAHAAIRED-PSYTKKERAEVKHRRFNRKKLTLKARRERV  279



>ref|XP_004533872.1| PREDICTED: 60S ribosomal protein L5-like [Ceratitis capitata]
Length=298

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 218/283 (77%), Gaps = 1/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKR+QVKF+RRREGKTDY AR RLI QDKNKYNTPKYR +VR +NKDI
Sbjct  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  A I GD ++ +AY++ELP+YG++VGLTNYAAAYCTGLL+ARR+L KL +D  Y 
Sbjct  61   TVQIAYARIEGDRVVCAAYSHELPKYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VEP  E    FR  LDVGL RTTTG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GCTEVTGEEYNVEPVDEGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G++ ++K+ +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI AD++E +Y
Sbjct  181  PGYSAEAKSFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLETIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIE  953
            KK H +IRADP+ KK E++     KR+N KKLT ++R+ K+ E
Sbjct  241  KKAHQSIRADPTHKKKEQKSGGVKKRWNAKKLTNEQRKVKVAE  283



>emb|CDI98331.1| ribosomal protein l5 [Echinococcus multilocularis]
Length=299

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 212/280 (76%), Gaps = 1/280 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G  E  GE+Y VE  E R  F+  LDVGL RT++G  +FGALKGA+DGGL+IPHS KRF 
Sbjct  121  GQTEVNGENYLVESKEKRGAFKCFLDVGLRRTSSGANIFGALKGAVDGGLNIPHSSKRFP  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G   +S   +AE HR  I+G H+A YM SL E+  E Y+  F  Y+K GIEAD+IE +Y+
Sbjct  181  GNDPESGEYNAEAHRARIFGQHIAEYMRSLKEESEEAYRRQFGTYLKLGIEADDIEPMYQ  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKL  947
            K HAAIR D      +++   +H+RFN+KKLT   RR ++
Sbjct  241  KAHAAIRED-PSYTKKERAEVKHRRFNRKKLTLKARRERV  279



>gb|EFX90266.1| hypothetical protein DAPPUDRAFT_299917 [Daphnia pulex]
Length=302

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 222/301 (74%), Gaps = 14/301 (5%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M FIKV K +AYFKRFQVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFIKVIKNKAYFKRFQVKFRRRREGKTDYYARRRLVVQDKNKYNTPKYRMIVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  A I GD+I+ +AY++ELP YG++VGLTNYAAAYCTGLLLARRLL+K ++D  Y+
Sbjct  61   CCQIAYARIEGDVIVCAAYSHELPHYGVKVGLTNYAAAYCTGLLLARRLLKKFKLDTIYQ  120

Query  468  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  632
            G  E TG  ++VE     PG     FRA LDVGL RTTTG R+FGA+KGA+DGG+D+PHS
Sbjct  121  GCTEVTGGVFNVEDVDDGPG----AFRACLDVGLARTTTGARIFGAMKGAVDGGIDVPHS  176

Query  633  EKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNI  812
             KRF G+  +SK+ +AEVHRK+I G HVA YM  L +++ E Y+  FS +IK G+ AD I
Sbjct  177  TKRFPGYDSESKDFNAEVHRKHIMGAHVADYMRQLVDEDEEAYKKQFSQFIKHGLVADTI  236

Query  813  EALYKKVHAAIRAD-pspkksekqppkeHKRFNQKKLTYDERRAKLI----ERLNALNAA  977
            E +YKK H AIRAD    K S+     + KR+N K+LT +ER+A++     E L+ L A+
Sbjct  237  ETMYKKAHEAIRADPEKQKSSKDPSKIKKKRWNAKRLTLEERKARVAAKKKEFLSKLEAS  296

Query  978  A  980
            A
Sbjct  297  A  297



>ref|XP_005107604.1| PREDICTED: 60S ribosomal protein L5-like [Aplysia californica]
Length=294

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 219/291 (75%), Gaps = 10/291 (3%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K++AYFKRFQVKFKRRREG TDY AR RLI QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKSKAYFKRFQVKFKRRREGVTDYYARKRLIFQDKNKYNTPKYRLIVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V QI  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL+K  +DQ YE
Sbjct  61   VCQIAYARIEGDVIVCAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLKKFGLDQTYE  120

Query  468  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  632
            G VE  GE++ VE     PG     FRA LDVGL RTTTG RVFGALKGA DGG+DIPHS
Sbjct  121  GQVEPDGEEFCVEDVDGAPG----AFRAYLDVGLARTTTGARVFGALKGAADGGIDIPHS  176

Query  633  EKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNI  812
             +RF G+  +SK  +A+VHR +I G HV+ YM  L E++ E Y+  FS +IK  I A  +
Sbjct  177  NRRFPGYDAESKKFNAQVHRDHIMGKHVSDYMTYLQENDEEAYKRQFSQFIKNSIAAGKV  236

Query  813  EALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNA  965
            E +YKK HAAIRADP  K   K+   + KR+N+KKL+  +R+A+++++  A
Sbjct  237  EEMYKKAHAAIRADPESKPPGKKEVVK-KRWNRKKLSNAQRKARVVQKKEA  286



>gb|EPZ34992.1| 60S ribosomal protein L5 [Rozella allomycis CSF55]
Length=297

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 195/250 (78%), Gaps = 1/250 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+K  K +AYFKRFQ K++RRREGKTDY AR RLI QDKNKYN+PKYR VVRFTNKDI
Sbjct  1    MPFVKEIKNKAYFKRFQTKYRRRREGKTDYYARKRLIIQDKNKYNSPKYRMVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + Q+V A I GD+++ASAYA+ELPRYG++VGLTNYAAAYC GLLLARR+L K  +  +YE
Sbjct  61   ICQMVYARIQGDVVIASAYAHELPRYGVQVGLTNYAAAYCVGLLLARRVLTKFNLASKYE  120

Query  468  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  EA GE ++VE  E   RPF+A LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF
Sbjct  121  GQTEADGEIFNVEAIEDGPRPFKAYLDVGLRRTSTGARVFGAMKGAADGGIFIPHSEKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+   SK LDAE  R YIYGGHV+ YM  L E++ E+Y+  FS YI+ GIEAD +E +Y
Sbjct  181  PGYDSSSKTLDAETLRNYIYGGHVSEYMEYLQEEDEERYKIQFSKYIELGIEADAVEEMY  240

Query  825  KKVHAAIRAD  854
            +  H AIRAD
Sbjct  241  QNAHEAIRAD  250



>sp|Q627R7.2|RL5_CAEBR RecName: Full=60S ribosomal protein L5 [Caenorhabditis briggsae]
 emb|CAP22065.2| Protein CBR-RPL-5 [Caenorhabditis briggsae]
Length=294

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 212/283 (75%), Gaps = 2/283 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF ++SK+ +AE HR  I G HVA YM+ L E++ ++Y+  FS ++  G+ ADN+ A Y+
Sbjct  181  GFDQESKDYNAEAHRDRILGKHVADYMSLLKEEDEDRYKRQFSKFLSNGMNADNLVATYQ  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            K HA IRADPSP   +   P   KR   K+LTYDER+ ++ ++
Sbjct  241  KAHANIRADPSPSAKKAAKPS--KRHTAKRLTYDERKQRVADK  281



>ref|XP_002109848.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV28014.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=297

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 213/293 (73%), Gaps = 2/293 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKRFQVK+KRRREGKTDY AR RL  QDKNKYN+PKYR VVR TNKD+
Sbjct  1    MTFVKVVKNKAYFKRFQVKYKRRREGKTDYFARKRLCTQDKNKYNSPKYRMVVRLTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI  A + GD I  +AY++ELPRYG++VGLTNYAA YCTGLLLARR+L KL +  +Y 
Sbjct  61   ICQIACAKLEGDEIFCAAYSHELPRYGIKVGLTNYAACYCTGLLLARRVLTKLNLADKYV  120

Query  468  GNVEATGEDYSV-EPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E  GED+ V EP E  R FR  LDVGL RTTTG R+FG LKGA+DGGL+IPH  KRF
Sbjct  121  GVEEPDGEDFEVEEPDEGARAFRCFLDVGLARTTTGARIFGTLKGAVDGGLNIPHQHKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  +SK+ DA VHR  I+G HVA YM  L  ++ E Y++ FS +IK GI AD++E +Y
Sbjct  181  PGYDNESKSYDAGVHRDRIFGCHVADYMRQLQGEDEEAYRSQFSRFIKNGITADSVEEMY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            K  H+AIRA+     ++K+    HKRFN+KKLT ++R+ ++ ++  A   + G
Sbjct  241  KSAHSAIRAN-PAPLAKKEKKVAHKRFNEKKLTLEQRKERVAQKKAAFLQSLG  292



>gb|ETN75275.1| ribosomal L18p/L5e family protein [Necator americanus]
Length=305

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 211/283 (75%), Gaps = 0/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK KRRR+GKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  9    MGLVKVVKNKAYFKRYQVKLKRRRQGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  68

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI  + I GD+I+ASAY++ELP +G++VGLTNYAA Y TGLLLARR L+ L++D+ ++
Sbjct  69   IAQIAYSKIEGDVIVASAYSHELPAFGIKVGLTNYAAGYATGLLLARRHLKNLQLDKTFK  128

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G  E  GE Y+VE  + R PF+A+LDVGL RTTTG +VF  +KG  DGG+D+PHSE RF 
Sbjct  129  GQEEVNGEFYTVEEEDGRAPFKAVLDVGLARTTTGCKVFAVMKGVADGGIDVPHSENRFF  188

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+  +SK  DAE HR  I+G HVA YM SL E++ + Y+  FS +I +G+ ADN+E +YK
Sbjct  189  GYDSESKKYDAEAHRDRIFGKHVAEYMRSLKEEDEDAYKRQFSHFIAEGVTADNLEEMYK  248

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            K H AIRA+P  +    +   E KR+N KK+T ++RR ++ E+
Sbjct  249  KGHEAIRANPDRRTKPSKKQGEKKRWNAKKITLEQRRERVEEK  291



>ref|XP_011197235.1| PREDICTED: 60S ribosomal protein L5 [Bactrocera dorsalis]
Length=298

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 216/283 (76%), Gaps = 1/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKR+QVKF+RRREGKTDY AR RLI QDKNKYNTPKYR +VR +NKDI
Sbjct  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  A I GD ++ +AY++ELP YG++VGLTNYAAAYCTGLL+ARR+L KL +D  Y 
Sbjct  61   TVQIAYARIEGDRVVCAAYSHELPNYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VEP  +    FR  LDVGL RTTTG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  ++KN +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI AD++E +Y
Sbjct  181  PGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLETIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIE  953
            KK H AIR+DP+ KK +++     KR+N KKLT ++R+ K+ E
Sbjct  241  KKAHQAIRSDPTHKKKDQKSGVVKKRWNAKKLTNEQRKVKVAE  283



>ref|XP_002630158.1| C. briggsae CBR-RPL-5 protein [Caenorhabditis briggsae]
Length=297

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 212/283 (75%), Gaps = 2/283 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  4    MGLVKVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  63

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  64   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  123

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  124  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  183

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF ++SK+ +AE HR  I G HVA YM+ L E++ ++Y+  FS ++  G+ ADN+ A Y+
Sbjct  184  GFDQESKDYNAEAHRDRILGKHVADYMSLLKEEDEDRYKRQFSKFLSNGMNADNLVATYQ  243

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            K HA IRADPSP   +   P   KR   K+LTYDER+ ++ ++
Sbjct  244  KAHANIRADPSPSAKKAAKPS--KRHTAKRLTYDERKQRVADK  284



>ref|XP_011191002.1| PREDICTED: 60S ribosomal protein L5 [Bactrocera cucurbitae]
Length=298

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 168/283 (59%), Positives = 217/283 (77%), Gaps = 1/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKR+QVKF+RRREGKTDY AR RLI QDKNKYNTPKYR +VR +NKDI
Sbjct  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  A I GD ++ +AY++ELP+YG++VGLTNYAAAYCTGLL+ARR+L KL +D  Y 
Sbjct  61   TVQIAYARIEGDRVVCAAYSHELPKYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VEP  +    FR  LDVGL RTTTG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  ++KN +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI AD++E +Y
Sbjct  181  PGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLETIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIE  953
            KK H +IR+DP+ KK +++     KR+N KKLT ++R+ K+ E
Sbjct  241  KKAHQSIRSDPTHKKKDQKSGGVKKRWNAKKLTNEQRKVKVAE  283



>gb|ADQ73874.1| 60S ribosomal protein L5 [Laodelphax striatella]
Length=299

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 169/288 (59%), Positives = 217/288 (75%), Gaps = 1/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKR+QVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VR +NKDI
Sbjct  1    MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLIVQDKNKYNTPKYRLIVRLSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              QI  + I GD I+ +AY++ELP+YG++VGLTNYA+AYCTGLL+ARRLL+KL +DQ Y 
Sbjct  61   TCQIAYSRIEGDKIVCAAYSHELPKYGVKVGLTNYASAYCTGLLIARRLLKKLGLDQLYA  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VE   E    F+  LDVGL++T+TG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GTTEVTGEEYNVEALDEGPGAFKCFLDVGLMKTSTGARVFGAMKGAVDGGLNIPHSVKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             GF  +SKN +A+VHRK+I+G HV+ YM  L E++ E Y+  FS +IK G++ + IE +Y
Sbjct  181  PGFDGESKNFNADVHRKHIFGLHVSEYMQQLAENDDEAYKKQFSQFIKLGVQPEAIEGIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
            KK H AIRADP  K  ++  P   +R+N+KKLT  ERR  + ++  A 
Sbjct  241  KKAHEAIRADPVLKAKQRAKPPVKRRWNRKKLTLSERRNTIAQKKAAF  288



>gb|ACZ13335.1| 60S ribosomal protein L5 [Bursaphelenchus xylophilus]
Length=297

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 212/281 (75%), Gaps = 2/281 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K RAYFKRFQ K KRRREGKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNRAYFKRFQTKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI  + I GD++++SAYA+ELPRYG++VGLTNYAAAY TGLLLARR L+ +++D  Y+
Sbjct  61   IAQIAYSKIGGDVVVSSAYAHELPRYGIKVGLTNYAAAYATGLLLARRHLKSIKLDTLYK  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E  GEDY+VE  G++  PF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE RF
Sbjct  121  GTEEVNGEDYNVEQEGDNPNPFQAVLDVGLARTTTGAKVFAVMKGVADGGINVPHSESRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  +SK  +AE HR  I+G HVA YM  L +D+ + Y+  FS +IK GI  D++E +Y
Sbjct  181  YGYDPESKEYNAEAHRDRIFGKHVAEYMKQLKDDDEDAYKRQFSQFIKAGISPDSLEGIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKL  947
            KK H AIRA+  P+  + +  ++ KR+  KKLT+++R+A++
Sbjct  241  KKAHDAIRANSEPEAKKGEEVEK-KRWTAKKLTHEQRKARV  280



>gb|EYB99479.1| hypothetical protein Y032_0122g1070 [Ancylostoma ceylanicum]
Length=297

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 210/283 (74%), Gaps = 0/283 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK KRRR+GKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNKAYFKRYQVKLKRRRQGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI  + I GD+I+ASAY++ELP +G++VGLTNYAA Y TGLLLARR L+ L++DQ ++
Sbjct  61   IAQIAYSKIEGDVIVASAYSHELPAFGIKVGLTNYAAGYATGLLLARRHLKNLKLDQTFK  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G  +  GE Y+VE  + R PF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE RF 
Sbjct  121  GQEDVNGEFYTVEEEDGRSPFKAVLDVGLARTTTGCKVFAVMKGVADGGIEVPHSENRFF  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+  +SK  DAE HR  I+G HVA YM SL +++ + Y+  FS +I  GI ADN+E +YK
Sbjct  181  GYDSESKKYDAEAHRDRIFGKHVAEYMRSLKDEDEDAYKRQFSHFIANGISADNLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            K H AIRA+P  +    +   E KR+N KK+T ++RR ++ E+
Sbjct  241  KGHEAIRANPDRRTKPSKKQGEKKRWNAKKITLEKRRERVEEK  283



>gb|KJH44233.1| ribosomal L18p/L5e family protein [Dictyocaulus viviparus]
Length=297

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 211/287 (74%), Gaps = 0/287 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKRFQVK KRRR+GKTDY AR RL  QDKNKYNTPKYR +VRFTNKD+
Sbjct  1    MGLVKVVKNKAYFKRFQVKLKRRRQGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            +AQI  + I GD+I+ASAY++ELP YG++VGLTNYAAAY TGLLLARR L+ L++D+ ++
Sbjct  61   IAQIAYSKIEGDVIVASAYSHELPSYGIKVGLTNYAAAYATGLLLARRHLKNLKLDKTFK  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G  E +GE Y+VE  + RRPF+A+LDVGL RTTTG +VF  +KG  DGG+++PHSE RF 
Sbjct  121  GLDEVSGEFYTVEDEKGRRPFKAVLDVGLARTTTGCKVFAVMKGVADGGINVPHSENRFF  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            G+  +SK  DA+ HR  I G HVA YM SL  D  E Y+  FS +I  G+ AD++E +YK
Sbjct  181  GYDVESKKYDAQAHRDRILGKHVAEYMRSLWNDNIEGYKRQFSKFIACGVTADSLEEMYK  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
              HAAIRA+P  +    +   E KRF  KK+T ++R+ ++ ++ N L
Sbjct  241  SAHAAIRANPERQPKPAKKYGEQKRFTAKKITLEQRKKRIQQKKNLL  287



>ref|NP_495811.1| Protein RPL-5 [Caenorhabditis elegans]
 sp|P49405.1|RL5_CAEEL RecName: Full=60S ribosomal protein L5 [Caenorhabditis elegans]
 emb|CAA90251.1| RPL-5 [Caenorhabditis elegans]
Length=293

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 212/283 (75%), Gaps = 2/283 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQ+  + I GD+++ASAY++ELPRYGL+VGLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYK  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF ++SK  +AE HR  I G HVA YM  L E++ ++Y+  FS ++  G+ ADN+ A Y+
Sbjct  181  GFDQESKEYNAEAHRDRILGKHVADYMTYLKEEDEDRYKRQFSKFLAAGLNADNLVATYQ  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KVH+AIRAD SP   +   P   KR   K+LTYDER+ ++ ++
Sbjct  241  KVHSAIRADASPAAKKAAKPS--KRHTAKRLTYDERKQRVADK  281



>gb|KDO24705.1| hypothetical protein SPRG_10239 [Saprolegnia parasitica CBS 223.65]
Length=299

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/259 (62%), Positives = 194/259 (75%), Gaps = 10/259 (4%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            MAF+KV K++AYFKR+Q K++RRREGKTDYRAR RLI QDKNKYN+PKYR VVR TNK +
Sbjct  1    MAFVKVNKSKAYFKRYQTKYRRRREGKTDYRARKRLITQDKNKYNSPKYRLVVRITNKRV  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI  A I GD ILASAY++EL RYGL+ G  NY AAYCTGLL+ RRLL KL +D +YE
Sbjct  61   ICQIAYAEIDGDKILASAYSDELKRYGLKCGFKNYPAAYCTGLLVGRRLLNKLGLDGDYE  120

Query  468  GNVEATGED----------YSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggl  617
            GN E  GE           Y  E  + +RPFRA LDVGL  T+TGNRVFGALKGA D GL
Sbjct  121  GNTEVDGEVVKTEANGRTYYVAEVADEKRPFRAFLDVGLRSTSTGNRVFGALKGATDAGL  180

Query  618  dIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGI  797
            DIPHSEKRF G+ +D+K+ DAEVH++ I+G H++ +M  L ED+PE YQ HF+ YIK GI
Sbjct  181  DIPHSEKRFPGYDRDAKSYDAEVHKERIFGDHISNHMKELEEDDPEMYQKHFADYIKAGI  240

Query  798  EADNIEALYKKVHAAIRAD  854
             +D++E LY  VH AIR D
Sbjct  241  TSDDMEDLYASVHEAIRED  259



>ref|XP_003856228.1| 60S ribosomal protein L5 [Zymoseptoria tritici IPO323]
 gb|EGP91204.1| hypothetical protein MYCGRDRAFT_102365 [Zymoseptoria tritici 
IPO323]
 gb|KJY01408.1| 60s ribosomal protein l5 [Zymoseptoria brevis]
Length=300

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 214/300 (71%), Gaps = 11/300 (4%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F K+ K  AYF R+QVK+ RRR GKTDY AR RLI Q KNKYN PKYR VVRFTNKDI
Sbjct  1    MPFTKLVKNSAYFSRYQVKYARRRAGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QIV++ + GD + ++AYA+EL  YG+  GLTN+AAAYCTGLLLARR L KL++D+ +E
Sbjct  61   ICQIVTSELTGDKVFSAAYAHELKAYGITHGLTNWAAAYCTGLLLARRTLAKLKLDETFE  120

Query  468  GNVEATGEDYSVEP----GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSE  635
            G  EA GE    EP    GE+RRPF+A LDVGL RT+TG RVFGA+KGA DGGL IPHSE
Sbjct  121  GVEEADGEFTITEPADVDGETRRPFKAFLDVGLARTSTGARVFGAMKGASDGGLYIPHSE  180

Query  636  KRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIE  815
            KRF GF  ++K LDAE  RKYI+GGHVA YM +L +D+ E+Y++ F+GYI   IEAD +E
Sbjct  181  KRFPGFDIETKELDAETLRKYIFGGHVAEYMETLADDDEERYKSQFNGYIDDEIEADGLE  240

Query  816  ALYKKVHAAIRADpspkksekqppkeHK-------RFNQKKLTYDERRAKLIERLNALNA  974
             LY+  H  IR DP  K   +   K  +       ++ QKKLT+ +R+ ++ E++ AL +
Sbjct  241  ELYQDAHKQIREDPFKKAEGEGEKKTKEQWKAESLKYKQKKLTHAQRQERVQEKIKALTS  300



>gb|EGT59634.1| hypothetical protein CAEBREN_19650 [Caenorhabditis brenneri]
Length=293

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 209/283 (74%), Gaps = 2/283 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M  +KV K +AYFKR+QVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI
Sbjct  1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            VAQ+  + I GD+++ASAYA+ELPRYGL+ GLTNYAAAY TGLLLARR L+ + +D  Y+
Sbjct  61   VAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYK  120

Query  468  GNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRFA  647
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F  +KG  DGG+++PHSE RF 
Sbjct  121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF  180

Query  648  GFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYK  827
            GF ++SK  +AE HR  I G HVA YM  L E++ ++Y+  FS +I  G+ ADN+   Y+
Sbjct  181  GFDQESKEYNAEAHRDRILGKHVADYMAYLKEEDEDRYKRQFSKFITAGLNADNLVGTYQ  240

Query  828  KVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KVH+ IRADPSP   +   P   KR   KKLTYDER+  + ++
Sbjct  241  KVHSNIRADPSPSAKKAAKPS--KRHTAKKLTYDERKQAVADK  281



>gb|KDR11979.1| 60S ribosomal protein L5 [Zootermopsis nevadensis]
Length=300

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 177/285 (62%), Positives = 215/285 (75%), Gaps = 2/285 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + YFKRFQVKFKRRREGKTDY AR RL  QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKNKQYFKRFQVKFKRRREGKTDYYARLRLTIQDKNKYNTPKYRLIVRFSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              Q+  + I GDMIL SAY++ELPRYG++VGLTNYAAAYCTGLLLARRLL+KL +D+ Y 
Sbjct  61   TCQVAYSRIEGDMILCSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLKKLGLDKLYL  120

Query  468  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TGE+Y+VE  E     FR  LDVGL+RTTTG RVFGA+KGA+DGGL+IPHS KRF
Sbjct  121  GCTEVTGEEYNVEAVEDGPAAFRCYLDVGLMRTTTGARVFGAMKGAVDGGLNIPHSTKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  ++K  +AEVHRK+I G HVA YM  L E++ E Y+  FS YIK GIEADNIE++Y
Sbjct  181  PGYDPETKEFNAEVHRKHILGQHVAEYMRQLAENDDEAYKRQFSNYIKLGIEADNIESIY  240

Query  825  KKVHAAIRAD-pspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            KK H  IRAD    KK +       KR+N+ KL+  ER+ ++ ++
Sbjct  241  KKAHETIRADPARVKKQKDTSGIVKKRWNRAKLSLSERKNRIAQK  285



>dbj|BAN20290.1| ribosomal protein L5 [Riptortus pedestris]
Length=299

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 213/288 (74%), Gaps = 1/288 (0%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K + Y+KRFQVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VR +NKDI
Sbjct  1    MGFVKVVKNKQYYKRFQVKFKRRREGKTDYYARKRLIVQDKNKYNTPKYRLIVRLSNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
              Q+  + I GD I+ +AY++ELP YG++VGLTNYAAAYCTGLLLARRLLQKL++D  YE
Sbjct  61   TCQVAYSRIEGDKIVCAAYSHELPAYGIKVGLTNYAAAYCTGLLLARRLLQKLKLDSLYE  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E TG++Y+VE   E    FR  LDVGL++T+ G RVFGALKGA+DGGL+IPHS KRF
Sbjct  121  GTTEVTGDEYNVENLDEGPGAFRCYLDVGLMKTSAGARVFGALKGAVDGGLNIPHSMKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  +SK  +AEVHRK+I+G HVA YM  L E + + Y+  FS YIK GI AD +E +Y
Sbjct  181  PGYDSESKEFNAEVHRKHIFGVHVADYMRQLAESDDDAYKKQFSQYIKNGITADQVEEIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNAL  968
            KK HAAIRADPS K   K      KR+N+ KLT  ER+  + ++  A 
Sbjct  241  KKAHAAIRADPSKKAPAKTKTPVKKRWNRAKLTLAERKNSIAQKKAAF  288



>emb|CCQ18634.1| 60S ribosomal protein L5 [Sycon ciliatum]
Length=296

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 222/285 (78%), Gaps = 2/285 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K R YFKRFQVK++RRREGKTDY AR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPFVKVVKDRQYFKRFQVKYRRRREGKTDYYARKRLCVQDKNKYNTPKYRLVVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V Q+  A + GD+IL+SAY++ELPRYG++VGLTNYAAAYCTGLLLARR+L KL++ + Y+
Sbjct  61   VTQVAYARLQGDIILSSAYSHELPRYGIQVGLTNYAAAYCTGLLLARRVLTKLDLAKHYD  120

Query  468  GNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  E  G++Y+V+    +   FR  LD+GL RTTTG R+FGALKGA+DGGL+IPH+ KRF
Sbjct  121  GQTEVDGDEYAVDDVAGAPSAFRCFLDIGLARTTTGARIFGALKGAVDGGLNIPHNCKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             GF  +SK  +AEVHR++I+G HV+ YM +L E++ + +Q  FSG++K G+ AD +E +Y
Sbjct  181  PGFDGESKEFNAEVHREHIFGQHVSNYMKTLQEEDQDAFQRQFSGFVKAGVTADGLEGMY  240

Query  825  KKVHAAIRADpspkksekqppkeH-KRFNQKKLTYDERRAKLIER  956
             K HAAIRADPSPK  ++QP  +  KRF +KKL+ ++R  ++ ++
Sbjct  241  TKAHAAIRADPSPKAKKEQPADKKPKRFGRKKLSREQRANRVAQK  285



>gb|KGG50093.1| 60S ribosomal protein L5-2 [Mitosporidium daphniae]
Length=329

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 169/292 (58%), Positives = 221/292 (76%), Gaps = 6/292 (2%)
 Frame = +3

Query  102  APMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  281
            A M F+K+ K +AYFKRFQVK++RRREGKTDY AR RL+ Q KNKYNTPKYR VVR TN 
Sbjct  29   ASMPFVKLVKNKAYFKRFQVKYRRRREGKTDYYARKRLVVQAKNKYNTPKYRLVVRITNT  88

Query  282  DIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQE  461
            DIV QI+ A I GD++ ASAYA+ELPRYG++VGLTN+A+AYCTGLL ARR L KL +D +
Sbjct  89   DIVCQIMYARIQGDIVFASAYAHELPRYGVKVGLTNFASAYCTGLLCARRALAKLGLDSK  148

Query  462  YEGNVEATGEDY---SVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  632
            YEG  +A GE +   S+E  +S RPF+A LDVGL RTTTG+R+FGALKGA+DGG+ +PHS
Sbjct  149  YEGKAKADGEYFLVDSIEGDDSPRPFKAFLDVGLSRTTTGSRIFGALKGAVDGGIYVPHS  208

Query  633  EKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNI  812
            ++RF G++ ++K +D  V RKYI+G HVA YM  L ED+ E Y+  FS YIK G+ AD I
Sbjct  209  DRRFPGYSTETKKVDTNVLRKYIFGQHVADYMTLLKEDDHESYEKQFSKYIKNGVTADAI  268

Query  813  EALYKKVHAAIRADpspkksekqppkeHKR---FNQKKLTYDERRAKLIERL  959
            + +Y K H  IR DPS K S+K+  +  +R   F +++LTY+ER+A + +++
Sbjct  269  KGIYAKAHELIRKDPSFKPSQKKVSEMAERSKSFKKQRLTYEERKANIAKKI  320



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  450  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPH  629
            MD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPH
Sbjct  1    MDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPH  60

Query  630  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  809
            SEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN
Sbjct  61   SEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADN  120

Query  810  IEALYKKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            +E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  121  LEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_001639289.1| predicted protein [Nematostella vectensis]
 gb|EDO47226.1| predicted protein [Nematostella vectensis]
Length=296

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 221/293 (75%), Gaps = 2/293 (1%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKRFQVKFKRRREGKTDY AR RLI QDKNKYNTPKYRFVVR TNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARKRLITQDKNKYNTPKYRFVVRITNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            + QI  A + GD +LASAYA+ELP +G++VGLTNYAAAYCTGLLLARRLL  L + + Y 
Sbjct  61   ICQIAYAKLDGDRVLASAYAHELPNFGVKVGLTNYAAAYCTGLLLARRLLTMLNLHEIYT  120

Query  468  GNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHSEKRF  644
            G  +  G++Y+VE  + S   FR  LDVGL RT+TG RVFGALKGA+DGGL+IPHS KRF
Sbjct  121  GTDDVNGDEYNVESVDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMKRF  180

Query  645  AGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALY  824
             G+  +SK+  AEVHR +I+G HVA YM SL E++ E Y+  FS YIK G++AD+IE +Y
Sbjct  181  PGYDSESKDFSAEVHRNHIFGKHVAEYMRSLAEEDEESYKRQFSAYIKNGVDADSIEGIY  240

Query  825  KKVHAAIRADpspkksekqppkeHKRFNQKKLTYDERRAKLIERLNALNAAAG  983
            K  H AIRADP  KK+EK+  +  KRF++KK++  +R  ++ ++  A   A G
Sbjct  241  KAAHQAIRADPVHKKAEKKDVQL-KRFHRKKMSRQQRVDRVKQKKAAFLRAQG  292



>emb|CBN08634.1| small nucleolar RNA, C/D box 21 [Microcosmus squamiger]
Length=297

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 173/289 (60%), Positives = 219/289 (76%), Gaps = 10/289 (3%)
 Frame = +3

Query  108  MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  287
            M F+KV K +AYFKR+QVK+KRRR+G TDY AR RL+ QDKNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRYQVKYKRRRQGITDYYARKRLVVQDKNKYNTPKYRMIVRFTNKDI  60

Query  288  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  467
            V QI  A I GD+ + +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL K  +D+ YE
Sbjct  61   VCQIAYARIEGDVTVCAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKIYE  120

Query  468  GNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldggldIPHS  632
            G  E  G++Y VE     PG     FRA LDVGL RTTTG R+FGA+KGA DGGLDIPHS
Sbjct  121  GQKEVDGDEYYVEDIDGQPG----AFRAFLDVGLARTTTGARIFGAMKGAADGGLDIPHS  176

Query  633  EKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNI  812
             KRF G+  +S N +AE HR +I+GGHV+ YM +L E++ ++Y+  FS YIK GI AD++
Sbjct  177  TKRFPGYDSESGNFNAEFHRSHIFGGHVSDYMKNLEEEDEDQYKRQFSQYIKHGITADSL  236

Query  813  EALYKKVHAAIRAD-pspkksekqppkeHKRFNQKKLTYDERRAKLIER  956
            EA+Y K H AIRAD    KK E++   + KR+N+KK+T+ +RR ++ ++
Sbjct  237  EAMYTKCHEAIRADPTPKKKEEEKKVGKAKRWNRKKMTFAQRRDRVRQK  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3659574876594