BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4448

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593905.1|  PREDICTED: eukaryotic initiation factor 4A-9...    383   8e-132   Nicotiana tomentosiformis
ref|XP_002324737.1|  translation initiation factor eIF-4A family ...    389   5e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011019413.1|  PREDICTED: eukaryotic initiation factor 4A-9...    389   8e-131   Populus euphratica
ref|XP_010929386.1|  PREDICTED: eukaryotic initiation factor 4A-2       387   2e-130   Elaeis guineensis
ref|XP_010927213.1|  PREDICTED: eukaryotic initiation factor 4A-2...    387   2e-130   Elaeis guineensis
ref|XP_009757031.1|  PREDICTED: eukaryotic initiation factor 4A-9       387   2e-130   Nicotiana sylvestris
gb|ABK93239.1|  unknown                                                 387   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_002308545.1|  translation initiation factor eIF-4A family ...    387   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_011081667.1|  PREDICTED: eukaryotic initiation factor 4A-2       387   3e-130   Sesamum indicum [beniseed]
ref|XP_010925445.1|  PREDICTED: eukaryotic initiation factor 4A-8...    387   3e-130   Elaeis guineensis
ref|XP_011038130.1|  PREDICTED: eukaryotic initiation factor 4A-15      387   3e-130   Populus euphratica
ref|XP_011100200.1|  PREDICTED: eukaryotic initiation factor 4A-14      387   4e-130   Sesamum indicum [beniseed]
ref|XP_008798133.1|  PREDICTED: eukaryotic initiation factor 4A-14      387   4e-130   Phoenix dactylifera
ref|XP_003533770.1|  PREDICTED: eukaryotic initiation factor 4A-1...    386   6e-130   
ref|XP_006597014.1|  PREDICTED: uncharacterized protein LOC100786...    388   7e-130   
gb|KHN28839.1|  Eukaryotic initiation factor 4A-15                      386   7e-130   Glycine soja [wild soybean]
ref|XP_010242273.1|  PREDICTED: eukaryotic initiation factor 4A-11      385   1e-129   Nelumbo nucifera [Indian lotus]
ref|XP_010929385.1|  PREDICTED: eukaryotic initiation factor 4A-15      385   2e-129   Elaeis guineensis
ref|XP_010915249.1|  PREDICTED: eukaryotic initiation factor 4A-8...    385   2e-129   Elaeis guineensis
ref|XP_008782542.1|  PREDICTED: eukaryotic initiation factor 4A-1...    385   2e-129   Phoenix dactylifera
ref|NP_001242064.1|  uncharacterized protein LOC100786735               385   2e-129   Glycine max [soybeans]
sp|Q40471.1|IF4A9_TOBAC  RecName: Full=Eukaryotic initiation fact...    384   3e-129   Nicotiana tabacum [American tobacco]
ref|XP_002521376.1|  dead box ATP-dependent RNA helicase, putative      384   4e-129   Ricinus communis
ref|XP_008220506.1|  PREDICTED: eukaryotic initiation factor 4A-1...    384   7e-129   Prunus mume [ume]
ref|XP_008801403.1|  PREDICTED: eukaryotic initiation factor 4A-15      383   8e-129   Phoenix dactylifera
sp|Q40466.1|IF413_TOBAC  RecName: Full=Eukaryotic initiation fact...    381   9e-129   Nicotiana tabacum [American tobacco]
emb|CBI27885.3|  unnamed protein product                                383   1e-128   Vitis vinifera
ref|XP_004245077.1|  PREDICTED: eukaryotic initiation factor 4A-2       383   1e-128   Solanum lycopersicum
ref|XP_010094955.1|  Eukaryotic initiation factor 4A-13                 376   2e-128   Morus notabilis
emb|CAN70196.1|  hypothetical protein VITISV_040309                     382   2e-128   Vitis vinifera
ref|XP_007222702.1|  hypothetical protein PRUPE_ppa006409mg             382   3e-128   Prunus persica
gb|KDP33852.1|  hypothetical protein JCGZ_07423                         382   3e-128   Jatropha curcas
ref|XP_006342504.1|  PREDICTED: eukaryotic initiation factor 4A-2...    382   4e-128   Solanum tuberosum [potatoes]
emb|CDP08290.1|  unnamed protein product                                382   4e-128   Coffea canephora [robusta coffee]
gb|AFC90091.1|  eukaryotic initiation factor 4A-14                      382   4e-128   Nicotiana benthamiana
ref|XP_009764703.1|  PREDICTED: eukaryotic initiation factor 4A-1...    381   4e-128   Nicotiana sylvestris
ref|XP_008798130.1|  PREDICTED: eukaryotic initiation factor 4A-8...    381   5e-128   Phoenix dactylifera
ref|XP_012068942.1|  PREDICTED: eukaryotic initiation factor 4A-8       381   5e-128   Jatropha curcas
ref|XP_006426587.1|  hypothetical protein CICLE_v10025724mg             381   5e-128   
ref|XP_009604758.1|  PREDICTED: eukaryotic initiation factor 4A-1...    381   5e-128   Nicotiana tomentosiformis
ref|XP_009780782.1|  PREDICTED: eukaryotic initiation factor 4A-1...    381   5e-128   Nicotiana sylvestris
ref|XP_009604756.1|  PREDICTED: eukaryotic initiation factor 4A-7       381   6e-128   Nicotiana tomentosiformis
sp|P41382.1|IF410_TOBAC  RecName: Full=Eukaryotic initiation fact...    381   6e-128   Nicotiana tabacum [American tobacco]
ref|XP_009784285.1|  PREDICTED: eukaryotic initiation factor 4A-14      381   6e-128   Nicotiana sylvestris
emb|CAN61608.1|  hypothetical protein VITISV_040122                     381   6e-128   Vitis vinifera
gb|ACU22915.1|  unknown                                                 374   6e-128   Glycine max [soybeans]
ref|XP_004513437.1|  PREDICTED: eukaryotic initiation factor 4A-1...    381   7e-128   
ref|XP_009399791.1|  PREDICTED: eukaryotic initiation factor 4A-8       381   7e-128   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q40467.1|IF414_TOBAC  RecName: Full=Eukaryotic initiation fact...    381   7e-128   Nicotiana tabacum [American tobacco]
sp|Q40470.1|IF4A7_TOBAC  RecName: Full=Eukaryotic initiation fact...    381   8e-128   Nicotiana tabacum [American tobacco]
sp|P41379.1|IF4A2_NICPL  RecName: Full=Eukaryotic initiation fact...    381   8e-128   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008793233.1|  PREDICTED: eukaryotic initiation factor 4A-1...    380   1e-127   Phoenix dactylifera
gb|KJB56905.1|  hypothetical protein B456_009G142800                    377   1e-127   Gossypium raimondii
ref|XP_009597977.1|  PREDICTED: eukaryotic initiation factor 4A-15      380   1e-127   Nicotiana tomentosiformis
ref|XP_004253093.1|  PREDICTED: eukaryotic initiation factor 4A-2       380   1e-127   Solanum lycopersicum
gb|KHG04102.1|  Eukaryotic initiation factor 4A-14                      376   2e-127   Gossypium arboreum [tree cotton]
gb|AAN74635.1|  DEAD box RNA helicase                                   380   2e-127   Pisum sativum [garden pea]
ref|XP_003595233.1|  Eukaryotic initiation factor 4A                    380   2e-127   Medicago truncatula
ref|XP_007138709.1|  hypothetical protein PHAVU_009G230600g             379   2e-127   Phaseolus vulgaris [French bean]
ref|XP_009385793.1|  PREDICTED: eukaryotic initiation factor 4A-1...    379   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303662.1|  PREDICTED: eukaryotic initiation factor 4A-8       379   3e-127   Fragaria vesca subsp. vesca
ref|XP_004146811.1|  PREDICTED: eukaryotic initiation factor 4A-8       379   3e-127   Cucumis sativus [cucumbers]
ref|XP_002278119.1|  PREDICTED: eukaryotic initiation factor 4A-11      379   3e-127   Vitis vinifera
gb|EYU29343.1|  hypothetical protein MIMGU_mgv1a007274mg                379   3e-127   Erythranthe guttata [common monkey flower]
ref|XP_007215455.1|  hypothetical protein PRUPE_ppa006399mg             379   3e-127   Prunus persica
gb|KJB56903.1|  hypothetical protein B456_009G142800                    379   4e-127   Gossypium raimondii
ref|XP_009403035.1|  PREDICTED: eukaryotic initiation factor 4A-1...    379   4e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008447621.1|  PREDICTED: eukaryotic initiation factor 4A-8       379   5e-127   Cucumis melo [Oriental melon]
ref|XP_009602748.1|  PREDICTED: eukaryotic initiation factor 4A-11      379   5e-127   Nicotiana tomentosiformis
sp|Q40465.1|IF411_TOBAC  RecName: Full=Eukaryotic initiation fact...    379   5e-127   Nicotiana tabacum [American tobacco]
ref|XP_007024535.1|  Eukaryotic translation initiation factor 4A1...    378   7e-127   Theobroma cacao [chocolate]
ref|XP_003543580.1|  PREDICTED: eukaryotic initiation factor 4A-1...    378   7e-127   Glycine max [soybeans]
gb|KJB70132.1|  hypothetical protein B456_011G063400                    378   8e-127   Gossypium raimondii
gb|KHG23060.1|  Eukaryotic initiation factor 4A-9                       371   9e-127   Gossypium arboreum [tree cotton]
sp|Q40468.1|IF415_TOBAC  RecName: Full=Eukaryotic initiation fact...    378   1e-126   Nicotiana tabacum [American tobacco]
ref|XP_004291063.1|  PREDICTED: eukaryotic initiation factor 4A-2       378   1e-126   Fragaria vesca subsp. vesca
ref|XP_008392378.1|  PREDICTED: eukaryotic initiation factor 4A-8       377   2e-126   Malus domestica [apple tree]
gb|KHN30068.1|  Eukaryotic initiation factor 4A-10                      377   2e-126   Glycine soja [wild soybean]
ref|XP_008379513.1|  PREDICTED: eukaryotic initiation factor 4A-8       377   2e-126   Malus domestica [apple tree]
gb|KHN06630.1|  Eukaryotic initiation factor 4A-15                      377   2e-126   Glycine soja [wild soybean]
ref|XP_008377701.1|  PREDICTED: eukaryotic initiation factor 4A-1...    377   3e-126   
ref|XP_010927212.1|  PREDICTED: eukaryotic initiation factor 4A-1...    377   3e-126   Elaeis guineensis
emb|CBI35913.3|  unnamed protein product                                370   3e-126   Vitis vinifera
ref|XP_009415521.1|  PREDICTED: eukaryotic initiation factor 4A-15      376   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009372398.1|  PREDICTED: eukaryotic initiation factor 4A-8       376   5e-126   Pyrus x bretschneideri [bai li]
gb|ACJ84921.1|  unknown                                                 376   6e-126   Medicago truncatula
ref|XP_009389913.1|  PREDICTED: eukaryotic initiation factor 4A-11      376   7e-126   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS65096.1|  hypothetical protein M569_09681                         376   7e-126   Genlisea aurea
gb|EYU29345.1|  hypothetical protein MIMGU_mgv1a007246mg                375   8e-126   Erythranthe guttata [common monkey flower]
ref|XP_004141688.1|  PREDICTED: eukaryotic initiation factor 4A-11      375   8e-126   Cucumis sativus [cucumbers]
ref|XP_006338111.1|  PREDICTED: eukaryotic initiation factor 4A-1...    375   9e-126   Solanum tuberosum [potatoes]
ref|XP_008462340.1|  PREDICTED: eukaryotic initiation factor 4A-11      375   9e-126   Cucumis melo [Oriental melon]
gb|KHN17683.1|  Eukaryotic initiation factor 4A-15                      375   9e-126   Glycine soja [wild soybean]
ref|XP_007136846.1|  hypothetical protein PHAVU_009G079100g             375   1e-125   Phaseolus vulgaris [French bean]
ref|XP_007150491.1|  hypothetical protein PHAVU_005G157100g             375   1e-125   Phaseolus vulgaris [French bean]
ref|XP_008337727.1|  PREDICTED: eukaryotic initiation factor 4A-11      375   1e-125   Malus domestica [apple tree]
gb|KHN32709.1|  Eukaryotic initiation factor 4A-10                      375   1e-125   Glycine soja [wild soybean]
gb|KJB34989.1|  hypothetical protein B456_006G095400                    375   1e-125   Gossypium raimondii
emb|CDO97887.1|  unnamed protein product                                375   1e-125   Coffea canephora [robusta coffee]
ref|XP_002304104.1|  translation initiation factor 4A family protein    375   1e-125   
ref|XP_011010150.1|  PREDICTED: eukaryotic initiation factor 4A-8       375   1e-125   Populus euphratica
gb|AIZ68204.1|  eukaryotic initiation factor 4A-14                      375   1e-125   Ornithogalum longebracteatum [sea-onion]
gb|KHN39326.1|  Eukaryotic initiation factor 4A-10                      375   2e-125   Glycine soja [wild soybean]
ref|XP_003531602.1|  PREDICTED: eukaryotic initiation factor 4A-10      375   2e-125   Glycine max [soybeans]
ref|XP_006583001.1|  PREDICTED: eukaryotic initiation factor 4A-10      375   2e-125   Glycine max [soybeans]
gb|ACU21478.1|  unknown                                                 375   2e-125   Glycine max [soybeans]
ref|NP_001058481.1|  Os06g0701100                                       375   2e-125   
gb|AAR23806.1|  initiation factor eIF4A-15                              375   2e-125   Helianthus annuus
dbj|BAA02152.1|  eukaryotic initiation factor 4A                        375   2e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003522265.1|  PREDICTED: eukaryotic initiation factor 4A-11      375   2e-125   Glycine max [soybeans]
ref|XP_007012323.1|  Eukaryotic translation initiation factor 4A1       375   2e-125   Theobroma cacao [chocolate]
gb|KJB54655.1|  hypothetical protein B456_009G043400                    374   3e-125   Gossypium raimondii
ref|XP_006656443.1|  PREDICTED: eukaryotic initiation factor 4A-1...    374   3e-125   Oryza brachyantha
ref|XP_010033764.1|  PREDICTED: eukaryotic initiation factor 4A-2...    374   3e-125   Eucalyptus grandis [rose gum]
gb|EAZ02256.1|  hypothetical protein OsI_24355                          375   3e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_009381599.1|  PREDICTED: eukaryotic initiation factor 4A-9...    374   3e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006342502.1|  PREDICTED: eukaryotic initiation factor 4A-2...    374   3e-125   Solanum tuberosum [potatoes]
ref|XP_004253094.1|  PREDICTED: eukaryotic initiation factor 4A-2...    374   4e-125   Solanum lycopersicum
ref|XP_002277703.1|  PREDICTED: eukaryotic initiation factor 4A-8       374   5e-125   Vitis vinifera
ref|XP_007202168.1|  hypothetical protein PRUPE_ppa006450mg             373   6e-125   Prunus persica
ref|XP_007135520.1|  hypothetical protein PHAVU_010G136300g             373   6e-125   Phaseolus vulgaris [French bean]
ref|XP_006357714.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic i...    373   7e-125   
ref|XP_011079970.1|  PREDICTED: eukaryotic initiation factor 4A-8       373   7e-125   Sesamum indicum [beniseed]
gb|EYU21355.1|  hypothetical protein MIMGU_mgv1a0072631mg               373   8e-125   Erythranthe guttata [common monkey flower]
ref|XP_010049453.1|  PREDICTED: eukaryotic initiation factor 4A-15      373   9e-125   
gb|AFK40852.1|  unknown                                                 373   1e-124   Lotus japonicus
ref|XP_009410226.1|  PREDICTED: eukaryotic initiation factor 4A-9...    373   1e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338110.1|  PREDICTED: eukaryotic initiation factor 4A-1...    373   1e-124   
ref|XP_003563508.1|  PREDICTED: eukaryotic initiation factor 4A         372   1e-124   Brachypodium distachyon [annual false brome]
ref|XP_010262239.1|  PREDICTED: uncharacterized protein LOC104600806    388   2e-124   
ref|XP_010656491.1|  PREDICTED: uncharacterized protein LOC100244028    385   3e-124   Vitis vinifera
ref|XP_006853908.1|  PREDICTED: eukaryotic initiation factor 4A-3       372   3e-124   Amborella trichopoda
ref|XP_006474427.1|  PREDICTED: eukaryotic initiation factor 4A-9...    372   3e-124   Citrus sinensis [apfelsine]
dbj|BAJ85348.1|  predicted protein                                      372   3e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89461.1|  predicted protein                                      372   3e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96964.1|  predicted protein                                      371   5e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012077530.1|  PREDICTED: eukaryotic initiation factor 4A-1...    382   6e-124   
ref|XP_003526019.1|  PREDICTED: eukaryotic initiation factor 4A-11      370   7e-124   Glycine max [soybeans]
gb|AAY33860.1|  eukaryotic initiation factor 4A                         370   8e-124   Cenchrus americanus [bulrush millet]
ref|XP_009798256.1|  PREDICTED: eukaryotic initiation factor 4A-8       370   9e-124   Nicotiana sylvestris
ref|XP_004966111.1|  PREDICTED: eukaryotic initiation factor 4A-3...    370   1e-123   Setaria italica
sp|P41381.1|IF4A8_TOBAC  RecName: Full=Eukaryotic initiation fact...    370   1e-123   Nicotiana tabacum [American tobacco]
ref|XP_010062659.1|  PREDICTED: eukaryotic initiation factor 4A-1...    370   1e-123   Eucalyptus grandis [rose gum]
ref|NP_001105396.1|  translational initiation factor eIF-4A             370   1e-123   
gb|KEH32494.1|  DEAD-box ATP-dependent RNA helicase                     370   1e-123   Medicago truncatula
ref|XP_009361722.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    384   2e-123   
gb|AFW75865.1|  putative DEAD-box ATP-dependent RNA helicase fami...    369   2e-123   
ref|XP_006453066.1|  hypothetical protein CICLE_v10008460mg             369   2e-123   Citrus clementina [clementine]
ref|XP_002438954.1|  hypothetical protein SORBIDRAFT_10g028940          369   3e-123   Sorghum bicolor [broomcorn]
ref|XP_006601410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    383   3e-123   
ref|XP_009624936.1|  PREDICTED: eukaryotic initiation factor 4A-8...    369   3e-123   Nicotiana tomentosiformis
gb|KHG25459.1|  Eukaryotic initiation factor 4A-8                       364   3e-123   Gossypium arboreum [tree cotton]
ref|XP_011072546.1|  PREDICTED: eukaryotic initiation factor 4A-8...    369   3e-123   Sesamum indicum [beniseed]
gb|KEH32495.1|  DEAD-box ATP-dependent RNA helicase                     369   4e-123   Medicago truncatula
sp|P41378.1|IF4A_WHEAT  RecName: Full=Eukaryotic initiation facto...    369   5e-123   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010322836.1|  PREDICTED: eukaryotic initiation factor 4A-8...    369   5e-123   Solanum lycopersicum
ref|XP_010552222.1|  PREDICTED: eukaryotic initiation factor 4A-1...    361   5e-123   Tarenaya hassleriana [spider flower]
gb|KJB65513.1|  hypothetical protein B456_010G098500                    369   6e-123   Gossypium raimondii
ref|XP_010669372.1|  PREDICTED: eukaryotic initiation factor 4A-9       368   6e-123   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN34609.1|  unknown                                                 368   7e-123   Zea mays [maize]
ref|XP_003597562.1|  Eukaryotic initiation factor 4A                    368   1e-122   Medicago truncatula
ref|XP_009334733.1|  PREDICTED: eukaryotic initiation factor 4A-1...    368   1e-122   
gb|EMS68416.1|  Eukaryotic initiation factor 4A-1                       368   1e-122   Triticum urartu
ref|XP_007154632.1|  hypothetical protein PHAVU_003G134800g             367   1e-122   Phaseolus vulgaris [French bean]
ref|XP_004951905.1|  PREDICTED: eukaryotic initiation factor 4A-like    367   2e-122   Setaria italica
emb|CDY72259.1|  BnaCnng76770D                                          360   2e-122   Brassica napus [oilseed rape]
ref|XP_004510408.1|  PREDICTED: eukaryotic initiation factor 4A-1...    367   3e-122   Cicer arietinum [garbanzo]
ref|XP_010322839.1|  PREDICTED: eukaryotic initiation factor 4A-8...    366   3e-122   Solanum lycopersicum
ref|XP_003574572.1|  PREDICTED: eukaryotic initiation factor 4A-1...    366   4e-122   Brachypodium distachyon [annual false brome]
ref|XP_006453067.1|  hypothetical protein CICLE_v10008468mg             366   5e-122   Citrus clementina [clementine]
ref|XP_006595337.1|  PREDICTED: eukaryotic initiation factor 4A-14      378   5e-122   
ref|NP_001045878.1|  Os02g0146600                                       366   5e-122   
ref|NP_001104874.1|  translation initiation factor                      366   6e-122   Zea mays [maize]
ref|XP_011046150.1|  PREDICTED: eukaryotic initiation factor 4A-8...    365   7e-122   Populus euphratica
ref|XP_003627168.1|  Eukaryotic initiation factor 4A                    365   9e-122   Medicago truncatula
ref|XP_002514133.1|  dead box ATP-dependent RNA helicase, putative      376   1e-121   
ref|XP_007012776.1|  Eukaryotic translation initiation factor 4A1...    365   1e-121   
ref|XP_010087709.1|  Eukaryotic initiation factor 4A-8                  365   1e-121   
ref|XP_006646878.1|  PREDICTED: eukaryotic initiation factor 4A-3...    365   1e-121   Oryza brachyantha
ref|XP_010534921.1|  PREDICTED: eukaryotic initiation factor 4A-1       364   2e-121   Tarenaya hassleriana [spider flower]
emb|CDY02469.1|  BnaA08g00760D                                          364   2e-121   
ref|XP_006369263.1|  hypothetical protein POPTR_0001s20480g             364   2e-121   
ref|XP_002451536.1|  hypothetical protein SORBIDRAFT_04g003390          364   3e-121   Sorghum bicolor [broomcorn]
emb|CDY55205.1|  BnaCnng28430D                                          364   3e-121   Brassica napus [oilseed rape]
ref|XP_006392695.1|  hypothetical protein EUTSA_v10011528mg             364   3e-121   Eutrema salsugineum [saltwater cress]
ref|XP_009106914.1|  PREDICTED: eukaryotic initiation factor 4A-1...    364   3e-121   Brassica rapa
ref|XP_007012324.1|  Eukaryotic translation initiation factor 4A1       364   4e-121   Theobroma cacao [chocolate]
ref|XP_009334734.1|  PREDICTED: eukaryotic initiation factor 4A-1...    363   4e-121   
emb|CDX82505.1|  BnaA03g33160D                                          364   4e-121   
ref|XP_006297793.1|  hypothetical protein CARUB_v10013828mg             363   4e-121   Capsella rubella
ref|NP_001151064.1|  LOC100284697                                       363   5e-121   Zea mays [maize]
sp|Q41741.1|IF4A_MAIZE  RecName: Full=Eukaryotic initiation facto...    363   6e-121   Zea mays [maize]
emb|CDP03140.1|  unnamed protein product                                363   6e-121   Coffea canephora [robusta coffee]
ref|XP_010501441.1|  PREDICTED: eukaryotic initiation factor 4A-1       363   6e-121   Camelina sativa [gold-of-pleasure]
gb|ACU18673.1|  unknown                                                 357   7e-121   Glycine max [soybeans]
ref|XP_010542416.1|  PREDICTED: eukaryotic initiation factor 4A-1       363   8e-121   Tarenaya hassleriana [spider flower]
ref|XP_009598422.1|  PREDICTED: eukaryotic initiation factor 4A-9...    355   8e-121   Nicotiana tomentosiformis
ref|XP_006307670.1|  hypothetical protein CARUB_v10009297mg             363   8e-121   Capsella rubella
gb|AFW69337.1|  putative DEAD-box ATP-dependent RNA helicase fami...    363   9e-121   
ref|XP_010688701.1|  PREDICTED: eukaryotic initiation factor 4A-9...    362   1e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009135344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    362   1e-120   Brassica rapa
gb|EYU45869.1|  hypothetical protein MIMGU_mgv1a007331mg                362   1e-120   Erythranthe guttata [common monkey flower]
ref|XP_006407149.1|  hypothetical protein EUTSA_v10020824mg             362   1e-120   
ref|XP_006357392.1|  PREDICTED: eukaryotic initiation factor 4A-8...    362   1e-120   
emb|CDX97528.1|  BnaA05g25510D                                          362   2e-120   
ref|XP_002884997.1|  predicted protein                                  362   2e-120   Arabidopsis lyrata subsp. lyrata
emb|CDY10607.1|  BnaC03g70070D                                          362   2e-120   Brassica napus [oilseed rape]
ref|XP_009334732.1|  PREDICTED: eukaryotic initiation factor 4A-6...    362   2e-120   
ref|XP_009334735.1|  PREDICTED: eukaryotic initiation factor 4A-6...    362   3e-120   
ref|XP_004486853.1|  PREDICTED: eukaryotic initiation factor 4A-1...    362   3e-120   Cicer arietinum [garbanzo]
emb|CDX75739.1|  BnaC03g38220D                                          362   3e-120   
ref|XP_010536184.1|  PREDICTED: eukaryotic initiation factor 4A-9...    361   4e-120   Tarenaya hassleriana [spider flower]
ref|XP_009107078.1|  PREDICTED: eukaryotic initiation factor 4A-1       361   4e-120   Brassica rapa
emb|CDY39079.1|  BnaA01g29770D                                          361   5e-120   Brassica napus [oilseed rape]
gb|EPS63850.1|  hypothetical protein M569_10933                         361   5e-120   Genlisea aurea
emb|CDY08220.1|  BnaA05g13990D                                          361   6e-120   Brassica napus [oilseed rape]
dbj|BAH56988.1|  AT3G13920                                              360   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242400.1|  PREDICTED: eukaryotic initiation factor 4A-2       372   8e-120   
gb|AAL91176.1|  eukaryotic translation initiation factor                360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566469.1|  translational initiation factor 4A-1                  360   1e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63951.1|  Eukaryotic initiation factor 4A, putative               360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480021.1|  PREDICTED: eukaryotic initiation factor 4A-1...    359   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_002891805.1|  predicted protein                                  359   2e-119   Arabidopsis lyrata subsp. lyrata
ref|XP_010090077.1|  Eukaryotic initiation factor 4A-15                 373   2e-119   
gb|ABR18348.1|  unknown                                                 359   3e-119   Picea sitchensis
ref|XP_010462344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    359   3e-119   
ref|XP_010502017.1|  PREDICTED: eukaryotic initiation factor 4A-2...    353   3e-119   Camelina sativa [gold-of-pleasure]
ref|NP_001030693.1|  translational initiation factor 4A-1               359   4e-119   
ref|XP_009146433.1|  PREDICTED: eukaryotic initiation factor 4A-1...    358   4e-119   Brassica rapa
ref|NP_175829.1|  eukaryotic initiation factor 4A-2                     358   4e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAN74636.1|  DEAD box RNA helicase                                   358   5e-119   Pisum sativum [garden pea]
ref|XP_009117360.1|  PREDICTED: eukaryotic initiation factor 4A-1...    358   9e-119   Brassica rapa
ref|XP_010324046.1|  PREDICTED: eukaryotic initiation factor 4A-9...    357   2e-118   Solanum lycopersicum
dbj|BAE98559.1|  eukaryotic protein synthesis initiation factor 4A      357   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147530.1|  PREDICTED: eukaryotic initiation factor 4A-1       355   8e-118   Brassica rapa
emb|CDY24057.1|  BnaA06g00550D                                          355   9e-118   Brassica napus [oilseed rape]
ref|XP_011470735.1|  PREDICTED: eukaryotic initiation factor 4A-9       367   1e-117   Fragaria vesca subsp. vesca
ref|XP_001786409.1|  predicted protein                                  347   2e-117   
ref|XP_009779503.1|  PREDICTED: eukaryotic initiation factor 4A-9...    353   4e-117   Nicotiana sylvestris
ref|XP_011628795.1|  PREDICTED: eukaryotic initiation factor 4A-9...    353   6e-117   
emb|CDY33073.1|  BnaC06g07060D                                          353   6e-117   Brassica napus [oilseed rape]
ref|XP_006858971.2|  PREDICTED: eukaryotic initiation factor 4A-9...    353   8e-117   Amborella trichopoda
emb|CDY53867.1|  BnaC02g46260D                                          351   6e-116   Brassica napus [oilseed rape]
ref|XP_004508240.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    363   7e-116   
gb|ABS19813.1|  eukaryotic initiation factor 4A                         347   9e-116   Lolium perenne [perennial ryegrass]
ref|XP_001783934.1|  predicted protein                                  350   1e-115   
gb|ACA24135.1|  eukaryotic initiation factor 4A                         347   2e-115   Lolium temulentum
emb|CDY49861.1|  BnaA02g16100D                                          350   2e-115   Brassica napus [oilseed rape]
ref|XP_001758216.1|  predicted protein                                  349   2e-115   
ref|XP_001765568.1|  predicted protein                                  348   3e-115   
ref|XP_009127948.1|  PREDICTED: eukaryotic initiation factor 4A-3...    348   5e-115   Brassica rapa
ref|XP_006390626.1|  hypothetical protein EUTSA_v10018626mg             347   2e-114   Eutrema salsugineum [saltwater cress]
ref|XP_001771324.1|  predicted protein                                  346   3e-114   
dbj|BAB21258.1|  eukaryotic initiation factor 4A                        346   3e-114   Oryza sativa [red rice]
ref|XP_009334736.1|  PREDICTED: eukaryotic initiation factor 4A-6...    344   1e-113   
ref|XP_002966250.1|  hypothetical protein SELMODRAFT_85554              345   1e-113   
ref|XP_006302320.1|  hypothetical protein CARUB_v10020373mg             344   2e-113   Capsella rubella
ref|XP_009105938.1|  PREDICTED: eukaryotic initiation factor 4A-3       344   2e-113   Brassica rapa
ref|NP_001189885.1|  translational initiation factor 4A-1               342   7e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ABS19814.1|  eukaryotic initiation factor 4A                         340   8e-113   Lolium perenne [perennial ryegrass]
emb|CDX72939.1|  BnaC06g33870D                                          344   8e-113   
ref|XP_009127949.1|  PREDICTED: eukaryotic initiation factor 4A-3...    342   8e-113   Brassica rapa
ref|NP_001185220.1|  eukaryotic initiation factor 4A-2                  341   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416036.1|  PREDICTED: eukaryotic initiation factor 4A-3       341   3e-112   Camelina sativa [gold-of-pleasure]
emb|CDY68148.1|  BnaA07g38930D                                          351   4e-112   Brassica napus [oilseed rape]
ref|XP_002524306.1|  dead box ATP-dependent RNA helicase, putative      339   2e-111   
ref|XP_011628796.1|  PREDICTED: eukaryotic initiation factor 4A-6...    336   3e-110   
ref|NP_177417.1|  eukaryotic initiation factor 4A-3                     335   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888890.1|  predicted protein                                  335   5e-110   Arabidopsis lyrata subsp. lyrata
gb|ACU24597.1|  unknown                                                 329   6e-110   Glycine max [soybeans]
emb|CAA09211.1|  RNA helicase                                           336   7e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009624937.1|  PREDICTED: eukaryotic initiation factor 4A-8...    333   2e-109   Nicotiana tomentosiformis
gb|ACN40356.1|  unknown                                                 333   3e-109   Picea sitchensis
gb|ACN40838.1|  unknown                                                 331   2e-108   Picea sitchensis
gb|KEH39505.1|  DEAD-box ATP-dependent RNA helicase                     330   2e-108   Medicago truncatula
gb|ACN40422.1|  unknown                                                 331   5e-108   Picea sitchensis
ref|NP_001078148.1|  translational initiation factor 4A-1               327   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132534.1|  PREDICTED: eukaryotic initiation factor 4A-1...    328   4e-107   Brassica rapa
ref|XP_002982302.1|  hypothetical protein SELMODRAFT_228839             325   9e-106   
ref|XP_002966232.1|  hypothetical protein SELMODRAFT_143895             323   2e-105   
gb|ACJ85073.1|  unknown                                                 317   3e-103   
gb|AAL69381.1|AF462218_1  putative DEAD/DEAH box helicase               307   1e-102   
ref|XP_002499673.1|  hypothetical protein MICPUN_106753                 316   2e-102   
ref|XP_003058151.1|  predicted protein                                  314   9e-102   
ref|XP_005644820.1|  eukaryotic initiation factor 4A-like protein       314   1e-101   
ref|XP_005845171.1|  eukaryotic initiation factor 4A (ATP-depende...    313   2e-101   
gb|AFC88837.1|  initiation factor 4A-3-like protein                     312   3e-101   
gb|AID52925.1|  initiation factor eIF4A                                 304   6e-100   
gb|KDO65151.1|  hypothetical protein CISIN_1g015129mg                   304   2e-98    
emb|CDY11154.1|  BnaC06g24060D                                          298   3e-98    
ref|XP_010552227.1|  PREDICTED: eukaryotic initiation factor 4A-1       303   5e-98    
gb|AFJ42571.1|  elongation initiation factor 4A                         301   9e-98    
gb|KIZ04417.1|  Eukaryotic initiation factor 4A-3                       304   3e-97    
ref|XP_001691452.1|  eukaryotic initiation factor 4A-like protein       302   5e-97    
emb|CEF98795.1|  Helicase, C-terminal                                   302   5e-97    
ref|XP_007513631.1|  predicted protein                                  302   6e-97    
ref|XP_002951303.1|  hypothetical protein VOLCADRAFT_120953             301   9e-97    
gb|KDD74664.1|  DEAD/DEAH box helicase                                  300   5e-96    
ref|XP_010501104.1|  PREDICTED: eukaryotic initiation factor 4A-1...    297   9e-96    
emb|CAC43286.1|  translation initiation factor eIF-4A1                  296   5e-95    
ref|XP_001418972.1|  predicted protein                                  295   4e-94    
ref|XP_011398174.1|  Eukaryotic initiation factor 4A-10                 294   4e-94    
emb|CDP15708.1|  unnamed protein product                                290   6e-94    
gb|AAK83983.1|AF393811_1  eukaryotic initiation factor 4A -like p...    274   6e-90    
ref|XP_009764706.1|  PREDICTED: eukaryotic initiation factor 4A-6...    277   9e-88    
ref|XP_010533343.1|  PREDICTED: eukaryotic initiation factor 4A-1...    276   2e-87    
ref|XP_006279086.1|  hypothetical protein CARUB_v10012714mg             277   2e-87    
gb|KJB65515.1|  hypothetical protein B456_010G098500                    274   8e-87    
emb|CDY32586.1|  BnaC03g15540D                                          275   1e-86    
gb|AAF19805.1|  EIF4A protein                                           270   2e-85    
ref|XP_010514906.1|  PREDICTED: eukaryotic initiation factor 4A-2...    265   2e-82    
ref|XP_003747632.1|  PREDICTED: eukaryotic initiation factor 4A-I...    257   1e-79    
ref|XP_006300238.1|  hypothetical protein CARUB_v10016478mg             257   3e-79    
gb|AII97883.1|  BLTX517                                                 252   2e-78    
gb|AFP57571.1|  eukaryotic initiation factor 4A                         250   2e-78    
ref|NP_001177648.1|  eukaryotic initiation factor 4a                    253   4e-78    
ref|NP_001091916.1|  eukaryotic initiation factor 4a                    253   1e-77    
gb|KJH48350.1|  eukaryotic initiation factor 4A-III                     251   2e-77    
gb|ENN77191.1|  hypothetical protein YQE_06329                          250   5e-77    
gb|KIH56011.1|  DEAD/DEAH box helicase                                  246   6e-77    
gb|KJH52606.1|  eukaryotic initiation factor 4A-III                     249   1e-76    
emb|CDJ93494.1|  DNA RNA helicase domain containing protein             245   1e-76    
gb|EFA03968.1|  hypothetical protein TcasGA2_TC014113                   251   1e-76    
gb|AEE61546.1|  unknown                                                 249   2e-76    
gb|ERL87143.1|  hypothetical protein D910_04543                         249   2e-76    
gb|KFM75183.1|  Eukaryotic initiation factor 4A-I                       249   3e-76    
ref|XP_006219988.1|  PREDICTED: eukaryotic initiation factor 4A-like    244   4e-76    
dbj|BAM17712.1|  eukaryotic initiation factor 4a                        248   4e-76    
ref|XP_002163229.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   5e-76    
gb|KFM62051.1|  Eukaryotic initiation factor 4A-II                      248   5e-76    
gb|KHN88002.1|  Eukaryotic initiation factor 4A                         248   6e-76    
gb|EKG22315.1|  RNA helicase ATP-dependent DEAD-box conserved site      247   9e-76    
gb|EFX83683.1|  hypothetical protein DAPPUDRAFT_230663                  248   1e-75    
dbj|BAN20868.1|  eukaryotic initiation factor 4a                        247   1e-75    
emb|CCJ09440.1|  eukaryotic initiation factor 4A                        247   1e-75    
ref|XP_007764392.1|  DEAD-domain-containing protein                     246   2e-75    
ref|XP_009020682.1|  hypothetical protein HELRODRAFT_112831             248   2e-75    
pdb|3BOR|A  Chain A, Crystal Structure Of The Deadc Domain Of Hum...    241   2e-75    
gb|EYC01872.1|  hypothetical protein Y032_0103g3516                     246   2e-75    
gb|KDR15558.1|  Eukaryotic initiation factor 4A-II                      248   2e-75    
ref|XP_002002717.1|  GI17537                                            246   2e-75    
gb|EHJ75348.1|  eukaryotic initiation factor 4A                         246   2e-75    
ref|XP_001962722.1|  GF15595                                            245   3e-75    
ref|XP_011552532.1|  PREDICTED: eukaryotic initiation factor 4A         246   3e-75    
ref|XP_001968873.1|  GG25110                                            245   3e-75    
gb|ABY66383.1|  eukaryotic initiation factor 4A                         246   3e-75    
ref|XP_002424727.1|  eukaryotic initiation factor 4A-II, putative       247   3e-75    
gb|AHK26791.1|  eukaryotic translation initiation factor 4A             246   3e-75    
gb|EYB84565.1|  hypothetical protein Y032_0314g2232                     245   4e-75    
gb|EPB79760.1|  eukaryotic initiation factor 4A-III                     245   4e-75    
ref|XP_003740341.1|  PREDICTED: eukaryotic initiation factor 4A-I...    246   5e-75    
ref|XP_011421101.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   5e-75    
gb|ACV88438.1|  AT04852p                                                244   6e-75    
ref|NP_476595.1|  eukaryotic initiation factor 4a, isoform C            245   6e-75    
ref|XP_002038023.1|  GM18587                                            245   6e-75    
ref|XP_002407236.1|  translation initiation factor 4F, helicase s...    246   6e-75    
gb|ADA53586.1|  RE22480p                                                245   6e-75    
gb|AAV84216.1|  elongation factor 4A                                    239   6e-75    
ref|XP_002089150.1|  eIF-4a                                             245   7e-75    
gb|EDL78075.1|  eukaryotic translation initiation factor 4A2, iso...    238   7e-75    
ref|XP_006825894.1|  PREDICTED: eukaryotic initiation factor 4A-I...    245   8e-75    
ref|XP_001656675.1|  AAEL013359-PA                                      243   1e-74    
gb|AGK45314.2|  eukaryotic initiation factor 4A                         245   1e-74    
gb|ETE63526.1|  Eukaryotic initiation factor 4A-II                      242   1e-74    
dbj|BAH71323.1|  ACYPI002483                                            238   1e-74    
ref|XP_005895572.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   2e-74    
ref|XP_001841147.1|  ATP-dependent RNA helicase eIF4A                   244   2e-74    
ref|XP_007884153.1|  PREDICTED: eukaryotic initiation factor 4A-I...    244   2e-74    
gb|ABF51379.1|  eukaryotic translation initiation factor 4A             244   2e-74    
gb|KDR69281.1|  hypothetical protein GALMADRAFT_256112                  243   2e-74    
ref|XP_010234049.1|  PREDICTED: ATP-dependent RNA helicase drs1-like    255   2e-74    
gb|KJA24162.1|  hypothetical protein HYPSUDRAFT_38930                   243   2e-74    
ref|XP_006262091.1|  PREDICTED: eukaryotic initiation factor 4A-II      243   2e-74    
ref|NP_001037376.1|  eukaryotic translation initiation factor 4A        244   2e-74    
gb|AII97731.1|  BLTX345                                                 238   2e-74    
ref|XP_007587937.1|  putative atp-dependent rna helicase eif4a pr...    243   3e-74    
ref|XP_010395597.1|  PREDICTED: eukaryotic initiation factor 4A-II      243   3e-74    
emb|CCF72996.1|  unnamed protein product                                243   3e-74    
ref|XP_004078949.1|  PREDICTED: eukaryotic initiation factor 4A-I...    243   3e-74    
ref|XP_005506650.1|  PREDICTED: eukaryotic initiation factor 4A-II      243   3e-74    
ref|XP_011632968.1|  PREDICTED: eukaryotic initiation factor 4A-I       244   3e-74    
ref|XP_001656674.1|  AAEL013359-PC                                      243   3e-74    
ref|XP_009074201.1|  PREDICTED: eukaryotic initiation factor 4A-II      243   3e-74    
ref|XP_007071060.1|  PREDICTED: eukaryotic initiation factor 4A-I...    243   3e-74    
gb|KIJ15730.1|  hypothetical protein PAXINDRAFT_11322                   243   4e-74    
ref|XP_004365945.1|  eukaryotic translation initiation factor 4A ...    243   4e-74    
ref|XP_002065355.1|  GK14711                                            243   4e-74    
ref|XP_006637457.1|  PREDICTED: eukaryotic initiation factor 4A-I...    243   4e-74    
ref|XP_011258665.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   4e-74    
ref|XP_006637458.1|  PREDICTED: eukaryotic initiation factor 4A-I...    243   4e-74    
gb|KIN99522.1|  hypothetical protein M404DRAFT_1004624                  239   4e-74    
gb|KIK19856.1|  hypothetical protein PISMIDRAFT_682778                  243   4e-74    
ref|XP_001357204.2|  GA21521                                            243   4e-74    
ref|XP_003137738.1|  hypothetical protein LOAG_02152                    243   4e-74    
emb|CDQ56285.1|  unnamed protein product                                243   5e-74    
ref|XP_004473759.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   5e-74    
ref|XP_003705530.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   5e-74    
ref|XP_005024716.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   5e-74    
dbj|BAE36681.1|  unnamed protein product                                236   6e-74    
ref|XP_002840305.1|  hypothetical protein                               244   6e-74    
emb|CDP92497.1|  Protein Bm13696, isoform c                             243   6e-74    
gb|EOA97603.1|  Eukaryotic initiation factor 4A-II                      242   6e-74    
ref|NP_998616.2|  eukaryotic initiation factor 4A-II                    243   6e-74    
ref|XP_005802438.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   7e-74    
gb|KIM36462.1|  hypothetical protein M413DRAFT_449165                   242   7e-74    
ref|XP_008547801.1|  PREDICTED: eukaryotic initiation factor 4A-I...    243   7e-74    
gb|KFQ16858.1|  Eukaryotic initiation factor 4A-II                      242   7e-74    
ref|XP_002051383.1|  GJ15436                                            242   7e-74    
ref|XP_005476057.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   7e-74    
ref|XP_007250744.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   8e-74    
ref|XP_005802437.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   8e-74    
gb|EMC85744.1|  Eukaryotic initiation factor 4A-II                      242   8e-74    
ref|NP_989880.1|  eukaryotic initiation factor 4A-II                    242   8e-74    
ref|XP_011704143.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   8e-74    
ref|XP_011151421.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   8e-74    
ref|XP_003437851.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   9e-74    
ref|XP_011883471.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   9e-74    
ref|XP_011052523.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   9e-74    
gb|EJW88714.1|  eukaryotic initiation factor 4A                         242   9e-74    
ref|XP_011176133.1|  PREDICTED: eukaryotic initiation factor 4A-I       243   9e-74    
ref|XP_007263911.1|  DEAD-domain-containing protein                     242   9e-74    
ref|XP_009901850.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   9e-74    
ref|XP_005024714.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   9e-74    
ref|XP_003492849.1|  PREDICTED: eukaryotic initiation factor 4A-l...    243   9e-74    
ref|XP_007071059.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   9e-74    
gb|KDQ33091.1|  hypothetical protein PLEOSDRAFT_1091325                 241   1e-73    
ref|XP_008282835.1|  PREDICTED: eukaryotic initiation factor 4A-II      242   1e-73    
ref|XP_003225744.1|  PREDICTED: eukaryotic initiation factor 4A-II      242   1e-73    
ref|XP_006138538.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
ref|XP_002196090.1|  PREDICTED: eukaryotic initiation factor 4A-II      242   1e-73    
emb|CEF62867.1|  Eukaryotic initiation factor 4A-II                     242   1e-73    
ref|XP_005146991.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
dbj|BAB27678.2|  unnamed protein product                                236   1e-73    
ref|XP_001988166.1|  GH11018                                            241   1e-73    
gb|KIJ59695.1|  hypothetical protein HYDPIDRAFT_118189                  241   1e-73    
ref|XP_001894230.1|  eukaryotic initiation factor 4A                    242   1e-73    
ref|XP_009997708.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
ref|XP_009901849.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
ref|XP_005024715.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
emb|CCQ18648.1|  Translation initiation factor 4F, helicase subunit     243   1e-73    
ref|XP_005146992.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
ref|XP_005067896.1|  PREDICTED: eukaryotic initiation factor 4A-I       236   1e-73    
ref|XP_010223876.1|  PREDICTED: eukaryotic initiation factor 4A-II      241   1e-73    
ref|XP_005051294.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   1e-73    
ref|XP_009997700.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   1e-73    
ref|XP_006017190.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   1e-73    
gb|KFH74007.1|  ATP-dependent RNA helicase eIF4A                        241   1e-73    
gb|ELU06081.1|  hypothetical protein CAPTEDRAFT_202865                  242   1e-73    
ref|XP_006017189.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
ref|XP_008491602.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
ref|XP_008168912.1|  PREDICTED: eukaryotic initiation factor 4A-I...    242   2e-73    
gb|ELK28651.1|  Eukaryotic initiation factor 4A-II                      241   2e-73    
emb|CDJ95865.1|  DNA RNA helicase domain containing protein             235   2e-73    
ref|XP_007195306.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
ref|XP_008491601.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
ref|XP_008560387.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
ref|XP_005331052.1|  PREDICTED: eukaryotic initiation factor 4A-I...    241   2e-73    
emb|CAA48790.1|  eukaryotic translation initiation factor 4A (eIF...    241   2e-73    
gb|KIP08860.1|  hypothetical protein PHLGIDRAFT_103669                  241   2e-73    
prf||1912301A  initiation factor eIF-4A                                 241   2e-73 
gb|AAH15842.1|  Eukaryotic translation initiation factor 4A, isof...    241   2e-73    
ref|XP_623285.1|  PREDICTED: eukaryotic initiation factor 4A-like...    241   2e-73    
ref|XP_008214369.1|  PREDICTED: eukaryotic initiation factor 4A-I       241   2e-73    
ref|XP_007322327.1|  hypothetical protein SERLADRAFT_476444             241   2e-73    
ref|XP_007862988.1|  DEAD-domain-containing protein                     241   3e-73    
ref|XP_005545524.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   3e-73    
ref|XP_002175853.1|  translation initiation factor eIF4A                240   3e-73    
gb|KIJ98728.1|  hypothetical protein K443DRAFT_680564                   241   3e-73    
ref|XP_005088431.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   3e-73    
ref|XP_007395441.1|  hypothetical protein PHACADRAFT_255471             240   3e-73    
ref|XP_007872333.1|  hypothetical protein PNEG_00452                    241   3e-73    
ref|XP_005876342.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   3e-73    
ref|XP_011952852.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   3e-73    
ref|XP_005771275.1|  hypothetical protein EMIHUDRAFT_413872             240   3e-73    
ref|XP_009675574.1|  PREDICTED: eukaryotic initiation factor 4A-II      241   3e-73    
ref|XP_741188.1|  RNA helicase-1                                        235   3e-73    
ref|XP_004745275.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   3e-73    
gb|EAW90166.1|  eukaryotic translation initiation factor 4A, isof...    238   3e-73    
ref|NP_001116510.1|  eukaryotic initiation factor 4A-II isoform c       239   3e-73    
ref|NP_001011139.1|  eukaryotic translation initiation factor 4A1       241   3e-73    
ref|XP_007849642.1|  eukaryotic translation initiation factor           240   4e-73    
ref|XP_006752550.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    240   4e-73    
ref|XP_005545523.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   4e-73    
ref|XP_007116337.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   4e-73    
ref|XP_006171515.1|  PREDICTED: eukaryotic initiation factor 4A-I...    240   4e-73    
gb|KIL66550.1|  hypothetical protein M378DRAFT_160543                   240   4e-73    
gb|EMP25200.1|  Eukaryotic initiation factor 4A-II                      240   4e-73    
ref|XP_007116335.1|  PREDICTED: eukaryotic initiation factor 4A-I...    240   4e-73    
gb|EDK97657.1|  eukaryotic translation initiation factor 4A2, iso...    239   4e-73    
gb|EFB26304.1|  hypothetical protein PANDA_002799                       240   4e-73    
ref|XP_004278520.1|  PREDICTED: eukaryotic initiation factor 4A-II      240   4e-73    
ref|XP_006171516.1|  PREDICTED: eukaryotic initiation factor 4A-I...    240   4e-73    
ref|XP_004899727.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   5e-73    
ref|XP_004713471.1|  PREDICTED: eukaryotic initiation factor 4A-II      240   5e-73    
emb|CEG64572.1|  Putative ATP-dependent RNA helicase eIF4A              239   5e-73    
ref|XP_005989465.1|  PREDICTED: eukaryotic initiation factor 4A-I...    239   5e-73    
gb|AIC61961.1|  EIF4A2                                                  240   6e-73    
ref|XP_005910826.1|  PREDICTED: eukaryotic initiation factor 4A-II      240   6e-73    
dbj|BAA06336.1|  eukaryotic initiation factor 4AII                      240   6e-73    
ref|XP_004473756.1|  PREDICTED: eukaryotic initiation factor 4A-I...    240   6e-73    



>ref|XP_009593905.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=207

 Score =   383 bits (984),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_002324737.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|ABK92554.1| unknown [Populus trichocarpa]
 gb|EEF03302.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   389 bits (999),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D+KM ELLT +GQ+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDGQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_011019413.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
 ref|XP_011019414.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
Length=413

 Score =   389 bits (998),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA +APEGSQFDARQ+D+KM ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSKMNELLTTEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010929386.1| PREDICTED: eukaryotic initiation factor 4A-2 [Elaeis guineensis]
Length=413

 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_010927213.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Elaeis guineensis]
Length=413

 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_009757031.1| PREDICTED: eukaryotic initiation factor 4A-9 [Nicotiana sylvestris]
Length=413

 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>gb|ABK93239.1| unknown [Populus trichocarpa]
Length=413

 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_002308545.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|EEE92068.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_011081667.1| PREDICTED: eukaryotic initiation factor 4A-2 [Sesamum indicum]
Length=413

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+DAKM ELL  +G+EFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDAKMNELLGTDGEEFFTSYDEVYNSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010925445.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_011038130.1| PREDICTED: eukaryotic initiation factor 4A-15 [Populus euphratica]
Length=413

 Score =   387 bits (993),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D+KM ELLT + Q+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDAQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_011100200.1| PREDICTED: eukaryotic initiation factor 4A-14 [Sesamum indicum]
Length=413

 Score =   387 bits (993),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQ+DARQYDAKM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDARQYDAKMDELLGTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNIVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_008798133.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
 ref|XP_008798134.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
Length=413

 Score =   387 bits (993),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDSKMNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_003533770.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX1 
[Glycine max]
 ref|XP_003533771.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX2 
[Glycine max]
 ref|XP_006587022.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Glycine max]
 gb|KHN35869.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   386 bits (992),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_006597014.1| PREDICTED: uncharacterized protein LOC100786735 isoform X1 [Glycine 
max]
 ref|XP_006597015.1| PREDICTED: uncharacterized protein LOC100786735 isoform X2 [Glycine 
max]
 ref|XP_006597016.1| PREDICTED: uncharacterized protein LOC100786735 isoform X3 [Glycine 
max]
Length=457

 Score =   388 bits (996),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  44   VMAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  103

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRE
Sbjct  104  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRE  163

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  164  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  223

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  224  PDYIKMFVLDEADEMLSRG  242



>gb|KHN28839.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   386 bits (991),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010242273.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nelumbo nucifera]
Length=413

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMSELLTSDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010929385.1| PREDICTED: eukaryotic initiation factor 4A-15 [Elaeis guineensis]
Length=413

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNDLLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_010915249.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELLT +GQEFFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDSKMNELLTQDGQEFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_008782542.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008782543.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   385 bits (988),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYD KM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLVPEGSQFDARQYDTKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|NP_001242064.1| uncharacterized protein LOC100786735 [Glycine max]
 gb|ACU18275.1| unknown [Glycine max]
Length=413

 Score =   385 bits (988),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL++NLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQDNLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>sp|Q40471.1|IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9; Short=eIF-4A-9; 
AltName: Full=ATP-dependent RNA helicase eIF4A-9 [Nicotiana 
tabacum]
 emb|CAA55736.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+ SFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYHSFDAMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=413

 Score =   384 bits (986),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYDAKM ELL+ EGQEFFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMSELLSTEGQEFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_008220506.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Prunus mume]
Length=413

 Score =   384 bits (985),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_008801403.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
 ref|XP_008801404.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
Length=413

 Score =   383 bits (984),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVTPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>sp|Q40466.1|IF413_TOBAC RecName: Full=Eukaryotic initiation factor 4A-13; Short=eIF-4A-13; 
AltName: Full=ATP-dependent RNA helicase eIF4A-13, partial 
[Nicotiana tabacum]
 emb|CAA55741.1| unnamed protein product [Nicotiana tabacum]
Length=355

 Score =   381 bits (978),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>emb|CBI27885.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_004245077.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
 ref|XP_006351592.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Solanum tuberosum]
Length=413

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_010094955.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
 gb|EXB57648.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
Length=248

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYDAKM ELL  +G +FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVVPEGSQFDARQYDAKMNELLGSDGSDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>emb|CAN70196.1| hypothetical protein VITISV_040309 [Vitis vinifera]
Length=410

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_007222702.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
 gb|EMJ23901.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
Length=413

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KDP33852.1| hypothetical protein JCGZ_07423 [Jatropha curcas]
Length=413

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD+KM ELL  +G++FFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNELLATDGEDFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_006342504.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=413

 Score =   382 bits (980),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQ+DAKM ELL  E QEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>emb|CDP08290.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   382 bits (980),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 191/199 (96%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEG-QEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDARQYDAKM ELL  +G QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTDGGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  181  PDYIKMFVLDEADEMLSRG  199



>gb|AFC90091.1| eukaryotic initiation factor 4A-14 [Nicotiana benthamiana]
Length=413

 Score =   382 bits (980),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSR 
Sbjct  181  DHIKMFVLDEADEMLSRS  198



>ref|XP_009764703.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764704.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   381 bits (979),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_008798130.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798131.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798132.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
Length=413

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYDAK+ ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLPPEGSQFDARQYDAKLNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHAC GGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACFGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_012068942.1| PREDICTED: eukaryotic initiation factor 4A-8 [Jatropha curcas]
 gb|KDP40743.1| hypothetical protein JCGZ_24742 [Jatropha curcas]
Length=413

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYDAKM ELL+ +GQ+FFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMNELLSSDGQDFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYATVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_006426587.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006426588.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006465995.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X1 
[Citrus sinensis]
 ref|XP_006465996.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X2 
[Citrus sinensis]
 gb|ESR39827.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|ESR39828.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|KDO65148.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65149.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65150.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=413

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009604758.1| PREDICTED: eukaryotic initiation factor 4A-10 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_009780782.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Nicotiana 
sylvestris]
Length=413

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_009604756.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604757.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604759.1| PREDICTED: eukaryotic initiation factor 4A-7 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   381 bits (979),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>sp|P41382.1|IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10; Short=eIF-4A-10; 
AltName: Full=ATP-dependent RNA helicase eIF4A-10 [Nicotiana 
tabacum]
 emb|CAA55642.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55641.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   381 bits (979),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_009784285.1| PREDICTED: eukaryotic initiation factor 4A-14 [Nicotiana sylvestris]
Length=413

 Score =   381 bits (979),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera]
Length=413

 Score =   381 bits (979),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|ACU22915.1| unknown [Glycine max]
Length=225

 Score =   374 bits (960),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLLP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_004513437.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Cicer arietinum]
 ref|XP_004513438.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Cicer arietinum]
Length=413

 Score =   381 bits (978),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMHLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009399791.1| PREDICTED: eukaryotic initiation factor 4A-8 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   381 bits (978),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL+ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLSQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>sp|Q40467.1|IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14; Short=eIF-4A-14; 
AltName: Full=ATP-dependent RNA helicase eIF4A-14 [Nicotiana 
tabacum]
 emb|CAA55742.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   381 bits (978),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>sp|Q40470.1|IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7; Short=eIF-4A-7; 
AltName: Full=ATP-dependent RNA helicase eIF4A-7 [Nicotiana 
tabacum]
 emb|CAA55738.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   381 bits (978),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>sp|P41379.1|IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2 [Nicotiana 
plumbaginifolia]
 emb|CAA43513.1| nicotiana eukaryotic translation initiation factor 4A [Nicotiana 
plumbaginifolia]
Length=413

 Score =   381 bits (978),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQ+DAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_008793233.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008793234.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQ+D+KM ELLT +GQEFFTSYDEV+D+FD+M L+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDARQFDSKMNELLTQDGQEFFTSYDEVYDTFDSMNLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>gb|KJB56905.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=336

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009597977.1| PREDICTED: eukaryotic initiation factor 4A-15 [Nicotiana tomentosiformis]
Length=413

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+D+KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IK+FVLDEADEMLSRG
Sbjct  181  DHIKIFVLDEADEMLSRG  198



>ref|XP_004253093.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
Length=413

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQ+DAKM ELL  E Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>gb|KHG04102.1| Eukaryotic initiation factor 4A-14 [Gossypium arboreum]
Length=313

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|AAN74635.1| DEAD box RNA helicase [Pisum sativum]
 gb|AAR97917.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+Q+D KM ELLT EGQ+F+T Y+EV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDTKMNELLTTEGQDFYTFYEEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_003595233.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|ABN09109.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES65484.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_007138709.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
 gb|ESW10703.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
Length=413

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YD+KM ELLT + Q+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMNELLTTDAQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009385793.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM EL++ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMNELISQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_004303662.1| PREDICTED: eukaryotic initiation factor 4A-8 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFDA+QYD+KM E+L+ EGQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGAQFDAKQYDSKMNEILSSEGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_004146811.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis sativus]
 gb|KGN59802.1| hypothetical protein Csa_3G848120 [Cucumis sativus]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera]
 emb|CBI20640.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|EYU29343.1| hypothetical protein MIMGU_mgv1a007274mg [Erythranthe guttata]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA AAPEGSQFDARQ+DAKM E+L  EG EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQFDAKMNEILGAEGDEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTVVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_007215455.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
 ref|XP_008228255.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 ref|XP_008228256.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|EMJ16654.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
Length=413

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD KM ELL+ +GQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KJB56903.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
 gb|KJB56904.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=413

 Score =   379 bits (973),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009403035.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   379 bits (973),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDE+ +SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMTELLTADGQEFFTSYDEICESFDDMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_008447621.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis melo]
 gb|ADN33729.1| helicase [Cucumis melo subsp. melo]
Length=413

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_009602748.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana tomentosiformis]
 ref|XP_009791873.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana sylvestris]
Length=413

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DNIKMFVLDEADEMLSRG  198



>sp|Q40465.1|IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11; Short=eIF-4A-11; 
AltName: Full=ATP-dependent RNA helicase eIF4A-11 [Nicotiana 
tabacum]
 emb|CAA55737.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DNIKMFVLDEADEMLSRG  198



>ref|XP_007024535.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY27157.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   378 bits (971),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL  +G EFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_003543580.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Glycine max]
 ref|XP_003546753.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X1 
[Glycine max]
 ref|XP_006597198.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Glycine max]
Length=413

 Score =   378 bits (971),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>gb|KJB70132.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
 gb|KJB70133.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
Length=413

 Score =   378 bits (971),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KHG23060.1| Eukaryotic initiation factor 4A-9 [Gossypium arboreum]
Length=224

 Score =   371 bits (953),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  180  DHIKMFVLDEADEMLSRG  197



>sp|Q40468.1|IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15; Short=eIF-4A-15; 
AltName: Full=ATP-dependent RNA helicase eIF4A-15 [Nicotiana 
tabacum]
 emb|CAA55739.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKV ACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVTACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_004291063.1| PREDICTED: eukaryotic initiation factor 4A-2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFD RQYDAKM ELL  +GQ+FFTSYDEVHDSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDTRQYDAKMTELLGSDGQDFFTSYDEVHDSFDVMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQR+LSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRVLSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D I+MFVLDEADEMLSRG
Sbjct  181  DCIRMFVLDEADEMLSRG  198



>ref|XP_008392378.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KHN30068.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLLENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_008379513.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KHN06630.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLLP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_008377701.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Malus domestica]
Length=413

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFD  QYDAKM ELL  +GQ+FFTSYDE+HDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELLGADGQDFFTSYDEIHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010927212.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Elaeis guineensis]
Length=413

 Score =   377 bits (967),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYD KM ELLT +GQ+FFT+YDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGQVPEGSQFDARQYDTKMNELLTADGQDFFTTYDEVYDSFDAMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALV APTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVFAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHAC GGTSVREDQRILSSGVHVVVGTPGRVFDML+RQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACFGGTSVREDQRILSSGVHVVVGTPGRVFDMLQRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>emb|CBI35913.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGV+VHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVRVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009415521.1| PREDICTED: eukaryotic initiation factor 4A-15 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   376 bits (966),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D KM +LL+ +GQEFFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQFDTKMNDLLSADGQEFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_009372398.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
 ref|XP_009340681.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
Length=413

 Score =   376 bits (966),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|ACJ84921.1| unknown [Medicago truncatula]
 gb|AFK40621.1| unknown [Medicago truncatula]
Length=413

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLR IYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRDIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTR+L
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRKL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009389913.1| PREDICTED: eukaryotic initiation factor 4A-11 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   376 bits (965),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFDARQYDAKM ELL+ + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMTPEGSQFDARQYDAKMNELLSQDVQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DNIKMFVLDEADEMLSRG  198



>gb|EPS65096.1| hypothetical protein M569_09681 [Genlisea aurea]
Length=413

 Score =   376 bits (965),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA ++DAKM E+L  EG+EFFT+YDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDAKMNEILGGEGEEFFTNYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|EYU29345.1| hypothetical protein MIMGU_mgv1a007246mg [Erythranthe guttata]
Length=413

 Score =   375 bits (964),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA   PEGS FDARQ+DAKM E+L  EG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MADKVPEGSNFDARQFDAKMDEILGAEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis sativus]
 gb|KGN45514.1| hypothetical protein Csa_7G450710 [Cucumis sativus]
Length=413

 Score =   375 bits (964),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|XP_006338111.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Solanum tuberosum]
 ref|XP_006338112.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Solanum tuberosum]
Length=414

 Score =   375 bits (964),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 193/199 (97%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>ref|XP_008462340.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis melo]
Length=413

 Score =   375 bits (964),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>gb|KHN17683.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   375 bits (964),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDY GVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+P
Sbjct  121  AQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_007136846.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
 gb|ESW08840.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
Length=413

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDGRHYDAKMDELLGADGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_007150491.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
 gb|ESW22485.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
Length=413

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMSELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_008337727.1| PREDICTED: eukaryotic initiation factor 4A-11 [Malus domestica]
Length=412

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  180  GAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEK  359
             AAPEGSQFD RQYD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEK
Sbjct  2    AAAPEGSQFDTRQYDTKMSELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEK  61

Query  360  PSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQ  539
            PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQ
Sbjct  62   PSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQ  121

Query  540  QIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDY  719
            QIEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRPD 
Sbjct  122  QIEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLRPDS  181

Query  720  IKMFVLDEADEMLSRG  767
            IKMFVLDEADEMLSRG
Sbjct  182  IKMFVLDEADEMLSRG  197



>gb|KHN32709.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>gb|KJB34989.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
 gb|KJB34990.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
Length=413

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D KM +LL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDQKMSDLLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>emb|CDO97887.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYD +M+ELL+ +GQ+FFTSYDEVHD+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDTRMKELLSADGQDFFTSYDEVHDTFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILLAGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DSIKMFVLDEADEMLSRG  198



>ref|XP_002304104.1| translation initiation factor 4A family protein [Populus trichocarpa]
 ref|XP_002304185.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
 gb|ABK94270.1| unknown [Populus trichocarpa]
 gb|EEE79083.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|EEE79164.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
Length=413

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_011010150.1| PREDICTED: eukaryotic initiation factor 4A-8 [Populus euphratica]
Length=413

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|AIZ68204.1| eukaryotic initiation factor 4A-14 [Ornithogalum saundersiae]
Length=413

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD+KM +LL  +GQ+FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNDLLAGDGQDFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVI+QAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIRQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|KHN39326.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|XP_003531602.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
 gb|KHN11260.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|XP_006583001.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>gb|ACU21478.1| unknown [Glycine max]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|NP_001058481.1| Os06g0701100 [Oryza sativa Japonica Group]
 sp|P35683.2|IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Oryza sativa 
Japonica Group]
 dbj|BAD54014.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAD53769.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAF20395.1| Os06g0701100 [Oryza sativa Japonica Group]
 gb|EAZ38180.1| hypothetical protein OsJ_22532 [Oryza sativa Japonica Group]
 dbj|BAG94357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  181  PDYIKMFVLDEADEMLSRG  199



>gb|AAR23806.1| initiation factor eIF4A-15 [Helianthus annuus]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDSKMNDLLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DNIKMFVLDEADEMLSRG  198



>dbj|BAA02152.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAB21260.1| eukaryotic initiation factor 4A [Oryza sativa]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  181  PDYIKMFVLDEADEMLSRG  199



>ref|XP_003522265.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN29706.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D I+MFVLDEADEMLSRG
Sbjct  181  DNIRMFVLDEADEMLSRG  198



>ref|XP_007012323.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29942.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=412

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA AAPEGSQFDARQYDAKM EL   +GQEFFT+YDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMNEL-EADGQEFFTTYDEVYDTFDSMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  180  DHIKMFVLDEADEMLSRG  197



>gb|KJB54655.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
 gb|KJB54656.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
Length=412

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  180  DHIKMFVLDEADEMLSRG  197



>ref|XP_006656443.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006656444.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  181  PDYIKMFVLDEADEMLSRG  199



>ref|XP_010033764.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Eucalyptus 
grandis]
 gb|KCW53567.1| hypothetical protein EUGRSUZ_J028421 [Eucalyptus grandis]
Length=412

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFD RQ+D+K+ EL T E QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDPRQFDSKINEL-TTEAQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQ+LVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVQCQSLVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  180  DYIKMFVLDEADEMLSRG  197



>gb|EAZ02256.1| hypothetical protein OsI_24355 [Oryza sativa Indica Group]
Length=426

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  181  PDYIKMFVLDEADEMLSRG  199



>ref|XP_009381599.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA QYDAKM+ELL  +GQ+FFTSYD+V++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMKELLNADGQDFFTSYDDVYESFDKMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLGPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLLP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_006342502.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=410

 Score =   374 bits (960),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +3

Query  186  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  365
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  366  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  545
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  546  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK  725
            EKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRPD+IK
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRPDHIK  181

Query  726  MFVLDEADEMLSRG  767
            MFVLDEADEMLSRG
Sbjct  182  MFVLDEADEMLSRG  195



>ref|XP_004253094.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum lycopersicum]
Length=410

 Score =   374 bits (960),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +3

Query  186  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  365
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  366  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  545
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  546  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK  725
            EKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRPD+IK
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRPDHIK  181

Query  726  MFVLDEADEMLSRG  767
            MFVLDEADEMLSRG
Sbjct  182  MFVLDEADEMLSRG  195



>ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-8 [Vitis vinifera]
Length=413

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGV+VHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVRVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_007202168.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
 gb|EMJ03367.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
Length=411

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  183  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  362
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  2    AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  61

Query  363  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  542
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  121

Query  543  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYI  722
            IEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRPD I
Sbjct  122  IEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLRPDNI  181

Query  723  KMFVLDEADEMLSRG  767
            KMFVLDEADEMLSRG
Sbjct  182  KMFVLDEADEMLSRG  196



>ref|XP_007135520.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 ref|XP_007135521.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07514.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07515.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
Length=413

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|XP_006357714.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic initiation factor 
4A-9-like [Solanum tuberosum]
Length=413

 Score =   373 bits (958),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE LLRGIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEKLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYELLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVM+ALGDYL VKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMQALGDYLKVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_011079970.1| PREDICTED: eukaryotic initiation factor 4A-8 [Sesamum indicum]
Length=413

 Score =   373 bits (958),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD R YD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRHYDTKMNELLQSDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>gb|EYU21355.1| hypothetical protein MIMGU_mgv1a0072631mg [Erythranthe guttata]
Length=413

 Score =   373 bits (958),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD RQ+D++M ELL VEG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRQFDSRMNELLQVEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DSIKMFVLDEADEMLSRG  198



>ref|XP_010049453.1| PREDICTED: eukaryotic initiation factor 4A-15 [Eucalyptus grandis]
 gb|KCW82050.1| hypothetical protein EUGRSUZ_C03418 [Eucalyptus grandis]
Length=413

 Score =   373 bits (958),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGS FD+RQ+DAKM ELL+ +G++FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSAFDSRQFDAKMSELLSADGEDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IK+FVLDEADEMLSRG
Sbjct  181  DHIKIFVLDEADEMLSRG  198



>gb|AFK40852.1| unknown [Lotus japonicus]
Length=413

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+QYD+KM ELL  +GQEFFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMTELLATDGQEFFTSYDEVYDTFDSMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DSIKMFVLDEADEMLSRG  198



>ref|XP_009410226.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA QYDAKM +LL  +GQ+FFT YDEVH+SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMNDLLNADGQDFFTLYDEVHESFDEMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVKCQALVLGPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLLP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_006338110.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Solanum tuberosum]
Length=416

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 192/199 (96%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            + G+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  3    IVGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  62

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  122

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  182

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  183  PDHIKMFVLDEADEMLSRG  201



>ref|XP_003563508.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
 ref|XP_010227424.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
Length=414

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>ref|XP_010262239.1| PREDICTED: uncharacterized protein LOC104600806 [Nelumbo nucifera]
Length=929

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYG
Sbjct  516  VMAGLAPEGSQFDARQYDAKMSELLTADGQDFFTSYDEVYESFDAMGLQENLLRGIYAYG  575

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  576  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  635

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  636  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  695

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  696  PDYIKMFVLDEADEMLSRG  714



>ref|XP_010656491.1| PREDICTED: uncharacterized protein LOC100244028 [Vitis vinifera]
Length=827

 Score =   385 bits (988),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  414  VMAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYG  473

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  474  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  533

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  534  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  593

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  594  PDYIKMFVLDEADEMLSRG  612



>ref|XP_006853908.1| PREDICTED: eukaryotic initiation factor 4A-3 [Amborella trichopoda]
 gb|ERN15375.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
Length=412

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = +3

Query  186  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  365
            APEGSQFDARQYDAKM ELL  +G++FF SYDEV +SFD+MGL+ENLLRGIYAYGFEKPS
Sbjct  4    APEGSQFDARQYDAKMSELLQADGEDFFASYDEVFESFDSMGLQENLLRGIYAYGFEKPS  63

Query  366  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  545
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRELAQQI
Sbjct  64   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLECQALVLAPTRELAQQI  123

Query  546  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK  725
            EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK
Sbjct  124  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK  183

Query  726  MFVLDEADEMLSRG  767
            MFVLDEADEMLSRG
Sbjct  184  MFVLDEADEMLSRG  197



>ref|XP_006474427.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Citrus sinensis]
Length=413

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MAGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYMGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>dbj|BAJ85348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>dbj|BAJ89461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT12089.1| Eukaryotic initiation factor 4A [Aegilops tauschii]
Length=414

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>dbj|BAJ96964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   371 bits (952),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQAL+LAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALILAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_012077530.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Jatropha 
curcas]
Length=784

 Score =   382 bits (982),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDA+QYD+KM ELL  +G++FFT+YDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  371  VMAGLAPEGSQFDAKQYDSKMNELLATDGEDFFTTYDEVYDSFDSMGLQENLLRGIYAYG  430

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  431  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  490

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  491  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  550

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  551  PDYIKMFVLDEADEMLSRG  569



>ref|XP_003526019.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN32198.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   370 bits (951),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVH CVGGT VREDQRILSSGVHVVVGTPGRVFDML RQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHVCVGGTIVREDQRILSSGVHVVVGTPGRVFDMLCRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D I+MFVLDEADEMLSRG
Sbjct  181  DNIRMFVLDEADEMLSRG  198



>gb|AAY33860.1| eukaryotic initiation factor 4A [Cenchrus americanus]
Length=414

 Score =   370 bits (951),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>ref|XP_009798256.1| PREDICTED: eukaryotic initiation factor 4A-8 [Nicotiana sylvestris]
Length=413

 Score =   370 bits (951),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHV+VGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVIVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DY++MFVLDEADEMLSRG
Sbjct  181  DYLRMFVLDEADEMLSRG  198



>ref|XP_004966111.1| PREDICTED: eukaryotic initiation factor 4A-3-like [Setaria italica]
Length=414

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELL-TVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL T E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>sp|P41381.1|IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8; Short=eIF-4A-8; 
AltName: Full=ATP-dependent RNA helicase eIF4A-8 [Nicotiana 
tabacum]
 emb|CAA55639.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55640.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHV+VGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVIVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DY++MFVLDEADEMLSRG
Sbjct  181  DYLRMFVLDEADEMLSRG  198



>ref|XP_010062659.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Eucalyptus 
grandis]
 gb|KCW69788.1| hypothetical protein EUGRSUZ_F03152 [Eucalyptus grandis]
Length=412

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD RQYD K+ EL + +G EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDPRQYDEKISEL-SADGGEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  180  DYIKMFVLDEADEMLSRG  197



>ref|NP_001105396.1| translational initiation factor eIF-4A [Zea mays]
 gb|AAB67607.1| translational initiation factor eIF-4A [Zea mays]
Length=414

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>gb|KEH32494.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=430

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYG
Sbjct  17   VMAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYG  76

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTRE
Sbjct  77   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTRE  136

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSL 
Sbjct  137  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLH  196

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  197  PDYIKMFVLDEADEMLSRG  215



>ref|XP_009361722.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=868

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 211/241 (88%), Gaps = 3/241 (1%)
 Frame = +3

Query  54   LPQLQGLDPRSLGKP---*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYD  224
            +PQL+GLDPRSLG P      ++ +  ALSLSL      SS  +  AAPEGSQFD RQYD
Sbjct  413  IPQLRGLDPRSLGNPNSQKTRTKISCDALSLSLRLQLSHSSLAVMAAAPEGSQFDTRQYD  472

Query  225  AKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNG  404
             KM E+L  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC G
Sbjct  473  TKMSEILATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKG  532

Query  405  LDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGV  584
            LDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQIEKVMRALGDYLGV
Sbjct  533  LDVIQQAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQQIEKVMRALGDYLGV  592

Query  585  KVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSR  764
            +VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP+ IKMFVLDEADEMLSR
Sbjct  593  RVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLRPNSIKMFVLDEADEMLSR  652

Query  765  G  767
            G
Sbjct  653  G  653



>gb|AFW75865.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW75866.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=414

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_006453066.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|ESR66306.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|KDO73515.1| hypothetical protein CISIN_1g0150931mg [Citrus sinensis]
Length=413

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            M G APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MEGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYMGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  181  DYIRMFVLDEADEMLSRG  198



>ref|XP_002438954.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
 gb|EER90321.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
Length=414

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_006601410.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Glycine 
max]
Length=853

 Score =   383 bits (983),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 209/236 (89%), Gaps = 4/236 (2%)
 Frame = +3

Query  60   QLQGLDPRSLGKP*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYDAKMQE  239
            +L+G+DPRS G P      +SF       SL   S+ VMAG APEGSQFDARQYD+KM +
Sbjct  407  RLRGVDPRSSGNP----NSSSFTTEQRFFSLSIISTEVMAGLAPEGSQFDARQYDSKMSD  462

Query  240  LLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNGLDVIQ  419
            LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC GLDVIQ
Sbjct  463  LLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQ  522

Query  420  QAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHAC  599
            QAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQIEKVMRALGDY GVKVHAC
Sbjct  523  QAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHAC  582

Query  600  VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRG  767
            VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+PD+IKMFVLDEADEMLSRG
Sbjct  583  VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQPDHIKMFVLDEADEMLSRG  638



>ref|XP_009624936.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   369 bits (947),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMSLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DY++MFVLDEADEMLSRG
Sbjct  181  DYLRMFVLDEADEMLSRG  198



>gb|KHG25459.1| Eukaryotic initiation factor 4A-8 [Gossypium arboreum]
Length=288

 Score =   364 bits (935),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG AP+ SQ+DARQYD+KM ELL  +G +FFT+YDEV++SFD MGL+ENLLRGIYAYG
Sbjct  36   VMAGVAPDVSQYDARQYDSKMNELLADDGNDFFTTYDEVYESFDKMGLQENLLRGIYAYG  95

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTRE
Sbjct  96   FEKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRE  155

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  156  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  215

Query  711  PDYIKMFVLDEADEMLSRG  767
             DYIKMFVLDEADEMLSRG
Sbjct  216  ADYIKMFVLDEADEMLSRG  234



>ref|XP_011072546.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Sesamum indicum]
Length=412

 Score =   369 bits (947),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG AP GSQFDAR+YDAKM E+L V+GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPAGSQFDAREYDAKM-EVLQVDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRA  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYI+MFVLDEADEMLSRG
Sbjct  180  DYIRMFVLDEADEMLSRG  197



>gb|KEH32495.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   369 bits (947),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLHP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>sp|P41378.1|IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Triticum aestivum]
Length=414

 Score =   369 bits (946),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFD++RRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDIVRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_010322836.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322837.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322838.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   369 bits (946),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  3    VMARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  62

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTRE  122

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  182

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD ++MFVLDEADEMLSRG
Sbjct  183  PDCLRMFVLDEADEMLSRG  201



>ref|XP_010552222.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
 ref|XP_010552223.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
Length=215

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+D K+ ++L   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDQKLNDVLE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLGPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  180  DYIKMFVLDEADEMLSRG  197



>gb|KJB65513.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65514.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65516.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65517.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
Length=413

 Score =   369 bits (946),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG AP+GSQ+DARQYD+KM ELL  +G +FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPDGSQYDARQYDSKMNELLADDGNDFFTSYDEVYESFDKMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010669372.1| PREDICTED: eukaryotic initiation factor 4A-9 [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   368 bits (945),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQ+DARQYD KM ELL+ EG +FFTSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQYDARQYDNKMSELLSEEGSDFFTSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYENLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            + IKMFVLDEADEMLSRG
Sbjct  181  NSIKMFVLDEADEMLSRG  198



>gb|ACN34609.1| unknown [Zea mays]
 gb|AFW69338.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=414

 Score =   368 bits (945),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_003597562.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AES67813.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD +Q+D KM ELL+ EGQEFFTSYDEVH++FDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTKQFDTKMNELLSTEGQEFFTSYDEVHETFDAMGLLENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DCIKMFVLDEADEMLSRG  198



>ref|XP_009334733.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Pyrus x bretschneideri]
Length=413

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFD  QYDAKM EL+  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRC  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>gb|EMS68416.1| Eukaryotic initiation factor 4A-1 [Triticum urartu]
 gb|EMT30822.1| Eukaryotic initiation factor 4A-1 [Aegilops tauschii]
Length=414

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+QYD+KM ELL   +  EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKQYDSKMTELLNQGDTGEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_007154632.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
 gb|ESW26626.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
Length=413

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGS FD R +D+KM +LL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSNFDTRHFDSKMSDLLSSDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DNIKMFVLDEADEMLSRG  198



>ref|XP_004951905.1| PREDICTED: eukaryotic initiation factor 4A-like [Setaria italica]
Length=410

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 3/198 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD +QYD KMQELLT   +EFFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGKQYDNKMQELLT---EEFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRP  177

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  178  DNIKMFVLDEADEMLSRG  195



>emb|CDY72259.1| BnaCnng76770D, partial [Brassica napus]
Length=222

 Score =   360 bits (923),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 188/200 (94%), Gaps = 3/200 (2%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  347
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAY
Sbjct  8    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAY  65

Query  348  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  527
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  66   GFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTR  125

Query  528  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  707
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSL
Sbjct  126  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSL  185

Query  708  RPDYIKMFVLDEADEMLSRG  767
            R D IKMFVLDEADEMLSRG
Sbjct  186  RADNIKMFVLDEADEMLSRG  205



>ref|XP_004510408.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=413

 Score =   367 bits (941),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA  YD KM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDTKMNELLASDGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGD+LGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSL  
Sbjct  121  AQQIEKVMRALGDFLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLVS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  181  DRIKMFVLDEADEMLSRG  198



>ref|XP_010322839.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Solanum 
lycopersicum]
Length=413

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D ++MFVLDEADEMLSRG
Sbjct  181  DCLRMFVLDEADEMLSRG  198



>ref|XP_003574572.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brachypodium 
distachyon]
Length=414

 Score =   366 bits (940),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD KM ELL   E +EFFTSYDEVH+SFD M L+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDTKMTELLNQGETEEFFTSYDEVHESFDDMSLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRR SLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRSSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>ref|XP_006453067.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006453068.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006474428.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Citrus sinensis]
 gb|ESR66307.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|ESR66308.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|KDO73513.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
 gb|KDO73514.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
Length=412

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A EGSQFDARQ+DA+M +LL  +GQ+FFTSYDEV+D+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLA-EGSQFDARQFDARMNDLLGSDGQDFFTSYDEVYDTFDAMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D I++FVLDEADEMLSRG
Sbjct  180  DNIRIFVLDEADEMLSRG  197



>ref|XP_006595337.1| PREDICTED: eukaryotic initiation factor 4A-14 [Glycine max]
Length=794

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  381  VMAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  440

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  441  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRE  500

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL 
Sbjct  501  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLL  560

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  561  PDHIKMFVLDEADEMLSRG  579



>ref|NP_001045878.1| Os02g0146600 [Oryza sativa Japonica Group]
 sp|Q6Z2Z4.1|IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23; AltName: Full=eIF4A-2 
[Oryza sativa Japonica Group]
 dbj|BAD13081.1| putative translational initiation factor eIF-4A [Oryza sativa 
Japonica Group]
 dbj|BAF07792.1| Os02g0146600 [Oryza sativa Japonica Group]
 gb|EAY84464.1| hypothetical protein OsI_05839 [Oryza sativa Indica Group]
 dbj|BAG93556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56296.1| hypothetical protein OsJ_05367 [Oryza sativa Japonica Group]
 gb|AGT42311.1| eucaryotic initiation factor [Oryza sativa Japonica Group]
Length=414

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQ+LVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQSLVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD+IKMFVLDEADEMLSRG
Sbjct  181  PDHIKMFVLDEADEMLSRG  199



>ref|NP_001104874.1| translation initiation factor [Zea mays]
 gb|AAB64289.1| translation initiation factor [Zea mays]
Length=414

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIY YG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYRYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_011046150.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
 ref|XP_011046151.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
Length=413

 Score =   365 bits (938),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTIVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_003627168.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AET01644.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   365 bits (938),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA  YD+KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDSKMNELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGD+LGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDFLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRS  180

Query  714  DYIKMFVLDEADEMLSRG  767
            + IKMFVLDEADEMLSRG
Sbjct  181  ECIKMFVLDEADEMLSRG  198



>ref|XP_002514133.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF48087.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=764

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA+ +D+KM ELLT +G++FFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  352  MAGLAPEGSQFDAKHFDSKMNELLTADGEDFFTTYDEVYESFDSMGLQENLLRGIYAYGF  411

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQA VLAPTREL
Sbjct  412  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALVECQAXVLAPTREL  471

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  472  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  531

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  532  DYIKMFVLDEADEMLSRG  549



>ref|XP_007012776.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 ref|XP_007012777.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30395.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30396.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQFDARQ+D+KM + L  +GQ+   S+DEV+D+FDAMGL +NLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNDFLLADGQDVIASWDEVYDTFDAMGLLQNLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRR+SLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRKSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>ref|XP_010087709.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
 gb|EXB29697.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
Length=423

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A EG+QFDAR+YDAKM ELL+ +GQ+FFTSYDEVH+SFD+MGL E LLRGIYAYGF
Sbjct  11   MAGLASEGTQFDARKYDAKMNELLSNDGQDFFTSYDEVHESFDSMGLLEKLLRGIYAYGF  70

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQ LDYD V+CQALVLAPTREL
Sbjct  71   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQLLDYDLVQCQALVLAPTREL  130

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSL  
Sbjct  131  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLCS  190

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  191  DYIKMFVLDEADEMLSRG  208



>ref|XP_006646878.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006646879.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEGSQFDA+ YD KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDNKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  181  PDNIKMFVLDEADEMLSRG  199



>ref|XP_010534921.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D K+ +LL   G EFFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLLD-GGDEFFTSYDEVCESFDAMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  180  DYIKMFVLDEADEMLSRG  197



>emb|CDY02469.1| BnaA08g00760D [Brassica napus]
Length=412

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>ref|XP_006369263.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 ref|XP_006369264.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|ABK93256.1| unknown [Populus trichocarpa]
 gb|ERP65832.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 gb|ERP65833.1| translation initiation factor 4A family protein [Populus trichocarpa]
Length=413

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRQ  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_002451536.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
 gb|EES04512.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
Length=410

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 3/198 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRP  177

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  178  DNIKMFVLDEADEMLSRG  195



>emb|CDY55205.1| BnaCnng28430D [Brassica napus]
Length=423

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             DYIKMFVLDEADEMLSRG
Sbjct  179  ADYIKMFVLDEADEMLSRG  197



>ref|XP_006392695.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
 gb|ESQ29981.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
Length=412

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAGAAPEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGAAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  179  PDCIKMFVLDEADEMLSRG  197



>ref|XP_009106914.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Brassica rapa]
 ref|XP_009106915.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Brassica rapa]
Length=412

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>ref|XP_007012324.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29943.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=413

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A +GSQ+DA QYD+KM ELL+ EG+EFFT+YDEV +SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGLATDGSQYDAHQYDSKMNELLSDEGKEFFTTYDEVCESFDKMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D I+MFVLDEADEMLSRG
Sbjct  181  DAIRMFVLDEADEMLSRG  198



>ref|XP_009334734.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X3 
[Pyrus x bretschneideri]
Length=413

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFD  QYDAKM + +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSDRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRC  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>emb|CDX82505.1| BnaA03g33160D [Brassica napus]
Length=428

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 189/200 (95%), Gaps = 3/200 (2%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  347
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAY
Sbjct  4    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAY  61

Query  348  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  527
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  62   GFEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTR  121

Query  528  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  707
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSL
Sbjct  122  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSL  181

Query  708  RPDYIKMFVLDEADEMLSRG  767
            R D IKMFVLDEADEMLSRG
Sbjct  182  RADSIKMFVLDEADEMLSRG  201



>ref|XP_006297793.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
 gb|EOA30691.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
Length=412

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|NP_001151064.1| LOC100284697 [Zea mays]
 gb|ACF79496.1| unknown [Zea mays]
 gb|ACG41480.1| eukaryotic initiation factor 4A [Zea mays]
Length=410

 Score =   363 bits (932),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 187/198 (94%), Gaps = 3/198 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRP  177

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  178  DNIKMFVLDEADEMLSRG  195



>sp|Q41741.1|IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Zea mays]
 gb|AAA82736.1| translation initiation factor eIF-4A [Zea mays]
Length=410

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 187/198 (94%), Gaps = 3/198 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRP  177

Query  714  DYIKMFVLDEADEMLSRG  767
            D IKMFVLDEADEMLSRG
Sbjct  178  DNIKMFVLDEADEMLSRG  195



>emb|CDP03140.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A +GSQFDARQYD KM +LL+  GQ+FFTSYDEV DSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVATDGSQFDARQYDTKMSDLLSAGGQDFFTSYDEVWDSFDGMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+ QALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQSQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDML+R+SLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLQRRSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D++KMFVLDEADEMLSRG
Sbjct  181  DHLKMFVLDEADEMLSRG  198



>ref|XP_010501441.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010465264.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010487172.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
Length=412

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>gb|ACU18673.1| unknown [Glycine max]
Length=234

 Score =   357 bits (915),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDE  743
            D IKMFVLDE
Sbjct  181  DCIKMFVLDE  190



>ref|XP_010542416.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   363 bits (931),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDARQ+D K+ +L+   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLIE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  180  DHIKMFVLDEADEMLSRG  197



>ref|XP_009598422.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=208

 Score =   355 bits (912),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            M  A  EGSQFDARQ+DAK+ ELL+ +GQEFFTS DEV+DSFD MGLKENLLRGIYAYGF
Sbjct  1    MPSAVTEGSQFDARQFDAKITELLSGDGQEFFTSCDEVYDSFDDMGLKENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYKLLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDY+ VK HACVGGTSVREDQ +LS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYIDVKAHACVGGTSVREDQLVLSNGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEAD+MLSRG
Sbjct  181  DYIKMFVLDEADKMLSRG  198



>ref|XP_006307670.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
 gb|EOA40568.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
Length=412

 Score =   363 bits (931),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 187/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>gb|AFW69337.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=411

 Score =   363 bits (931),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = +3

Query  186  APEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  362
            APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYGFEKP
Sbjct  2    APEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYGFEKP  61

Query  363  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  542
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRELAQQ  121

Query  543  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYI  722
            IEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLRPD I
Sbjct  122  IEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLRPDNI  181

Query  723  KMFVLDEADEMLSRG  767
            KMFVLDEADEMLSRG
Sbjct  182  KMFVLDEADEMLSRG  196



>ref|XP_010688701.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAPEGSQ+DARQYD KM ELL+ +G +F TSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQYDARQYDNKMSELLSEDGGDFITSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            + IKMFVLDEADEMLSRG
Sbjct  181  NSIKMFVLDEADEMLSRG  198



>ref|XP_009135344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>gb|EYU45869.1| hypothetical protein MIMGU_mgv1a007331mg [Erythranthe guttata]
Length=410

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  186  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  365
            A EGSQFD RQYD++M E+L  + QEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDTRQYDSRMSEILQPDQQEFFTSYDEVHESFDAMGLQENLLRGIYAYGFEKPS  61

Query  366  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  545
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQI  121

Query  546  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIK  725
            EKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR DYIK
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRADYIK  181

Query  726  MFVLDEADEMLSRG  767
            +FVLDEADEMLSRG
Sbjct  182  IFVLDEADEMLSRG  195



>ref|XP_006407149.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
 gb|ESQ48602.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
Length=412

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 189/199 (95%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D+IKMFVLDEADEMLSRG
Sbjct  179  ADHIKMFVLDEADEMLSRG  197



>ref|XP_006357392.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Solanum tuberosum]
Length=413

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  A +G+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLATDGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D ++MFVLDEADEMLSRG
Sbjct  181  DCLRMFVLDEADEMLSRG  198



>emb|CDX97528.1| BnaA05g25510D [Brassica napus]
Length=425

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D+IKMFVLDEADEMLSRG
Sbjct  179  ADHIKMFVLDEADEMLSRG  197



>ref|XP_002884997.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61256.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>emb|CDY10607.1| BnaC03g70070D [Brassica napus]
Length=411

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 187/199 (94%), Gaps = 4/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D K+ E   V+GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNE---VQGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  57

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  58   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  117

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  177

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  178  ADSIKMFVLDEADEMLSRG  196



>ref|XP_009334732.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X1 
[Pyrus x bretschneideri]
Length=414

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQEL-LTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MA  APEGSQFD  QYDAKM E  +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEFRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
             DYIKMFVLDEADEMLSRG
Sbjct  181  CDYIKMFVLDEADEMLSRG  199



>ref|XP_009334735.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X4 
[Pyrus x bretschneideri]
Length=412

 Score =   362 bits (928),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MA  APEGSQFD  QYDAKM E+   EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEV-GAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR 
Sbjct  120  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRC  179

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  180  DYIKMFVLDEADEMLSRG  197



>ref|XP_004486853.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=412

 Score =   362 bits (928),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG AP+GSQFDA+QYD+KM ELLT +GQEF   YDEV+D+FDAM L+ENLLRGIYAYGF
Sbjct  1    MAGLAPDGSQFDAKQYDSKMNELLT-DGQEFGVEYDEVYDTFDAMKLEENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL  GVH VVGTPGRVFDMLRRQSLRP
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQGGVHTVVGTPGRVFDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            +YIKMFVLDEADEMLSRG
Sbjct  180  EYIKMFVLDEADEMLSRG  197



>emb|CDX75739.1| BnaC03g38220D [Brassica napus]
Length=436

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>ref|XP_010536184.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Tarenaya hassleriana]
Length=412

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A EGS +DARQYD++M ELLT EG++FF++YDEV++SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGVA-EGSLYDARQYDSRMSELLTEEGKDFFSTYDEVYESFDKMGLKENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD ++CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLLQCQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLRA  179

Query  714  DYIKMFVLDEADEMLSRG  767
            D+I+MFVLDEADEMLSRG
Sbjct  180  DHIRMFVLDEADEMLSRG  197



>ref|XP_009107078.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  SDSIKMFVLDEADEMLSRG  197



>emb|CDY39079.1| BnaA01g29770D [Brassica napus]
Length=412

 Score =   361 bits (926),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 187/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>gb|EPS63850.1| hypothetical protein M569_10933 [Genlisea aurea]
Length=413

 Score =   361 bits (926),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA ++D KM E+L  EG+EFFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDTKMNEILGGEGEEFFTNYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIRGLDVIQQAQSGTGKTATFCSGILQQLDYSVVDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRILS+GVHVVVGTPGRVFDMLRRQSLRP
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTIVREDQRILSTGVHVVVGTPGRVFDMLRRQSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IK+FVLDEADEMLSRG
Sbjct  181  DRIKIFVLDEADEMLSRG  198



>emb|CDY08220.1| BnaA05g13990D [Brassica napus]
Length=412

 Score =   361 bits (926),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  SDSIKMFVLDEADEMLSRG  197



>dbj|BAH56988.1| AT3G13920 [Arabidopsis thaliana]
Length=398

 Score =   360 bits (924),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|XP_008242400.1| PREDICTED: eukaryotic initiation factor 4A-2 [Prunus mume]
Length=806

 Score =   372 bits (956),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  183  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  362
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  397  AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  456

Query  363  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  542
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  457  SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  516

Query  543  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYI  722
            IEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLRPD I
Sbjct  517  IEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLRPDNI  576

Query  723  KMFVLDEADEMLSRG  767
            KMFVLDEADEMLSRG
Sbjct  577  KMFVLDEADEMLSRG  591



>gb|AAL91176.1| eukaryotic translation initiation factor [Arabidopsis thaliana]
Length=412

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|NP_566469.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 sp|P41376.1|IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Arabidopsis thaliana]
 emb|CAA46188.1| eukaryotic translation initiation factor 4A-1 [Arabidopsis thaliana]
 dbj|BAB02322.1| eukaryotic translation initiation factor; RNA helicase [Arabidopsis 
thaliana]
 emb|CAC43288.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
 gb|AAK93634.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAK96536.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM14243.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM19972.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM98124.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31802.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AEE75438.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=412

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>gb|AAM63951.1| Eukaryotic initiation factor 4A, putative [Arabidopsis thaliana]
Length=412

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|XP_010480021.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>ref|XP_002891805.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68064.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+A EG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAAEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDY GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  179  PDCIKMFVLDEADEMLSRG  197



>ref|XP_010090077.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
 gb|EXB38874.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
Length=857

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 190/198 (96%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG A EGSQFDARQ+DAKM ++L+ +GQ+FFT+YDEV+D+FDAMGL ENLLRGIYAYGF
Sbjct  446  MAGVA-EGSQFDARQFDAKMNDILSADGQDFFTTYDEVYDTFDAMGLHENLLRGIYAYGF  504

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQL+Y  VECQALVLAPTREL
Sbjct  505  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLEYGLVECQALVLAPTREL  564

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP
Sbjct  565  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  624

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  625  DYIKMFVLDEADEMLSRG  642



>gb|ABR18348.1| unknown [Picea sitchensis]
 gb|ACN39814.1| unknown [Picea sitchensis]
 gb|ACN40764.1| unknown [Picea sitchensis]
Length=413

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG   + + FDARQYDAKM+E+L+ EG E F SYDEVH+SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVVADATLFDARQYDAKMKEILSTEGDELFASYDEVHESFDEMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYL VKVHACVGGTSVR+DQRIL SGVHVVVGTPGRVFDMLRR SLRP
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVRDDQRILMSGVHVVVGTPGRVFDMLRRHSLRP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_010462344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADSIKMFVLDEADEMLSRG  197



>ref|XP_010502017.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Camelina sativa]
Length=271

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 184/197 (93%), Gaps = 3/197 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLS  761
             D IKMFVLDEADEMLS
Sbjct  179  ADSIKMFVLDEADEMLS  195



>ref|NP_001030693.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75439.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=415

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 188/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|XP_009146433.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   358 bits (920),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRA G YLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRARGAYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D+IKMFVLDEADEMLSRG
Sbjct  179  ADHIKMFVLDEADEMLSRG  197



>ref|NP_175829.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 sp|P41377.1|IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 19 [Arabidopsis 
thaliana]
 gb|AAD25605.1|AC005287_7 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAK62368.1|AF386923_1 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAL16231.1|AF428462_1 At1g54270/F20D21_52 [Arabidopsis thaliana]
 emb|CAA46189.1| eukaryotic translation initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AAM65512.1| eukaryotic translation initiation factor 4A, putative [Arabidopsis 
thaliana]
 gb|AAP37863.1| At1g54270 [Arabidopsis thaliana]
 dbj|BAE98493.1| Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33073.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=412

 Score =   358 bits (920),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 187/199 (94%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYALLQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDY GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
            PD IKMFVLDEADEMLSRG
Sbjct  179  PDCIKMFVLDEADEMLSRG  197



>gb|AAN74636.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   358 bits (920),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG APEGSQFDA ++DA+M +L+  +G EF+T  DEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDARMNDLMAGDGNEFYTISDEVCESFDAMGLQENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC G DVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGHDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL P
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLHP  180

Query  714  DYIKMFVLDEADEMLSRG  767
            DYIKMFVLDEADEMLSRG
Sbjct  181  DYIKMFVLDEADEMLSRG  198



>ref|XP_009117360.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVK HACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKGHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|XP_010324046.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Solanum lycopersicum]
Length=413

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE+LL+GIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEDLLKGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQ+QSGTGKTATFCSGVLQQLDY+ + CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQSQSGTGKTATFCSGVLQQLDYELLGCQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVM ALG  L VKVHACVGGTSVREDQRILS GVHVVVGTPGRVFDMLRRQSLR 
Sbjct  121  AQQIEKVMEALGQCLKVKVHACVGGTSVREDQRILSIGVHVVVGTPGRVFDMLRRQSLRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D+IKMFVLDEADEMLSRG
Sbjct  181  DHIKMFVLDEADEMLSRG  198



>dbj|BAE98559.1| eukaryotic protein synthesis initiation factor 4A [Arabidopsis 
thaliana]
Length=412

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKT TFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTTTFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL + VHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQASVHVVVGTPGRVFDMLKRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  ADNIKMFVLDEADEMLSRG  197



>ref|XP_009147530.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 185/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  SDCIKMFVLDEADEMLSRG  197



>emb|CDY24057.1| BnaA06g00550D [Brassica napus]
Length=412

 Score =   355 bits (911),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 185/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QFD RQ+D K+ ++L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNDVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  SDCIKMFVLDEADEMLSRG  197



>ref|XP_011470735.1| PREDICTED: eukaryotic initiation factor 4A-9 [Fragaria vesca 
subsp. vesca]
Length=801

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  183  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  362
            AAPEGSQFD  Q+D +M ELLT EGQ+FFTSYDEV+DSFD MGL+ENLLRGIYAYGFEKP
Sbjct  392  AAPEGSQFDTHQFDNRMNELLTAEGQDFFTSYDEVYDSFDNMGLQENLLRGIYAYGFEKP  451

Query  363  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  542
            SAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTRELAQQ
Sbjct  452  SAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSLLDCQALVLAPTRELAQQ  511

Query  543  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYI  722
            IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVH VVGTPGRVFDMLRRQSLRPD+I
Sbjct  512  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHAVVGTPGRVFDMLRRQSLRPDHI  571

Query  723  KMFVLDEADEMLSRG  767
            KMFVLDEADEMLSRG
Sbjct  572  KMFVLDEADEMLSRG  586



>ref|XP_001786409.1| predicted protein [Physcomitrella patens]
 gb|EDQ48779.1| predicted protein, partial [Physcomitrella patens]
Length=203

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR 
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IK FVLDEADEMLSRG
Sbjct  181  DSIKCFVLDEADEMLSRG  198



>ref|XP_009779503.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
sylvestris]
Length=409

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  204  FDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRG  383
            FDARQ+DAK+ ELL+ +GQEFFT YDEV+DSFD MGLKENL+RGIYAYGFEKPSAIQQRG
Sbjct  7    FDARQFDAKITELLSGDGQEFFTPYDEVYDSFDNMGLKENLVRGIYAYGFEKPSAIQQRG  66

Query  384  IVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRA  563
            IVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY+ +ECQALVLAPTRELAQQIEKVMRA
Sbjct  67   IVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYELLECQALVLAPTRELAQQIEKVMRA  126

Query  564  LGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDE  743
            LGDYLGVK HACVGGTSVREDQ +LS+GVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDE
Sbjct  127  LGDYLGVKAHACVGGTSVREDQLVLSNGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDE  186

Query  744  ADEMLSRG  767
            ADEMLSRG
Sbjct  187  ADEMLSRG  194



>ref|XP_011628795.1| PREDICTED: eukaryotic initiation factor 4A-9 isoform X1 [Amborella 
trichopoda]
Length=412

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFD RQYD+KM + L  +  EF+  YDEV+DSFD+M LKENLLRGIYAYGF
Sbjct  1    MAGMTPEGSQFDGRQYDSKMNDWLHAD-VEFYAQYDEVYDSFDSMKLKENLLRGIYAYGF  59

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD +ECQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLLECQALVLAPTREL  119

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVM ALGDYL VKVHACVGGTSVREDQRILSSGVHVVVGTPGRV+DMLRRQSLRP
Sbjct  120  AQQIEKVMWALGDYLSVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVYDMLRRQSLRP  179

Query  714  DYIKMFVLDEADEMLSRG  767
            + IKMFVLDEADEMLSRG
Sbjct  180  ECIKMFVLDEADEMLSRG  197



>emb|CDY33073.1| BnaC06g07060D [Brassica napus]
Length=412

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 185/199 (93%), Gaps = 3/199 (2%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRG+YAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGVYAYG  58

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQL+   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLEITLVQCQALVLAPTRE  118

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  179  SDCIKMFVLDEADEMLSRG  197



>ref|XP_006858971.2| PREDICTED: eukaryotic initiation factor 4A-9 isoform X2 [Amborella 
trichopoda]
Length=411

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 180/198 (91%), Gaps = 2/198 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG  PEGSQFD RQYD+KM EL      EF+  YDEV+DSFD+M LKENLLRGIYAYGF
Sbjct  1    MAGMTPEGSQFDGRQYDSKMNELHA--DVEFYAQYDEVYDSFDSMKLKENLLRGIYAYGF  58

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD +ECQALVLAPTREL
Sbjct  59   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLLECQALVLAPTREL  118

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVM ALGDYL VKVHACVGGTSVREDQRILSSGVHVVVGTPGRV+DMLRRQSLRP
Sbjct  119  AQQIEKVMWALGDYLSVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVYDMLRRQSLRP  178

Query  714  DYIKMFVLDEADEMLSRG  767
            + IKMFVLDEADEMLSRG
Sbjct  179  ECIKMFVLDEADEMLSRG  196



>emb|CDY53867.1| BnaC02g46260D [Brassica napus]
Length=422

 Score =   351 bits (900),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            MAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IKMFVLDEADEMLSRG
Sbjct  181  ADAIKMFVLDEADEMLSRG  199



>ref|XP_004508240.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cicer 
arietinum]
Length=859

 Score =   363 bits (933),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  350
            VMAG APEGSQFDA++YD KM +L+  +G++FF + DEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  446  VMAGEAPEGSQFDAKKYDDKMNDLIAADGEDFFGTSDEVYDSFDAMGLQENLLRGIYAYG  505

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY+  +CQALVLAPTRE
Sbjct  506  FEKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTQCQALVLAPTRE  565

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS GVHVVVGTPGRVFDMLRRQSL+
Sbjct  566  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSGGVHVVVGTPGRVFDMLRRQSLQ  625

Query  711  PDYIKMFVLDEADEMLSRG  767
            PDYIKMFVLDEADEMLSRG
Sbjct  626  PDYIKMFVLDEADEMLSRG  644



>gb|ABS19813.1| eukaryotic initiation factor 4A [Lolium perenne]
Length=338

 Score =   347 bits (891),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 1/186 (1%)
 Frame = +3

Query  213  RQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIV  389
            + YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYGFEKPSAIQQRGIV
Sbjct  1    KNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYGFEKPSAIQQRGIV  60

Query  390  PFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALG  569
            PFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQIEKVMRALG
Sbjct  61   PFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRELAQQIEKVMRALG  120

Query  570  DYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEAD  749
            DYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRPD IKMFVLDEAD
Sbjct  121  DYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDNIKMFVLDEAD  180

Query  750  EMLSRG  767
            EMLSRG
Sbjct  181  EMLSRG  186



>ref|XP_001783934.1| predicted protein [Physcomitrella patens]
 gb|EDQ51244.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQYDAKM+ +L+ EG +F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSGEGDDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR 
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IK FVLDEADEMLSRG
Sbjct  181  DSIKCFVLDEADEMLSRG  198



>gb|ACA24135.1| eukaryotic initiation factor 4A [Lolium temulentum]
Length=349

 Score =   347 bits (890),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = +3

Query  207  DARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRG  383
            DA+ YD KM ELL+  + +EFFTSYDEVH+SFD MGL+ENLLRGIYAYGFEKPSAIQQRG
Sbjct  7    DAKHYDTKMTELLSQGDTEEFFTSYDEVHESFDDMGLQENLLRGIYAYGFEKPSAIQQRG  66

Query  384  IVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRA  563
            IVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTRELAQQIEKVMRA
Sbjct  67   IVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVDCQALVLAPTRELAQQIEKVMRA  126

Query  564  LGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDE  743
            LGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLRPD+IKMFVLDE
Sbjct  127  LGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDHIKMFVLDE  186

Query  744  ADEMLSRG  767
            ADEMLSRG
Sbjct  187  ADEMLSRG  194



>emb|CDY49861.1| BnaA02g16100D [Brassica napus]
Length=427

 Score =   350 bits (897),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  171  VMAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAY  347
            VMAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAY
Sbjct  13   VMAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAY  72

Query  348  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  527
            GFEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTR
Sbjct  73   GFEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTR  132

Query  528  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  707
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSL
Sbjct  133  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSL  192

Query  708  RPDYIKMFVLDEADEMLSRG  767
            R D +KMFVLDEADEMLSRG
Sbjct  193  RADAMKMFVLDEADEMLSRG  212



>ref|XP_001758216.1| predicted protein [Physcomitrella patens]
 gb|EDQ77038.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG-  350
            MAG+APEGSQFDARQYDAKM+ +L+ EG++F ++++EVHD+FD MGL ENLLRGIYAYG 
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSAEGEDFISTWEEVHDTFDVMGLHENLLRGIYAYGS  60

Query  351  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  530
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTRE  120

Query  531  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  710
            LAQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  LAQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  180

Query  711  PDYIKMFVLDEADEMLSRG  767
             D IK FVLDEADEMLSRG
Sbjct  181  ADSIKCFVLDEADEMLSRG  199



>ref|XP_001765568.1| predicted protein [Physcomitrella patens]
 gb|EDQ69618.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  174  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  353
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  354  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  533
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  534  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRP  713
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR 
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALRA  180

Query  714  DYIKMFVLDEADEMLSRG  767
            D IK FVLDEADEMLSRG
Sbjct  181  DSIKCFVLDEADEMLSRG  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524835419250