BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4443

Length=996
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074632.1|  PREDICTED: coatomer subunit alpha-1-like           550   0.0      Sesamum indicum [beniseed]
ref|XP_011083895.1|  PREDICTED: coatomer subunit alpha-1-like           548   0.0      
gb|KDO49492.1|  hypothetical protein CISIN_1g000933mg                   540   0.0      Citrus sinensis [apfelsine]
emb|CDP07449.1|  unnamed protein product                                549   0.0      Coffea canephora [robusta coffee]
ref|XP_004238316.1|  PREDICTED: coatomer subunit alpha-1                548   0.0      Solanum lycopersicum
ref|XP_006341999.1|  PREDICTED: coatomer subunit alpha-1-like           548   0.0      Solanum tuberosum [potatoes]
gb|EYU32877.1|  hypothetical protein MIMGU_mgv1a000353mg                548   0.0      Erythranthe guttata [common monkey flower]
gb|KGN61838.1|  hypothetical protein Csa_2G249920                       528   0.0      Cucumis sativus [cucumbers]
ref|XP_011650153.1|  PREDICTED: coatomer subunit alpha-1-like           533   0.0      Cucumis sativus [cucumbers]
gb|EYU36749.1|  hypothetical protein MIMGU_mgv1a000357mg                546   0.0      Erythranthe guttata [common monkey flower]
ref|XP_004243143.1|  PREDICTED: coatomer subunit alpha-1-like           545   0.0      Solanum lycopersicum
ref|XP_006356758.1|  PREDICTED: coatomer subunit alpha-1-like           545   1e-180   
ref|XP_009794496.1|  PREDICTED: coatomer subunit alpha-1-like           544   2e-180   Nicotiana sylvestris
ref|XP_009598989.1|  PREDICTED: coatomer subunit alpha-1-like           544   3e-180   Nicotiana tomentosiformis
ref|XP_009599251.1|  PREDICTED: coatomer subunit alpha-1-like           543   3e-180   Nicotiana tomentosiformis
ref|XP_008365997.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    532   4e-180   
ref|XP_002318013.1|  coatomer alpha subunit-like family protein         543   4e-180   Populus trichocarpa [western balsam poplar]
ref|XP_009790884.1|  PREDICTED: coatomer subunit alpha-1-like           543   5e-180   Nicotiana sylvestris
ref|XP_006423409.1|  hypothetical protein CICLE_v10027697mg             543   6e-180   Citrus clementina [clementine]
gb|KDO49489.1|  hypothetical protein CISIN_1g000933mg                   543   6e-180   Citrus sinensis [apfelsine]
gb|KDO49490.1|  hypothetical protein CISIN_1g000933mg                   543   7e-180   Citrus sinensis [apfelsine]
ref|XP_011042646.1|  PREDICTED: coatomer subunit alpha-1-like iso...    543   7e-180   Populus euphratica
ref|XP_012067196.1|  PREDICTED: coatomer subunit alpha-1                543   8e-180   Jatropha curcas
ref|XP_002321558.1|  coatomer alpha subunit-like family protein         543   8e-180   
ref|XP_006487332.1|  PREDICTED: coatomer subunit alpha-2-like iso...    543   8e-180   Citrus sinensis [apfelsine]
ref|XP_002512969.1|  coatomer alpha subunit, putative                   542   9e-180   Ricinus communis
ref|XP_011028654.1|  PREDICTED: coatomer subunit alpha-1                542   9e-180   Populus euphratica
ref|XP_011042648.1|  PREDICTED: coatomer subunit alpha-1-like iso...    542   1e-179   Populus euphratica
ref|XP_008225617.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    541   1e-179   Prunus mume [ume]
ref|XP_004293978.1|  PREDICTED: coatomer subunit alpha-1-like           541   2e-179   Fragaria vesca subsp. vesca
ref|XP_007213296.1|  hypothetical protein PRUPE_ppa000388mg             541   2e-179   Prunus persica
ref|XP_010263850.1|  PREDICTED: coatomer subunit alpha-1                540   6e-179   Nelumbo nucifera [Indian lotus]
ref|XP_007210424.1|  hypothetical protein PRUPE_ppa000386mg             540   7e-179   Prunus persica
ref|XP_008240283.1|  PREDICTED: coatomer subunit alpha-1                540   8e-179   Prunus mume [ume]
ref|XP_008460997.1|  PREDICTED: coatomer subunit alpha-1-like           540   8e-179   Cucumis melo [Oriental melon]
ref|XP_010271512.1|  PREDICTED: coatomer subunit alpha-1-like           540   9e-179   Nelumbo nucifera [Indian lotus]
ref|XP_008802787.1|  PREDICTED: coatomer subunit alpha-1                540   1e-178   Phoenix dactylifera
ref|XP_007017678.1|  Coatomer, alpha subunit                            540   1e-178   
ref|XP_010919610.1|  PREDICTED: coatomer subunit alpha-1                539   1e-178   
emb|CBI19788.3|  unnamed protein product                                535   1e-178   Vitis vinifera
ref|XP_004300535.1|  PREDICTED: coatomer subunit alpha-1-like           539   2e-178   Fragaria vesca subsp. vesca
ref|XP_010526595.1|  PREDICTED: coatomer subunit alpha-1                539   2e-178   Tarenaya hassleriana [spider flower]
ref|XP_009346991.1|  PREDICTED: coatomer subunit alpha-2-like           539   2e-178   Pyrus x bretschneideri [bai li]
ref|XP_011649252.1|  PREDICTED: coatomer subunit alpha-1-like           539   3e-178   Cucumis sativus [cucumbers]
ref|XP_008461000.1|  PREDICTED: coatomer subunit alpha-1-like           539   3e-178   Cucumis melo [Oriental melon]
ref|XP_010933642.1|  PREDICTED: coatomer subunit alpha-1-like           538   3e-178   Elaeis guineensis
ref|XP_010933643.1|  PREDICTED: coatomer subunit alpha-1-like           538   3e-178   
ref|XP_008346150.1|  PREDICTED: coatomer subunit alpha-1-like           538   3e-178   
ref|XP_008448067.1|  PREDICTED: coatomer subunit alpha-1                538   4e-178   Cucumis melo [Oriental melon]
ref|XP_002529504.1|  coatomer alpha subunit, putative                   538   5e-178   
ref|XP_008393301.1|  PREDICTED: coatomer subunit alpha-1-like           538   6e-178   
ref|XP_004148533.1|  PREDICTED: coatomer subunit alpha-1                538   6e-178   Cucumis sativus [cucumbers]
ref|XP_010672358.1|  PREDICTED: coatomer subunit alpha-2-like           537   7e-178   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009362204.1|  PREDICTED: coatomer subunit alpha-1-like           537   7e-178   Pyrus x bretschneideri [bai li]
ref|XP_008349149.1|  PREDICTED: coatomer subunit alpha-1-like           536   2e-177   
ref|XP_002279779.1|  PREDICTED: coatomer subunit alpha-1                536   2e-177   Vitis vinifera
ref|XP_008374746.1|  PREDICTED: coatomer subunit alpha-1-like           536   3e-177   Malus domestica [apple tree]
ref|XP_010690807.1|  PREDICTED: coatomer subunit alpha-1                536   3e-177   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010555274.1|  PREDICTED: coatomer subunit alpha-1-like           536   4e-177   Tarenaya hassleriana [spider flower]
ref|XP_007042068.1|  Coatomer, alpha subunit                            535   6e-177   
ref|XP_007042069.1|  Coatomer, alpha subunit                            535   1e-176   
gb|EPS65879.1|  hypothetical protein M569_08896                         534   2e-176   Genlisea aurea
emb|CDY61804.1|  BnaC03g76410D                                          511   2e-176   Brassica napus [oilseed rape]
gb|KJB47565.1|  hypothetical protein B456_008G031400                    533   2e-176   Gossypium raimondii
ref|XP_006828935.1|  PREDICTED: coatomer subunit alpha-1                533   3e-176   Amborella trichopoda
gb|EMS45609.1|  Coatomer subunit alpha-3                                533   4e-176   Triticum urartu
gb|EMT27309.1|  Coatomer subunit alpha-3                                533   5e-176   
gb|KJB77745.1|  hypothetical protein B456_012G154500                    522   6e-176   Gossypium raimondii
gb|KHG21379.1|  hypothetical protein F383_26788                         531   2e-175   Gossypium arboreum [tree cotton]
gb|KJB32566.1|  hypothetical protein B456_005G247300                    531   2e-175   Gossypium raimondii
gb|KJB47562.1|  hypothetical protein B456_008G031300                    527   2e-175   Gossypium raimondii
ref|NP_001062612.1|  Os09g0127800                                       531   3e-175   
gb|EAZ08188.1|  hypothetical protein OsI_30447                          531   3e-175   Oryza sativa Indica Group [Indian rice]
ref|XP_002466586.1|  hypothetical protein SORBIDRAFT_01g010390          530   4e-175   Sorghum bicolor [broomcorn]
ref|NP_001051056.1|  Os03g0711400                                       530   4e-175   
ref|XP_008646256.1|  PREDICTED: uncharacterized protein LOC100384...    530   5e-175   Zea mays [maize]
gb|KJB32565.1|  hypothetical protein B456_005G247300                    531   8e-175   Gossypium raimondii
gb|KHG24640.1|  hypothetical protein F383_03247                         530   9e-175   Gossypium arboreum [tree cotton]
ref|XP_004982004.1|  PREDICTED: coatomer subunit alpha-3-like           530   9e-175   Setaria italica
gb|KJB47564.1|  hypothetical protein B456_008G031300                    529   1e-174   Gossypium raimondii
ref|XP_010531460.1|  PREDICTED: coatomer subunit alpha-1-like           529   2e-174   
ref|XP_008644216.1|  PREDICTED: uncharacterized protein LOC100502...    528   2e-174   Zea mays [maize]
ref|XP_010109755.1|  hypothetical protein L484_008431                   528   3e-174   Morus notabilis
ref|XP_002888041.1|  hypothetical protein ARALYDRAFT_475134             528   4e-174   Arabidopsis lyrata subsp. lyrata
ref|NP_176393.1|  coatomer subunit alpha-1                              527   5e-174   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53172.1|  BnaA06g40510D                                          516   7e-174   Brassica napus [oilseed rape]
ref|XP_010066202.1|  PREDICTED: coatomer subunit alpha-2-like           527   7e-174   Eucalyptus grandis [rose gum]
gb|KJB32563.1|  hypothetical protein B456_005G247200                    527   7e-174   Gossypium raimondii
ref|XP_006411704.1|  hypothetical protein EUTSA_v10024240mg             527   8e-174   Eutrema salsugineum [saltwater cress]
emb|CAE45585.1|  coatomer alpha subunit-like protein                    527   1e-173   Lotus japonicus
ref|XP_006300379.1|  hypothetical protein CARUB_v10019676mg             526   1e-173   Capsella rubella
gb|KHG26300.1|  hypothetical protein F383_08243                         526   1e-173   Gossypium arboreum [tree cotton]
ref|XP_010096174.1|  Coatomer subunit alpha-1                           527   1e-173   
gb|KHN25415.1|  Coatomer subunit alpha-2                                526   1e-173   Glycine soja [wild soybean]
ref|XP_003540979.1|  PREDICTED: coatomer subunit alpha-2-like iso...    526   1e-173   Glycine max [soybeans]
emb|CDY41989.1|  BnaA01g05610D                                          516   2e-173   Brassica napus [oilseed rape]
ref|XP_004507488.1|  PREDICTED: coatomer subunit alpha-1-like iso...    526   2e-173   
gb|KJB77746.1|  hypothetical protein B456_012G154500                    526   2e-173   Gossypium raimondii
ref|XP_009400896.1|  PREDICTED: coatomer subunit alpha-3                525   4e-173   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131781.1|  hypothetical protein PHAVU_011G041000g             525   4e-173   Phaseolus vulgaris [French bean]
ref|XP_004496148.1|  PREDICTED: coatomer subunit alpha-1-like           525   5e-173   
emb|CDX90339.1|  BnaA08g16450D                                          516   6e-173   
ref|XP_003607006.1|  Coatomer alpha subunit-like protein                525   6e-173   
sp|Q9AUR7.1|COPA2_ORYSJ  RecName: Full=Coatomer subunit alpha-2; ...    524   1e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003537852.1|  PREDICTED: coatomer subunit alpha-2-like           524   1e-172   Glycine max [soybeans]
gb|KHN39822.1|  Coatomer subunit alpha-1                                524   1e-172   Glycine soja [wild soybean]
ref|XP_010472129.1|  PREDICTED: coatomer subunit alpha-2-like           521   1e-172   
gb|KEH43347.1|  coatomer subunit alpha-like protein                     524   1e-172   Medicago truncatula
ref|XP_010430239.1|  PREDICTED: coatomer subunit alpha-1                523   3e-172   Camelina sativa [gold-of-pleasure]
ref|XP_003556297.1|  PREDICTED: coatomer subunit alpha-2-like           523   4e-172   Glycine max [soybeans]
ref|XP_003536291.1|  PREDICTED: coatomer subunit alpha-1-like           523   4e-172   Glycine max [soybeans]
ref|XP_009388919.1|  PREDICTED: coatomer subunit alpha-1-like           522   5e-172   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN37868.1|  Coatomer subunit alpha-1                                522   5e-172   Glycine soja [wild soybean]
ref|XP_010429041.1|  PREDICTED: coatomer subunit alpha-2-like           522   6e-172   Camelina sativa [gold-of-pleasure]
ref|XP_003564667.1|  PREDICTED: coatomer subunit alpha-3-like           522   6e-172   Brachypodium distachyon [annual false brome]
ref|XP_006404585.1|  hypothetical protein EUTSA_v10000016mg             522   7e-172   
ref|XP_010066199.1|  PREDICTED: coatomer subunit alpha-1                522   7e-172   Eucalyptus grandis [rose gum]
ref|XP_010429048.1|  PREDICTED: coatomer subunit alpha-2                522   7e-172   Camelina sativa [gold-of-pleasure]
ref|XP_010229358.1|  PREDICTED: coatomer subunit alpha-3                522   8e-172   Brachypodium distachyon [annual false brome]
gb|EPS70817.1|  hypothetical protein M569_03938                         522   8e-172   Genlisea aurea
ref|NP_179734.1|  coatomer subunit alpha-2                              522   8e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416888.1|  PREDICTED: coatomer subunit alpha-2-like           522   9e-172   Camelina sativa [gold-of-pleasure]
ref|XP_007144262.1|  hypothetical protein PHAVU_007G141700g             521   1e-171   Phaseolus vulgaris [French bean]
gb|AAS58474.1|  coatomer alpha subunit                                  521   1e-171   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN00939.1|  Coatomer subunit alpha-1                                521   1e-171   Glycine soja [wild soybean]
ref|XP_006293578.1|  hypothetical protein CARUB_v10022525mg             521   3e-171   Capsella rubella
ref|XP_006650487.1|  PREDICTED: coatomer subunit alpha-3-like           520   3e-171   Oryza brachyantha
ref|XP_001771211.1|  predicted protein                                  520   3e-171   
ref|XP_011622877.1|  PREDICTED: coatomer subunit alpha-1                519   1e-170   Amborella trichopoda
ref|XP_002966115.1|  hypothetical protein SELMODRAFT_85610              516   1e-170   
ref|XP_001766709.1|  predicted protein                                  518   2e-170   
ref|XP_008672096.1|  PREDICTED: uncharacterized protein LOC100192...    518   2e-170   
emb|CDY53168.1|  BnaA06g40470D                                          518   2e-170   Brassica napus [oilseed rape]
ref|XP_006411687.1|  hypothetical protein EUTSA_v10024239mg             518   2e-170   Eutrema salsugineum [saltwater cress]
ref|XP_002982185.1|  hypothetical protein SELMODRAFT_154977             518   3e-170   
ref|XP_009101859.1|  PREDICTED: coatomer subunit alpha-2                518   4e-170   Brassica rapa
ref|XP_001753855.1|  predicted protein                                  517   5e-170   
ref|XP_009109461.1|  PREDICTED: coatomer subunit alpha-2-like           517   5e-170   Brassica rapa
ref|XP_009101857.1|  PREDICTED: coatomer subunit alpha-2-like           517   6e-170   Brassica rapa
ref|XP_009407817.1|  PREDICTED: coatomer subunit alpha-3-like           516   7e-170   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397879.1|  PREDICTED: coatomer subunit alpha-3-like           513   2e-168   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878550.1|  hypothetical protein ARALYDRAFT_900556             512   3e-168   
ref|XP_002957821.1|  hypothetical protein VOLCADRAFT_77684              510   3e-167   Volvox carteri f. nagariensis
ref|XP_005651719.1|  Coatomer, alpha subunit                            509   6e-167   Coccomyxa subellipsoidea C-169
ref|XP_001693686.1|  alpha-COP                                          509   1e-166   Chlamydomonas reinhardtii
ref|XP_009400691.1|  PREDICTED: coatomer subunit alpha-3-like           504   4e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002990232.1|  hypothetical protein SELMODRAFT_447957             501   8e-164   Selaginella moellendorffii
ref|XP_002961902.1|  hypothetical protein SELMODRAFT_77651              500   1e-163   Selaginella moellendorffii
ref|XP_003057643.1|  predicted protein                                  500   2e-163   Micromonas pusilla CCMP1545
ref|XP_011398207.1|  Coatomer subunit alpha-2                           493   2e-162   Auxenochlorella protothecoides
gb|KCW64034.1|  hypothetical protein EUGRSUZ_G017081                    459   5e-160   Eucalyptus grandis [rose gum]
ref|XP_008383465.1|  PREDICTED: coatomer subunit alpha-1-like           486   8e-160   
gb|ACN31006.1|  unknown                                                 458   2e-159   Zea mays [maize]
ref|XP_003567287.2|  PREDICTED: coatomer subunit alpha-1-like           456   3e-158   Brachypodium distachyon [annual false brome]
ref|XP_007508098.1|  predicted protein                                  487   3e-158   Bathycoccus prasinos
ref|XP_001417203.1|  predicted protein                                  486   4e-158   Ostreococcus lucimarinus CCE9901
tpg|DAA52914.1|  TPA: hypothetical protein ZEAMMB73_412502              455   4e-158   
gb|KDD75879.1|  hypothetical protein H632_c457p0                        456   1e-157   Helicosporidium sp. ATCC 50920
ref|XP_002878551.1|  hypothetical protein ARALYDRAFT_900557             481   6e-157   
ref|XP_002501894.1|  coatomer protein complex                           483   1e-156   Micromonas commoda
emb|CDY13820.1|  BnaA09g43220D                                          459   2e-156   Brassica napus [oilseed rape]
emb|CEF97511.1|  Coatomer, alpha subunit, C-terminal                    476   2e-154   Ostreococcus tauri
ref|XP_003523472.1|  PREDICTED: coatomer subunit alpha-1-like iso...    474   9e-154   Glycine max [soybeans]
gb|EWM26143.1|  Coatomer, WD associated region                          476   1e-153   Nannochloropsis gaditana
emb|CBN77093.1|  Vesicle coat complex COPI, alpha subunit               473   8e-153   Ectocarpus siliculosus
emb|CDQ86226.1|  unnamed protein product                                451   2e-152   Oncorhynchus mykiss
ref|XP_005851353.1|  hypothetical protein CHLNCDRAFT_137537             457   3e-152   Chlorella variabilis
dbj|BAE02266.1|  unnamed protein product                                454   6e-152   Macaca fascicularis [crab eating macaque]
ref|XP_004333061.1|  alphaCOP, putative                                 469   2e-151   Acanthamoeba castellanii str. Neff
ref|XP_002896974.1|  coatomer protein complex, putative                 466   3e-150   Phytophthora infestans T30-4
ref|XP_002455000.1|  hypothetical protein SORBIDRAFT_03g002780          462   5e-150   
gb|ETL92039.1|  hypothetical protein L917_09539                         465   5e-150   Phytophthora parasitica
gb|ETK85490.1|  hypothetical protein L915_09709                         465   6e-150   Phytophthora parasitica
gb|ETI45564.1|  hypothetical protein F443_09913                         465   6e-150   Phytophthora parasitica P1569
gb|ETP15371.1|  hypothetical protein F441_09860                         465   6e-150   Phytophthora parasitica CJ01A1
ref|XP_008892963.1|  hypothetical protein PPTG_01415                    465   6e-150   Phytophthora parasitica INRA-310
ref|XP_008862869.1|  hypothetical protein H310_01524                    464   1e-149   Aphanomyces invadans
gb|ETM45336.1|  hypothetical protein L914_09580                         464   1e-149   Phytophthora parasitica
ref|XP_009117406.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    460   1e-149   Brassica rapa
ref|XP_008610604.1|  coatomer protein complex, subunit alpha (xenin)    461   1e-148   Saprolegnia diclina VS20
ref|XP_005768226.1|  COPA1, alpha subunit of the coatomer               449   3e-148   Emiliania huxleyi CCMP1516
gb|ABM68600.1|  AAEL013098-PA                                           446   3e-148   Aedes aegypti
ref|XP_009039560.1|  hypothetical protein AURANDRAFT_38357              459   6e-148   Aureococcus anophagefferens
ref|XP_010788149.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    453   7e-148   Notothenia coriiceps [yellowbelly rockcod]
emb|CDQ67339.1|  unnamed protein product                                459   7e-148   Oncorhynchus mykiss
emb|CCA26666.1|  predicted protein putative                             459   8e-148   Albugo laibachii Nc14
ref|XP_003487682.1|  PREDICTED: coatomer subunit alpha-like             435   1e-147   
ref|XP_006999128.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer pro...    456   1e-147   Peromyscus maniculatus bairdii
gb|EMT02979.1|  Coatomer subunit alpha-3                                457   2e-147   
ref|XP_011503846.1|  PREDICTED: coatomer subunit alpha                  458   2e-147   Ceratosolen solmsi marchali
ref|XP_009821126.1|  hypothetical protein H257_00241                    458   2e-147   Aphanomyces astaci
ref|XP_002801923.1|  PREDICTED: coatomer subunit alpha-like             456   2e-147   
ref|XP_004078629.1|  PREDICTED: coatomer subunit alpha                  457   3e-147   Oryzias latipes [Japanese rice fish]
ref|XP_005710742.1|  Coatomer subunit alpha, WD40 repeat-containi...    459   3e-147   Chondrus crispus [carageen]
ref|NP_001133825.1|  Coatomer subunit alpha                             459   3e-147   Salmo salar
ref|XP_010888093.1|  PREDICTED: coatomer subunit alpha                  457   3e-147   Esox lucius
ref|XP_005102617.1|  PREDICTED: coatomer subunit alpha-like             457   5e-147   Aplysia californica
ref|XP_005981769.1|  PREDICTED: coatomer subunit alpha isoform X2       457   5e-147   Pantholops hodgsonii [Tibetan antelope]
ref|NP_001001941.2|  coatomer subunit alpha                             457   5e-147   Danio rerio [leopard danio]
ref|XP_006096970.1|  PREDICTED: coatomer subunit alpha isoform X2       457   5e-147   Myotis lucifugus
ref|XP_008152468.1|  PREDICTED: coatomer subunit alpha isoform X2       457   5e-147   Eptesicus fuscus
ref|XP_005796611.1|  PREDICTED: coatomer subunit alpha-like isofo...    457   5e-147   Xiphophorus maculatus
ref|XP_005981768.1|  PREDICTED: coatomer subunit alpha isoform X1       457   5e-147   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008152467.1|  PREDICTED: coatomer subunit alpha isoform X1       457   5e-147   
ref|XP_006096969.1|  PREDICTED: coatomer subunit alpha isoform X1       457   6e-147   
ref|XP_006895530.1|  PREDICTED: coatomer subunit alpha isoform X2       457   6e-147   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004688439.1|  PREDICTED: coatomer subunit alpha isoform X2       457   6e-147   Condylura cristata
ref|XP_011595606.1|  PREDICTED: coatomer subunit alpha                  457   6e-147   Aquila chrysaetos canadensis
ref|XP_004002718.1|  PREDICTED: coatomer subunit alpha isoform X2       457   6e-147   Ovis aries [domestic sheep]
ref|XP_008432228.1|  PREDICTED: coatomer subunit alpha                  457   6e-147   Poecilia reticulata
ref|XP_005796610.1|  PREDICTED: coatomer subunit alpha-like isofo...    457   6e-147   
ref|XP_010562443.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Haliaeetus leucocephalus
ref|XP_006861712.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   Chrysochloris asiatica
ref|XP_003500327.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Cricetulus griseus [Chinese hamsters]
ref|XP_004775910.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Mustela putorius furo [black ferret]
ref|XP_004671175.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Jaculus jaculus
ref|XP_010282036.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Phaethon lepturus
ref|XP_006267538.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Alligator mississippiensis
ref|XP_009474826.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Nipponia nippon
ref|NP_001099115.1|  coatomer subunit alpha                             457   7e-147   Bos taurus [bovine]
ref|XP_004775909.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   
ref|XP_007945901.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Orycteropus afer afer
sp|Q27954.1|COPA_BOVIN  RecName: Full=Coatomer subunit alpha; Alt...    457   7e-147   Bos taurus [bovine]
ref|XP_008494291.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Calypte anna
ref|XP_008698915.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   Ursus maritimus [white bear]
ref|XP_006060555.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Bubalus bubalis [domestic water buffalo]
ref|XP_002928486.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Ailuropoda melanoleuca
ref|NP_001026576.1|  coatomer subunit alpha                             457   7e-147   Gallus gallus [bantam]
ref|XP_007129697.1|  PREDICTED: coatomer subunit alpha isoform X2       456   7e-147   
ref|XP_009080612.1|  PREDICTED: coatomer subunit alpha                  457   7e-147   Acanthisitta chloris
ref|XP_006174003.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Camelus ferus
ref|XP_004589141.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Ochotona princeps [southern American pika]
ref|XP_004442851.1|  PREDICTED: coatomer subunit alpha isoform 1        457   7e-147   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AAI62474.1|  Copa protein                                            457   7e-147   Danio rerio [leopard danio]
ref|XP_005400264.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Chinchilla lanigera
ref|XP_004613819.1|  PREDICTED: coatomer subunit alpha isoform X2       457   7e-147   Sorex araneus [Eurasian shrew]
ref|XP_004448470.1|  PREDICTED: coatomer subunit alpha isoform 2        457   7e-147   Dasypus novemcinctus
ref|XP_006895529.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004589140.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   Ochotona princeps [southern American pika]
ref|XP_004002719.1|  PREDICTED: coatomer subunit alpha isoform X1       457   7e-147   Ovis aries [domestic sheep]
ref|XP_001928742.1|  PREDICTED: coatomer subunit alpha isoform 2        456   7e-147   Sus scrofa [pigs]
ref|XP_003213999.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Meleagris gallopavo [common turkey]
ref|XP_007945900.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Orycteropus afer afer
ref|XP_005400263.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Chinchilla lanigera
ref|XP_003892963.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Papio anubis [baboon]
ref|XP_008518688.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Equus przewalskii [Przewalski horse]
ref|XP_007974682.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Chlorocebus sabaeus
ref|XP_004407935.1|  PREDICTED: coatomer subunit alpha isoform 1        457   8e-147   Odobenus rosmarus divergens
ref|XP_008518689.1|  PREDICTED: coatomer subunit alpha isoform X2       456   8e-147   Equus przewalskii [Przewalski horse]
ref|XP_004284479.1|  PREDICTED: coatomer subunit alpha isoform 2        456   8e-147   Orcinus orca [Orca]
ref|XP_006174002.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Camelus ferus
ref|XP_005203500.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Bos taurus [bovine]
ref|XP_007552064.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Poecilia formosa
ref|XP_007171826.1|  PREDICTED: coatomer subunit alpha isoform X2       456   8e-147   Balaenoptera acutorostrata scammoni
ref|XP_005233225.1|  PREDICTED: coatomer subunit alpha isoform X1       456   8e-147   Falco peregrinus [peregrine]
ref|XP_006922956.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Pteropus alecto
ref|XP_008582920.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004027749.1|  PREDICTED: coatomer subunit alpha isoform 2        457   8e-147   
ref|XP_004442852.1|  PREDICTED: coatomer subunit alpha isoform 2        456   8e-147   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004671174.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Jaculus jaculus
ref|XP_001914764.2|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    456   8e-147   
ref|XP_005141102.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Melopsittacus undulatus
ref|XP_004284478.1|  PREDICTED: coatomer subunit alpha isoform 1        457   8e-147   
ref|XP_007129696.1|  PREDICTED: coatomer subunit alpha isoform X1       456   8e-147   Physeter catodon
ref|XP_001171563.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Pan troglodytes
ref|XP_007974683.1|  PREDICTED: coatomer subunit alpha isoform X2       456   8e-147   Chlorocebus sabaeus
ref|XP_004901583.1|  PREDICTED: coatomer subunit alpha isoform X2       456   8e-147   
ref|XP_011371370.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   Pteropus vampyrus
ref|XP_006168889.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   
ref|XP_006060554.1|  PREDICTED: coatomer subunit alpha isoform X1       457   8e-147   
ref|XP_010359050.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Rhinopithecus roxellana
ref|XP_003466617.1|  PREDICTED: coatomer subunit alpha isoform 1        456   8e-147   Cavia porcellus [guinea pig]
ref|XP_008056902.1|  PREDICTED: coatomer subunit alpha                  456   8e-147   Carlito syrichta
ref|XP_004448469.1|  PREDICTED: coatomer subunit alpha isoform 1        457   8e-147   
dbj|BAC31555.1|  unnamed protein product                                456   8e-147   Mus musculus [mouse]
ref|XP_003892962.1|  PREDICTED: coatomer subunit alpha isoform X2       456   8e-147   Papio anubis [baboon]
ref|XP_008582921.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004639986.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   Octodon degus
ref|XP_004027748.1|  PREDICTED: coatomer subunit alpha isoform 1        456   9e-147   
ref|XP_001928732.1|  PREDICTED: coatomer subunit alpha isoform 1        457   9e-147   
ref|XP_005233226.1|  PREDICTED: coatomer subunit alpha isoform X2       457   9e-147   
ref|XP_005541313.1|  PREDICTED: coatomer subunit alpha isoform X1       457   9e-147   
ref|XP_009240111.1|  PREDICTED: coatomer subunit alpha isoform X1       456   9e-147   
ref|XP_004858772.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   
ref|XP_004688438.1|  PREDICTED: coatomer subunit alpha isoform X1       457   9e-147   
ref|XP_010991399.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   
ref|XP_006861713.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   
ref|XP_001171574.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   
ref|XP_004407936.1|  PREDICTED: coatomer subunit alpha isoform 2        456   9e-147   
ref|XP_002715282.1|  PREDICTED: coatomer subunit alpha                  456   9e-147   
ref|XP_004716569.1|  PREDICTED: coatomer subunit alpha isoform X1       456   9e-147   
ref|NP_004362.2|  coatomer subunit alpha isoform 2                      456   9e-147   
ref|XP_004716570.1|  PREDICTED: coatomer subunit alpha isoform X2       456   9e-147   
ref|XP_001369624.1|  PREDICTED: coatomer subunit alpha isoform X1       456   9e-147   
ref|XP_004901582.1|  PREDICTED: coatomer subunit alpha isoform X1       456   9e-147   
ref|XP_003466618.1|  PREDICTED: coatomer subunit alpha isoform 2        456   9e-147   
ref|XP_003415233.1|  PREDICTED: coatomer subunit alpha                  456   9e-147   
ref|NP_034068.3|  coatomer subunit alpha                                456   9e-147   
gb|AAB70879.1|  coatomer protein                                        456   9e-147   
ref|NP_001091868.1|  coatomer subunit alpha isoform 1                   456   9e-147   
gb|EAW52724.1|  coatomer protein complex, subunit alpha, isoform ...    456   9e-147   
ref|XP_008982977.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    456   1e-146   
ref|XP_006168890.1|  PREDICTED: coatomer subunit alpha isoform X2       456   1e-146   
gb|EDL39042.1|  coatomer protein complex subunit alpha, isoform C...    456   1e-146   
ref|NP_001128012.1|  coatomer subunit alpha                             456   1e-146   
ref|XP_005515154.1|  PREDICTED: coatomer subunit alpha                  456   1e-146   
dbj|BAG11074.1|  coatomer subunit alpha                                 456   1e-146   
ref|XP_004858771.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_010614962.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_010614964.1|  PREDICTED: coatomer subunit alpha isoform X2       456   1e-146   
ref|XP_010991398.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_008839027.1|  PREDICTED: coatomer subunit alpha isoform X2       456   1e-146   
ref|XP_005541314.1|  PREDICTED: coatomer subunit alpha isoform X2       456   1e-146   
ref|XP_004639985.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_008839026.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_007092432.1|  PREDICTED: coatomer subunit alpha                  456   1e-146   
ref|XP_011289413.1|  PREDICTED: coatomer subunit alpha                  456   1e-146   
ref|XP_004613818.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
gb|AAI69090.1|  Copa protein                                            456   1e-146   
ref|XP_003937994.1|  PREDICTED: coatomer subunit alpha                  456   1e-146   
gb|AAH24070.1|  Coatomer protein complex subunit alpha                  456   1e-146   
ref|XP_007234429.1|  PREDICTED: coatomer subunit alpha-like             456   1e-146   
ref|XP_008494290.1|  PREDICTED: coatomer subunit alpha isoform X1       456   1e-146   
ref|XP_005903946.1|  PREDICTED: coatomer subunit alpha isoform X2       456   1e-146   
ref|XP_008293242.1|  PREDICTED: coatomer subunit alpha                  456   1e-146   
ref|XP_009887819.1|  PREDICTED: coatomer subunit alpha isoform X1       456   2e-146   
gb|EHB13664.1|  Coatomer subunit alpha                                  457   2e-146   
ref|XP_006001923.1|  PREDICTED: coatomer subunit alpha isoform X2       456   2e-146   
ref|XP_005903945.1|  PREDICTED: coatomer subunit alpha isoform X1       456   2e-146   
ref|NP_001121466.1|  coatomer protein complex, subunit alpha            456   2e-146   
ref|XP_004555248.1|  PREDICTED: coatomer subunit alpha-like             456   2e-146   
ref|XP_006001922.1|  PREDICTED: coatomer subunit alpha isoform X1       456   2e-146   
ref|XP_006792415.1|  PREDICTED: coatomer subunit alpha-like             456   2e-146   
ref|XP_005918171.1|  PREDICTED: coatomer subunit alpha-like             455   2e-146   
ref|XP_005729030.1|  PREDICTED: coatomer subunit alpha-like isofo...    455   2e-146   
ref|XP_003447511.1|  PREDICTED: coatomer subunit alpha-like             455   2e-146   
ref|XP_011172118.1|  PREDICTED: coatomer subunit alpha                  455   3e-146   
ref|XP_005729029.1|  PREDICTED: coatomer subunit alpha-like isofo...    455   3e-146   
ref|XP_007441248.1|  PREDICTED: coatomer subunit alpha                  455   3e-146   
gb|ERZ98066.1|  hypothetical protein GLOINDRAFT_334453                  455   3e-146   
ref|XP_001631811.1|  predicted protein                                  455   3e-146   
ref|XP_967472.1|  PREDICTED: coatomer subunit alpha                     455   3e-146   
ref|XP_004210494.1|  PREDICTED: coatomer subunit alpha-like             436   4e-146   
gb|EZA50399.1|  Coatomer subunit alpha                                  454   4e-146   
ref|XP_011345251.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    454   5e-146   
gb|EXX75326.1|  Cop1p                                                   451   5e-146   
ref|NP_001086488.1|  coatomer protein complex, subunit alpha            454   6e-146   
ref|XP_003978283.1|  PREDICTED: coatomer subunit alpha                  454   6e-146   
ref|XP_001950394.1|  PREDICTED: coatomer subunit alpha                  454   7e-146   
ref|XP_008333163.1|  PREDICTED: coatomer subunit alpha                  454   1e-145   
ref|XP_011563272.1|  PREDICTED: coatomer subunit alpha-like             453   1e-145   
ref|XP_011269171.1|  PREDICTED: coatomer subunit alpha                  453   1e-145   
ref|XP_008544952.1|  PREDICTED: coatomer subunit alpha                  453   1e-145   
ref|XP_011556259.1|  PREDICTED: coatomer subunit alpha-like             452   1e-145   
ref|XP_003700869.1|  PREDICTED: coatomer subunit alpha                  453   1e-145   
ref|XP_009526440.1|  hypothetical protein PHYSODRAFT_545018             453   1e-145   
ref|XP_011863753.1|  PREDICTED: coatomer subunit alpha                  453   2e-145   
ref|XP_009039838.1|  hypothetical protein AURANDRAFT_70314              453   2e-145   
ref|XP_011690004.1|  PREDICTED: coatomer subunit alpha                  452   2e-145   
ref|XP_011634960.1|  PREDICTED: coatomer subunit alpha                  452   2e-145   
ref|XP_011052978.1|  PREDICTED: coatomer subunit alpha                  452   2e-145   
ref|XP_011135745.1|  PREDICTED: coatomer subunit alpha                  452   2e-145   
ref|XP_012054039.1|  PREDICTED: coatomer subunit alpha                  452   2e-145   
ref|XP_008204705.1|  PREDICTED: coatomer subunit alpha isoform X1       452   3e-145   
gb|AAQ63170.1|  coatomer protein complex subunit alpha                  452   3e-145   
ref|XP_011298436.1|  PREDICTED: coatomer subunit alpha                  452   5e-145   
ref|XP_002731289.1|  PREDICTED: coatomer subunit alpha-like             452   5e-145   
ref|XP_005759442.1|  COPA1, alpha subunit of the coatomer               452   5e-145   
gb|EXX75325.1|  Cop1p                                                   452   6e-145   
ref|XP_623198.1|  PREDICTED: coatomer subunit alpha isoform 1           451   9e-145   
ref|XP_006622894.1|  PREDICTED: coatomer subunit alpha-like             451   9e-145   
ref|XP_009059178.1|  hypothetical protein LOTGIDRAFT_218145             451   9e-145   
gb|KFM76440.1|  Coatomer subunit alpha                                  449   1e-144   
ref|XP_001663309.1|  AAEL013098-PA                                      451   1e-144   
ref|NP_001166192.1|  coatomer protein complex subunit alpha             450   2e-144   
ref|XP_001861349.1|  coatomer subunit alpha                             450   2e-144   
ref|XP_007171825.1|  PREDICTED: coatomer subunit alpha isoform X1       449   4e-144   
gb|EFX83790.1|  hypothetical protein DAPPUDRAFT_301644                  449   5e-144   
emb|CDX72683.1|  BnaC07g47050D                                          425   5e-144   
ref|XP_003078687.1|  WD40 repeat-containing protein (ISS)               450   5e-144   
ref|XP_008467461.1|  PREDICTED: coatomer subunit alpha-like             450   6e-144   
ref|XP_003691465.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    448   9e-144   
ref|XP_002428302.1|  coatomer alpha subunit, putative                   448   9e-144   
gb|KFH68427.1|  coatomer protein complex, subunit alpha (xenin)         447   3e-143   
ref|XP_009097457.1|  PREDICTED: coatomer subunit alpha                  447   5e-143   
gb|EIE76003.1|  hypothetical protein RO3G_00707                         444   1e-142   
ref|XP_011673596.1|  PREDICTED: coatomer subunit alpha isoform X4       446   1e-142   
ref|XP_011673592.1|  PREDICTED: coatomer subunit alpha isoform X1       445   1e-142   
ref|XP_005189048.1|  PREDICTED: coatomer subunit alpha                  445   3e-142   
ref|XP_319442.1|  AGAP010251-PA                                         444   3e-142   
ref|XP_001983547.1|  GH15519                                            444   4e-142   
ref|XP_002046370.1|  GJ12542                                            444   5e-142   
emb|CEG73732.1|  Putative Coatomer, WD associated region                444   5e-142   
ref|XP_002111714.1|  hypothetical protein TRIADDRAFT_24616              444   6e-142   
ref|XP_002012122.1|  GI16798                                            444   6e-142   
ref|XP_001955990.1|  GF24978                                            443   9e-142   
gb|KFB45492.1|  AGAP010251-PA-like protein                              443   1e-141   
ref|XP_011420529.1|  PREDICTED: coatomer subunit alpha-like             443   1e-141   
ref|XP_002093159.1|  GE20939                                            443   1e-141   
ref|XP_002034947.1|  GM14193                                            443   1e-141   
ref|NP_477395.1|  coat protein (coatomer) alpha, isoform A              443   1e-141   
ref|XP_001971170.1|  GG14579                                            443   1e-141   
ref|XP_002025634.1|  GL20730                                            443   2e-141   
ref|XP_001650231.1|  AAEL015001-PA                                      442   2e-141   
ref|XP_001352767.1|  GA20724                                            443   2e-141   
ref|XP_002069161.1|  GK23658                                            442   2e-141   
gb|EIE80782.1|  coatomer protein alpha subunit                          442   2e-141   
ref|XP_009022210.1|  hypothetical protein HELRODRAFT_101473             442   3e-141   
emb|CAA09492.1|  coatomer alpha subunit                                 441   6e-141   
gb|ELT95580.1|  hypothetical protein CAPTEDRAFT_156336                  441   1e-140   
gb|KDO30127.1|  hypothetical protein SPRG_19862                         435   2e-140   
ref|XP_011182814.1|  PREDICTED: coatomer subunit alpha                  440   2e-140   
emb|CDS11681.1|  hypothetical protein LRAMOSA03944                      440   2e-140   
emb|CDH50700.1|  coatomer alpha subunit                                 440   2e-140   
ref|XP_011200833.1|  PREDICTED: coatomer subunit alpha                  439   5e-140   
emb|CEP14680.1|  hypothetical protein                                   439   5e-140   
dbj|GAN02438.1|  coatomer protein complex, subunit alpha                439   6e-140   
gb|EPB81110.1|  coatomer protein complex, subunit alpha (xenin)         439   7e-140   
ref|XP_004525714.1|  PREDICTED: coatomer subunit alpha-like             438   7e-140   
gb|KFH68419.1|  coatomer protein complex, subunit alpha (xenin)         438   8e-140   
ref|XP_003387772.1|  PREDICTED: coatomer subunit alpha-like             438   1e-139   
ref|XP_001743343.1|  hypothetical protein                               437   1e-139   
emb|CDX82024.1|  BnaC08g35770D                                          415   3e-139   
ref|XP_010750764.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    436   7e-139   
gb|ELK38493.1|  Coatomer subunit alpha                                  435   9e-139   
gb|KFM03458.1|  Coatomer subunit alpha                                  434   1e-138   
ref|XP_009321084.1|  PREDICTED: coatomer subunit alpha                  435   1e-138   
ref|XP_007881714.1|  hypothetical protein PFL1_05984                    432   1e-138   
emb|CDY42637.1|  BnaC01g00490D                                          431   2e-138   
gb|EFB22053.1|  hypothetical protein PANDA_018450                       434   2e-138   
gb|ELR50442.1|  Coatomer subunit alpha                                  434   2e-138   
gb|EPQ02419.1|  Coatomer subunit alpha                                  434   2e-138   
ref|XP_003767922.1|  PREDICTED: coatomer subunit alpha                  434   2e-138   
ref|XP_005280787.1|  PREDICTED: coatomer subunit alpha                  434   2e-138   
ref|XP_003259153.2|  PREDICTED: coatomer subunit alpha                  434   3e-138   
gb|EFW14032.1|  coatomer alpha subunit                                  425   3e-138   
gb|EAS28953.3|  coatomer alpha subunit                                  425   3e-138   
ref|XP_011390661.1|  putative coatomer complex subunit alpha            434   4e-138   
ref|XP_003067962.1|  coatomer alpha subunit, putative                   425   4e-138   
ref|XP_007064713.1|  PREDICTED: coatomer subunit alpha                  432   6e-138   
gb|KIV82662.1|  hypothetical protein PV11_04756                         433   8e-138   
ref|XP_008078323.1|  WD40 repeat-like protein                           424   9e-138   
emb|CCF50700.1|  probable COP1-coatomer complex alpha chain of se...    433   1e-137   
ref|XP_004998986.1|  COP1 protein                                       432   1e-137   
ref|XP_005840278.1|  coatomer subunit alpha                             433   2e-137   
gb|KIW28228.1|  hypothetical protein PV07_07907                         432   2e-137   
ref|XP_006036151.1|  PREDICTED: coatomer subunit alpha                  432   2e-137   
dbj|GAC98173.1|  vegetative incompatibility protein HET-E-1             432   3e-137   
gb|KIW43031.1|  hypothetical protein PV06_04180                         431   3e-137   
ref|XP_006112406.1|  PREDICTED: coatomer subunit alpha                  430   3e-137   
emb|CBQ68769.1|  probable COP1-coatomer complex alpha chain of se...    431   4e-137   
gb|EST09046.1|  putative COP1-coatomer complex alpha chain              431   4e-137   
ref|XP_007913694.1|  putative coatomer subunit protein                  431   4e-137   
ref|XP_003737263.1|  PREDICTED: coatomer subunit alpha                  431   4e-137   
ref|XP_009159088.1|  coatomer protein complex, subunit alpha (xenin)    431   5e-137   
ref|XP_005434843.1|  PREDICTED: coatomer subunit alpha                  431   5e-137   
ref|XP_007928128.1|  hypothetical protein MYCFIDRAFT_215718             430   6e-137   
gb|KIW61270.1|  hypothetical protein PV05_01414                         430   7e-137   
ref|XP_005533455.1|  PREDICTED: coatomer subunit alpha                  431   9e-137   
emb|CCG83768.1|  protein of unknown function                            430   1e-136   
ref|XP_009262181.1|  hypothetical protein FPSE_10789                    430   1e-136   
gb|EME42492.1|  hypothetical protein DOTSEDRAFT_73359                   429   1e-136   
gb|KIV96927.1|  hypothetical protein PV10_00740                         429   1e-136   
gb|EKD02314.1|  hypothetical protein A1Q2_03370                         430   1e-136   
gb|EWZ47561.1|  coatomer protein complex, subunit alpha (xenin)         429   1e-136   
gb|EXL92480.1|  coatomer protein complex, subunit alpha (xenin)         429   1e-136   
gb|EGU85391.1|  hypothetical protein FOXB_04102                         429   1e-136   
gb|EWZ92610.1|  coatomer protein complex, subunit alpha (xenin)         429   2e-136   
ref|XP_011327781.1|  coatomer subunit alpha                             429   2e-136   
gb|EHK39883.1|  hypothetical protein TRIATDRAFT_152772                  429   2e-136   
ref|XP_006666398.1|  Coatomer, WD associated region                     420   2e-136   
gb|EWG53777.1|  coatomer protein complex, subunit alpha (xenin)         429   2e-136   
gb|EMD95016.1|  hypothetical protein COCHEDRAFT_1222255                 429   2e-136   
gb|ENH65076.1|  Putative coatomer subunit alpha                         429   2e-136   
gb|EXM21197.1|  coatomer protein complex, subunit alpha (xenin)         429   2e-136   
gb|KIW69177.1|  hypothetical protein PV04_05070                         429   2e-136   
gb|KFH45703.1|  putative coatomer subunit alpha-like protein            429   2e-136   
gb|EXK97845.1|  coatomer protein complex, subunit alpha (xenin)         429   2e-136   
emb|CCT67478.1|  probable COP1-coatomer complex alpha chain of se...    429   2e-136   
ref|XP_006965599.1|  vesicle coatomer complex, alpha subunit            429   2e-136   
ref|XP_007708326.1|  hypothetical protein COCCADRAFT_1756               429   2e-136   
ref|XP_003040742.1|  predicted protein                                  429   2e-136   
ref|XP_007697819.1|  hypothetical protein COCSADRAFT_158414             429   2e-136   
gb|EMS22388.1|  coatomer protein complex, subunit alpha                 429   2e-136   
ref|XP_008027562.1|  hypothetical protein SETTUDRAFT_163807             429   3e-136   
ref|XP_007683623.1|  hypothetical protein COCMIDRAFT_1497               429   3e-136   
gb|EHK19051.1|  hypothetical protein TRIVIDRAFT_78060                   429   3e-136   
ref|XP_007284565.1|  coatomer subunit                                   428   3e-136   
gb|KIL94438.1|  hypothetical protein FAVG1_03002                        428   3e-136   
gb|EQB47987.1|  coatomer WD associated region                           428   3e-136   
gb|KKA20293.1|  Coatomer subunit alpha                                  428   4e-136   
gb|EMP31360.1|  Coatomer subunit alpha                                  429   4e-136   
ref|XP_007599108.1|  coatomer WD associated region                      428   4e-136   
dbj|BAK00682.1|  predicted protein                                      428   5e-136   
emb|CDI54853.1|  probable COP1-coatomer complex alpha chain of se...    428   5e-136   
emb|CCD34485.1|  similar to coatomer subunit alpha                      419   5e-136   
ref|XP_008715936.1|  hypothetical protein HMPREF1541_03363              428   5e-136   
emb|CEP17781.1|  hypothetical protein                                   404   7e-136   
ref|XP_007676795.1|  hypothetical protein BAUCODRAFT_34527              427   8e-136   
gb|KJX92379.1|  coatomer subunit alpha like protein                     427   9e-136   



>ref|XP_011074632.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1218

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 258/258 (100%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHARQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_011083895.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1199

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 258/258 (100%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHARQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|KDO49492.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=916

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>emb|CDP07449.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 258/258 (100%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHARQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_004238316.1| PREDICTED: coatomer subunit alpha-1 [Solanum lycopersicum]
Length=1218

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_006341999.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1218

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|EYU32877.1| hypothetical protein MIMGU_mgv1a000353mg [Erythranthe guttata]
Length=1225

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/258 (99%), Positives = 258/258 (100%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNLLAAG  308



>gb|KGN61838.1| hypothetical protein Csa_2G249920 [Cucumis sativus]
Length=595

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  13   MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  72

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  73   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  132

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA+FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADD+LR
Sbjct  133  NWQSRTCISVLTGHNHYVMCAAFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDVLR  192

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  193  LSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  252

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  253  VDTLRGHMNNVSCVMFHA  270


 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  108  IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCAAFHPKEDLVVSASL  167

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  168  DQTVRVWDIGALRKKTVSPADDVLRLSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPT  227

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  228  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  287

Query  707  D  709
            D
Sbjct  288  D  288


 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  212  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  271

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      + HP+ +L+ + 
Sbjct  272  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  320



>ref|XP_011650153.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
Length=765

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA+FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCAAFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDVLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCAAFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDVLRLSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|EYU36749.1| hypothetical protein MIMGU_mgv1a000357mg [Erythranthe guttata]
Length=1220

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/257 (99%), Positives = 256/257 (99%), Gaps = 0/257 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA+FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFH  991
            VDTLRGHMNNVSCVLFH
Sbjct  241  VDTLRGHMNNVSCVLFH  257


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCATFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FHPK+D+++S S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPKQDIIISNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIISNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_004243143.1| PREDICTED: coatomer subunit alpha-1-like [Solanum lycopersicum]
Length=1219

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/257 (98%), Positives = 257/257 (100%), Gaps = 0/257 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKT+SPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTISPADDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFH  991
            VDTLRGHMNNVSCVLFH
Sbjct  241  VDTLRGHMNNVSCVLFH  257


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTISPADDLLRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FHP++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_006356758.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1219

 Score =   545 bits (1404),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 253/257 (98%), Positives = 257/257 (100%), Gaps = 0/257 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDL+VSASLDQTVRVWDIGALRKKTVSPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLIVSASLDQTVRVWDIGALRKKTVSPADDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFH  991
            VDTLRGHMNNVSCVLFH
Sbjct  241  VDTLRGHMNNVSCVLFH  257


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLIVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDLLRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FHP++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_009794496.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1218

 Score =   544 bits (1402),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/258 (98%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV FH+
Sbjct  241  VDTLRGHMNNVSCVQFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_009598989.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1219

 Score =   544 bits (1401),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 256/257 (99%), Positives = 256/257 (99%), Gaps = 0/257 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHHKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFH  991
            VDTLRGHMNNVSCVLFH
Sbjct  241  VDTLRGHMNNVSCVLFH  257


 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHHKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FHP++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILACHPEMNLLAAG  308



>ref|XP_009599251.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1218

 Score =   543 bits (1400),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 254/258 (98%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV FH+
Sbjct  241  VDTLRGHMNNVSCVQFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_008365997.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Malus domestica]
Length=828

 Score =   532 bits (1370),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ +  H + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQXHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVAPADDILRLSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDRSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_002318013.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEE96233.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1220

 Score =   543 bits (1400),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_009790884.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1219

 Score =   543 bits (1399),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 256/257 (99%), Positives = 256/257 (99%), Gaps = 0/257 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHHKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFH  991
            VDTLRGHMNNVSCVLFH
Sbjct  241  VDTLRGHMNNVSCVLFH  257


 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHHKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FHP++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILACHPEMNLLAAG  308



>ref|XP_006423409.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
 gb|ESR36649.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
Length=1219

 Score =   543 bits (1399),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>gb|KDO49489.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1208

 Score =   543 bits (1398),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>gb|KDO49490.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
 gb|KDO49491.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1219

 Score =   543 bits (1398),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_011042646.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
 ref|XP_011042647.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=1220

 Score =   543 bits (1398),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_012067196.1| PREDICTED: coatomer subunit alpha-1 [Jatropha curcas]
 ref|XP_012067197.1| PREDICTED: coatomer subunit alpha-1 [Jatropha curcas]
 gb|KDP41738.1| hypothetical protein JCGZ_26756 [Jatropha curcas]
Length=1218

 Score =   543 bits (1398),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_002321558.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEF05685.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1218

 Score =   543 bits (1398),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNSDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_006487332.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Citrus sinensis]
 ref|XP_006487333.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Citrus sinensis]
Length=1219

 Score =   543 bits (1398),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_002512969.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF49472.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   542 bits (1397),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_011028654.1| PREDICTED: coatomer subunit alpha-1 [Populus euphratica]
Length=1218

 Score =   542 bits (1397),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNSDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_011042648.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=1223

 Score =   542 bits (1397),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_008225617.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Prunus mume]
Length=1195

 Score =   541 bits (1394),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/258 (98%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVAPADDILRLSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHARQDIIVSNSEDRSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_004293978.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1219

 Score =   541 bits (1395),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 253/258 (98%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVAPADDILRLSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDRSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_007213296.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
 gb|EMJ14495.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
Length=1217

 Score =   541 bits (1394),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 252/258 (98%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVAPADDILRLSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHARQDIIVSNSEDRSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_010263850.1| PREDICTED: coatomer subunit alpha-1 [Nelumbo nucifera]
Length=1218

 Score =   540 bits (1392),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA+FHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHNEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCATFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHARQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 90/196 (46%), Gaps = 12/196 (6%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT +      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDI-------LRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT--  865
               R       D++       LRL + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDNLYYIKDRFLRLYEFSTQKDNQVIPIRRPGSTSLNQGPRTLSYSPTEN  378

Query  866  LPLIVSGADDRQVKIW  913
              L+ S AD    +++
Sbjct  379  AVLVCSDADGGSYELY  394



>ref|XP_007210424.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
 gb|EMJ11623.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
Length=1218

 Score =   540 bits (1391),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_008240283.1| PREDICTED: coatomer subunit alpha-1 [Prunus mume]
Length=1218

 Score =   540 bits (1391),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_008460997.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
 ref|XP_008460999.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   540 bits (1391),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_010271512.1| PREDICTED: coatomer subunit alpha-1-like [Nelumbo nucifera]
Length=1218

 Score =   540 bits (1391),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 257/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKIHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHNEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHARQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HPEMNLLAAG  308



>ref|XP_008802787.1| PREDICTED: coatomer subunit alpha-1 [Phoenix dactylifera]
Length=1218

 Score =   540 bits (1390),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAG  308



>ref|XP_007017678.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOY14903.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   540 bits (1390),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 253/261 (97%), Positives = 258/261 (99%), Gaps = 3/261 (1%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCI+VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KKTV+PADDILR
Sbjct  121  NWQSRTCIAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKTVAPADDILR  180

Query  761  ---LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
               LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTK
Sbjct  181  LGQLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTK  240

Query  932  AWEVDTLRGHMNNVSCVLFHS  994
            AWEVDT+RGHMNNVSCVLFHS
Sbjct  241  AWEVDTMRGHMNNVSCVLFHS  261


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 32/184 (17%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR------------------------------CLFTLLGHLDYIRTVQF  523
            D  ++VW+    +                                + L GH   +    F
Sbjct  156  DQTVRVWDIGALKKKTVAPADDILRLGQLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASF  215

Query  524  HHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTV  697
            H   P IVS +DD+ +++W         +  + GH + V C  FH ++D++VS S D+++
Sbjct  216  HPTLPLIVSGADDRQVKLWRMNDTKAWEVDTMRGHMNNVSCVLFHSRQDIIVSNSEDKSI  275

Query  698  RVWD  709
            RVWD
Sbjct  276  RVWD  279


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH++ +  V FH  
Sbjct  203  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTMRGHMNNVSCVLFHSR  262

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  263  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILACHPEMNLMAAG  311



>ref|XP_010919610.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919611.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919612.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
Length=1218

 Score =   539 bits (1389),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAG  308



>emb|CBI19788.3| unnamed protein product [Vitis vinifera]
Length=1062

 Score =   535 bits (1378),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRT +SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKT SPADDILR
Sbjct  121  NWQSRTLMSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTSSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV FH+
Sbjct  241  VDTLRGHMNNVSCVFFHA  258


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  TL+     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTLMSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTSSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHARQDVIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 90/196 (46%), Gaps = 12/196 (6%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDVIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILTAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKK-TVSP------ADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT--  865
               R   +VS        D  LRL + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDCLYYVKDRFLRLYEFSTQKDAQVIPIRRPGSAALNQGPRTLSYSPTEN  378

Query  866  LPLIVSGADDRQVKIW  913
              LI S  D    +++
Sbjct  379  AVLICSDVDGGSYELY  394



>ref|XP_004300535.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1218

 Score =   539 bits (1389),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D+++S S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIISNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIISNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_010526595.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526596.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526598.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
Length=1217

 Score =   539 bits (1388),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 248/258 (96%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            +SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDA+VKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  532
            D  ++VW+                +L +    L G +D I         R V    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAIVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDGTKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|XP_009346991.1| PREDICTED: coatomer subunit alpha-2-like [Pyrus x bretschneideri]
Length=1216

 Score =   539 bits (1388),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_011649252.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 ref|XP_011649253.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 gb|KGN61837.1| hypothetical protein Csa_2G249910 [Cucumis sativus]
Length=1219

 Score =   539 bits (1388),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_008461000.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   539 bits (1388),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDVLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDVLRLSQMNADLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_010933642.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   538 bits (1387),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQ+K+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDVIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDVIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPELNLLAAG  308



>ref|XP_010933643.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933644.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933645.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   538 bits (1387),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQ+K+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_008346150.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   538 bits (1387),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 85/187 (45%), Gaps = 10/187 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT +      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDI-------LRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP  871
               R       D +       LR  + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDSMYYVKDRFLRFYEFSTQRDSQVIPIRRPGSSNLNQGAKTLSYSPTEN  378

Query  872  LIVSGAD  892
             ++ G+D
Sbjct  379  AVLIGSD  385



>ref|XP_008448067.1| PREDICTED: coatomer subunit alpha-1 [Cucumis melo]
Length=1217

 Score =   538 bits (1386),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 69/135 (51%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               I+S S+D++IR+W+   RT +      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDLIISNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D +L
Sbjct  319  ERERPAFVISGDSLL  333



>ref|XP_002529504.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF32873.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   538 bits (1386),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV+FH
Sbjct  1    MLTKFETKSNRVKGLSFHCKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVNFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDIFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VD LRGHMNNVSCV+FH+
Sbjct  241  VDALRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDIFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDALRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 73/146 (50%), Gaps = 5/146 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   +  L GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDALRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCI-SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
               IVS S+D++IR+W+   R  I +    H+ + + AS HP+ +L ++A  D  + V+ 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRMGIQNFRREHDRFWILAS-HPEMNL-LAAGHDSGMIVFK  317

Query  710  IGALRKKTVSPADDILRLSQMNTDFF  787
            +   R       D +  + +    FF
Sbjct  318  LERERPAFAVSGDSLFYVKERFLRFF  343



>ref|XP_008393301.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1218

 Score =   538 bits (1385),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 248/258 (96%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSP+DDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPSDDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPSDDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_004148533.1| PREDICTED: coatomer subunit alpha-1 [Cucumis sativus]
 gb|KGN43163.1| hypothetical protein Csa_7G004160 [Cucumis sativus]
Length=1217

 Score =   538 bits (1385),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 69/135 (51%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               I+S S+D++IR+W+   RT +      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDLIISNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D +L
Sbjct  319  ERERPAFVISGDSLL  333



>ref|XP_010672358.1| PREDICTED: coatomer subunit alpha-2-like [Beta vulgaris subsp. 
vulgaris]
Length=1211

 Score =   537 bits (1384),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+VSPADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKSVSPADDIMRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSRQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILTAHPEMNLLAAG  308



>ref|XP_009362204.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362206.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362207.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362208.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
Length=1217

 Score =   537 bits (1384),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDI+R
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQ+K+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQLKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 85/187 (45%), Gaps = 10/187 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT +      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDI-------LRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP  871
               R       D +       LR  + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDSMYYVKDRFLRFYEFSTQRDSQVIPIRRPGSSNLNQGAKTLSYSPTEN  378

Query  872  LIVSGAD  892
             ++ G+D
Sbjct  379  AVLIGSD  385



>ref|XP_008349149.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   536 bits (1382),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 251/258 (97%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFHS
Sbjct  241  VDTLRGHMNNVSCVLFHS  258


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 85/187 (45%), Gaps = 10/187 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT +      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDI-------LRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP  871
               R       D +       LR  + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDSMYYVKDRFLRFYEFSTQRDSQVIPIRRPGSSNLNQGAKTLSYSPTEN  378

Query  872  LIVSGAD  892
             ++ G+D
Sbjct  379  AVLIGSD  385



>ref|XP_002279779.1| PREDICTED: coatomer subunit alpha-1 [Vitis vinifera]
Length=1217

 Score =   536 bits (1381),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 250/258 (97%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRT +SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKT SPADDILR
Sbjct  121  NWQSRTLMSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTSSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV FH+
Sbjct  241  VDTLRGHMNNVSCVFFHA  258


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  TL+     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTLMSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTSSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHARQDVIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 87/187 (47%), Gaps = 10/187 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDVIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILTAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKK-TVSP------ADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP  871
               R   +VS        D  LRL + +T     V  + +      ++G    S+ PT  
Sbjct  319  ERERPAFSVSGDCLYYVKDRFLRLYEFSTQKDAQVIPIRRPGSAALNQGPRTLSYSPTEN  378

Query  872  LIVSGAD  892
             ++  +D
Sbjct  379  AVLICSD  385



>ref|XP_008374746.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1216

 Score =   536 bits (1381),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVD VVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDTVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDILRLSQMNTDLFGGVDTVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHPEMNLLAAG  308



>ref|XP_010690807.1| PREDICTED: coatomer subunit alpha-1 [Beta vulgaris subsp. vulgaris]
Length=1220

 Score =   536 bits (1381),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLLRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I             + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREQDRFWILAAHPEMNLLAAG  308



>ref|XP_010555274.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1217

 Score =   536 bits (1380),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGG+D +VKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGIDVIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  532
            D  ++VW+                +L +    L G +D I         R V    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGIDVIVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|XP_007042068.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97899.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   535 bits (1378),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+LRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVD+VVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDSVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLRKKTVSPADDILRLSQMNTDLFGGVDSVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_007042069.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97900.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   535 bits (1377),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 247/258 (96%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+LRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVD+VVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDSVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLRKKTVSPADDILRLSQMNTDLFGGVDSVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|EPS65879.1| hypothetical protein M569_08896 [Genlisea aurea]
Length=1225

 Score =   534 bits (1375),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 248/258 (96%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVM ASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPAD+++R
Sbjct  121  NWQSRTCISVLTGHNHYVMSASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADEVIR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L QMNTDFFGGVDAVVKYVLEGH+RGVNWASFHPTLPLIVSGADDR VKIWRMNDTKAWE
Sbjct  181  LPQMNTDFFGGVDAVVKYVLEGHERGVNWASFHPTLPLIVSGADDRHVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (51%), Gaps = 6/134 (4%)
 Frame = +2

Query  371  DGPVRGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEY  535
            +G  RGV+   FH + PL VSG DD  +K+W     +   + TL GH++ +  V FH + 
Sbjct  201  EGHERGVNWASFHPTLPLIVSGADDRHVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQ  260

Query  536  PWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG  715
              IVS S+D++IRIW+   RT +      +      S HP+ +L ++A  D  + V+ + 
Sbjct  261  DVIVSNSEDKSIRIWDSTKRTGLQTFRREHDRFWILSAHPEMNL-LAAGHDNGIMVFKLE  319

Query  716  ALRKKTVSPADDIL  757
              R       D +L
Sbjct  320  RERPAFSVTGDSLL  333



>emb|CDY61804.1| BnaC03g76410D [Brassica napus]
Length=493

 Score =   511 bits (1315),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK+VSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKSVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKSVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL  613
               IVS S+D++IR+W+   RT I   
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTF  286



>gb|KJB47565.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47566.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47567.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47568.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
Length=1216

 Score =   533 bits (1374),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 255/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D+VVS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAKQDIVVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               +VS S+D++IR+W+   RT +      +      + HP+ + V++A  D  + V+ +
Sbjct  260  QDIVVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMN-VLAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R       D + 
Sbjct  319  ERERPAFAVSGDSLF  333



>ref|XP_006828935.1| PREDICTED: coatomer subunit alpha-1 [Amborella trichopoda]
 gb|ERM96351.1| hypothetical protein AMTR_s00001p00220200 [Amborella trichopoda]
Length=1216

 Score =   533 bits (1373),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 256/258 (99%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNT+ FGGVDAVVKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTELFGGVDAVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVSCV+FH+
Sbjct  241  VDTLRGHTNNVSCVMFHA  258


 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHNEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTELFGGVDAVVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVMFHARQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|EMS45609.1| Coatomer subunit alpha-3 [Triticum urartu]
Length=1200

 Score =   533 bits (1372),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R      AD +  +      FF
Sbjct  319  ERERPAFSVSADTVFYVKDRFLRFF  343



>gb|EMT27309.1| Coatomer subunit alpha-3 [Aegilops tauschii]
Length=1217

 Score =   533 bits (1372),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R      AD +  +      FF
Sbjct  319  ERERPAFSVSADTVFYVKDRFLRFF  343



>gb|KJB77745.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=852

 Score =   522 bits (1344),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLNKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN++ FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDT RGHMNNVSCVLFHS
Sbjct  241  VDTFRGHMNNVSCVLFHS  258


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +    GH + V C  FH K D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSKLDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNVLAAG  308



>gb|KHG21379.1| hypothetical protein F383_26788 [Gossypium arboreum]
Length=1213

 Score =   531 bits (1368),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK  SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKGASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKGASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEINLLAAG  308



>gb|KJB32566.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1213

 Score =   531 bits (1368),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK  SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKGASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKGASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEINLLAAG  308



>gb|KJB47562.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1064

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LS MNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYK------------------LHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                    ++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTASPADDILRLSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNILAAG  308



>ref|NP_001062612.1| Os09g0127800 [Oryza sativa Japonica Group]
 sp|Q0J3D9.1|COPA3_ORYSJ RecName: Full=Coatomer subunit alpha-3; AltName: Full=Alpha-coat 
protein 3; Short=Alpha-COP 3 [Oryza sativa Japonica Group]
 dbj|BAF24526.1| Os09g0127800 [Oryza sativa Japonica Group]
 gb|EAZ43816.1| hypothetical protein OsJ_28435 [Oryza sativa Japonica Group]
Length=1218

 Score =   531 bits (1367),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  308



>gb|EAZ08188.1| hypothetical protein OsI_30447 [Oryza sativa Indica Group]
Length=1218

 Score =   531 bits (1367),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_002466586.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
 gb|EER93584.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
Length=1217

 Score =   530 bits (1366),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 69/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R       D +  +      FF
Sbjct  319  ERERPAFCVSGDTVFYVKDRFLRFF  343



>ref|NP_001051056.1| Os03g0711400 [Oryza sativa Japonica Group]
 sp|Q9AUR8.1|COPA1_ORYSJ RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Oryza sativa Japonica Group]
 gb|AAK18834.1|AC082645_4 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98513.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12970.1| Os03g0711400 [Oryza sativa Japonica Group]
 gb|EAZ28339.1| hypothetical protein OsJ_12317 [Oryza sativa Japonica Group]
 dbj|BAG94532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1218

 Score =   530 bits (1366),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_008646256.1| PREDICTED: uncharacterized protein LOC100384351 isoform X1 [Zea 
mays]
 tpg|DAA50981.1| TPA: hypothetical protein ZEAMMB73_408440 [Zea mays]
Length=1218

 Score =   530 bits (1366),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R       D +  L      FF
Sbjct  319  ERERPAFCVSGDTVFYLKDRFLRFF  343



>gb|KJB32565.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1264

 Score =   531 bits (1367),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK  SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKGASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKGASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEINLLAAG  308



>gb|KHG24640.1| hypothetical protein F383_03247 [Gossypium arboreum]
Length=1218

 Score =   530 bits (1364),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 245/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LS MNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  532
            D  ++VW+                +L      L G +D +         R V    FH  
Sbjct  156  DQTVRVWDIGSLKKKTASPADDILRLSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNILAAG  308



>ref|XP_004982004.1| PREDICTED: coatomer subunit alpha-3-like [Setaria italica]
Length=1219

 Score =   530 bits (1364),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R       D +  +      FF
Sbjct  319  ERERPAFCVSGDTVFYVKDRFLRFF  343



>gb|KJB47564.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1218

 Score =   529 bits (1363),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 244/258 (95%), Positives = 254/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LS MNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  532
            D  ++VW+                +L      L G +D +         R V    FH  
Sbjct  156  DQTVRVWDIGSLKKKTASPADDILRLSHMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNILAAG  308



>ref|XP_010531460.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1219

 Score =   529 bits (1362),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCI+VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCIAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L QMN+D FGGVDA+VKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WR+NDTKAWE
Sbjct  181  LGQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRVNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHECPWIVSASDDQTIRIWNWQSRTCIAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLGQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRVNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 79/170 (46%), Gaps = 17/170 (10%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHDGPV--  382
            M   F  K + V   S   + R W + +L    +   D   R+G +  D F   D  V  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMRLGQMNSDLFGGVDAIVKY  198

Query  383  ------RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
                  RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH 
Sbjct  199  VLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRVNDTKAWEVDTLRGHMNNVSCVMFHA  258

Query  530  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +   IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  259  KQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|XP_008644216.1| PREDICTED: uncharacterized protein LOC100502115 isoform X1 [Zea 
mays]
 gb|AFW67844.1| hypothetical protein ZEAMMB73_579366 [Zea mays]
Length=1217

 Score =   528 bits (1361),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 69/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R       D +  +      FF
Sbjct  319  ERERPAFCVSGDTVFYVKDRFLRFF  343



>ref|XP_010109755.1| hypothetical protein L484_008431 [Morus notabilis]
 gb|EXC24660.1| hypothetical protein L484_008431 [Morus notabilis]
Length=1220

 Score =   528 bits (1360),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 246/259 (95%), Positives = 254/259 (98%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVS-PADDIL  757
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KKT S P DD+L
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKTGSPPGDDML  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            RLSQMNTD FGG+DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAW
Sbjct  181  RLSQMNTDLFGGIDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAW  240

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGHMNNVSCV+FH+
Sbjct  241  EVDTLRGHMNNVSCVMFHA  259


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWN----------------YKLHRCLFTLLGHLDYI---------RTVQ---FHH  529
            D  ++VW+                 +L +    L G +D +         R V    FH 
Sbjct  156  DQTVRVWDIGALKKKTGSPPGDDMLRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RV
Sbjct  216  TLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDV  278


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  261  QDIIVSNSEDKSIRVWDVTRRTGVQTFRREHDRFWILAAHPEMNLLAAG  309



>ref|XP_002888041.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64300.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
Length=1217

 Score =   528 bits (1359),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDA+VKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|NP_176393.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
 sp|Q94A40.2|COPA1_ARATH RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Arabidopsis thaliana]
 gb|AAC28519.1| Strong similarity to coatamer alpha subunit (HEPCOP) homolog 
gb|U24105 from Homo sapiens [Arabidopsis thaliana]
 gb|AEE33914.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
Length=1216

 Score =   527 bits (1358),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDA+VKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>emb|CDY53172.1| BnaA06g40510D [Brassica napus]
Length=831

 Score =   516 bits (1329),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 237/258 (92%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_010066202.1| PREDICTED: coatomer subunit alpha-2-like [Eucalyptus grandis]
 gb|KCW64037.1| hypothetical protein EUGRSUZ_G01711 [Eucalyptus grandis]
Length=1218

 Score =   527 bits (1358),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 244/258 (95%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLS HSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSLHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI AL+KKT SP DD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDISALKKKTASPGDDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHT  258


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISALKKKTASPGDDLLRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K++++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHTKQEIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHTK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      H+ + + AS HP+ +L+ + 
Sbjct  260  QEIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAS-HPEMNLLAAG  308



>gb|KJB32563.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
 gb|KJB32564.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
Length=1213

 Score =   527 bits (1357),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWD+ +L+KK  SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDVSSLKKKGASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDVSSLKKKGASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHPEINLLAAG  308



>ref|XP_006411704.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
 gb|ESQ53157.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
Length=1216

 Score =   527 bits (1357),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 253/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK H+C FTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHKCNFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIGALRKKTVSPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGALRKKTVSPADDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LSQMNADLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 79/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDLLRLSQMNADLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>emb|CAE45585.1| coatomer alpha subunit-like protein [Lotus japonicus]
Length=1221

 Score =   527 bits (1357),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K   PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHPEMNLLAAG  308



>ref|XP_006300379.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
 gb|EOA33277.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
Length=1218

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDA+VKYVLEGHDRGVNWA+FHP LPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>gb|KHG26300.1| hypothetical protein F383_08243 [Gossypium arboreum]
Length=1217

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLNKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN++ FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDT RGHMNNVSCV+FHS
Sbjct  241  VDTFRGHMNNVSCVMFHS  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +    GH + V C  FH K D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVMFHSKLDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (45%), Gaps = 33/169 (20%)
 Frame = +2

Query  266  SFHSKRPWILASLHSGVIQLWDYRMGTL----------IDRFDE----------------  367
            SFH K   ++++     +++WD  +G+L          I RF +                
Sbjct  142  SFHPKEDLVVSASLDQTVRVWD--IGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYV  199

Query  368  ---HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
               HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVMFHSK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNVLAAG  308



>ref|XP_010096174.1| Coatomer subunit alpha-1 [Morus notabilis]
 gb|EXB63569.1| Coatomer subunit alpha-1 [Morus notabilis]
Length=1234

 Score =   527 bits (1357),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 245/259 (95%), Positives = 254/259 (98%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  15   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  74

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  75   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRMW  134

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVS-PADDIL  757
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KKT S P DD+L
Sbjct  135  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKTGSPPGDDML  194

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            RLSQMNTD FGG+DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAW
Sbjct  195  RLSQMNTDLFGGIDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAW  254

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGHMNNVSCV+FH+
Sbjct  255  EVDTLRGHMNNVSCVMFHA  273


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (47%), Gaps = 30/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  110  IRTVQFHHENPWIVSASDDQTIRMWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  169

Query  434  DYKIKVWN----------------YKLHRCLFTLLGHLDYI---------RTVQ---FHH  529
            D  ++VW+                 +L +    L G +D +         R V    FH 
Sbjct  170  DQTVRVWDIGALKKKTGSPPGDDMLRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWAAFHP  229

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RV
Sbjct  230  TLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRV  289

Query  704  WD  709
            WD
Sbjct  290  WD  291


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  215  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  274

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  275  QDIIVSNSEDKSIRVWDATRRTGLQTFRREHDRFWILAAHPEMNLLAAG  323



>gb|KHN25415.1| Coatomer subunit alpha-2 [Glycine soja]
Length=1221

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K   PADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPADDVLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPADDVLRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHPEMNLLAAG  308



>ref|XP_003540979.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Glycine 
max]
 ref|XP_006592088.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Glycine 
max]
Length=1221

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K   PADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPADDVLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPADDVLRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHPEMNLLAAG  308



>emb|CDY41989.1| BnaA01g05610D [Brassica napus]
Length=850

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/258 (92%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_004507488.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Cicer arietinum]
 ref|XP_004507489.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Cicer arietinum]
Length=1222

 Score =   526 bits (1355),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K   P+DDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPSDDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVVFHA  258


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPSDDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVVFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVVFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHPEMNLLAAG  308



>gb|KJB77746.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=1216

 Score =   526 bits (1354),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L KKT SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLNKKTASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN++ FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDT RGHMNNVSCVLFHS
Sbjct  241  VDTFRGHMNNVSCVLFHS  258


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 83/182 (46%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +    GH + V C  FH K D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSKLDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DV  277


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +++ + 
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHPEMNVLAAG  308



>ref|XP_009400896.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400897.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400898.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
Length=1216

 Score =   525 bits (1353),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 244/258 (95%), Positives = 253/258 (98%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPW+LASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWVLASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQT+RVWDIGALRKK V+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTIRVWDIGALRKK-VAPADDILR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMND+KAWE
Sbjct  180  LSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVSCV+FH+
Sbjct  240  VDTLRGHTNNVSCVMFHA  257


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 80/180 (44%), Gaps = 28/180 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------CLFTLLGHLDYIRTVQFHHEY  535
            D  I+VW+    R                            + L GH   +    FH   
Sbjct  156  DQTIRVWDIGALRKKVAPADDILRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTL  215

Query  536  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            P IVS +DD+ +++W         +  L GH + V C  FH K +++VS S D+++R+WD
Sbjct  216  PLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAKMEVIVSNSEDKSIRIWD  275


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I  +   +      S HP+ +L+ + 
Sbjct  259  MEVIVSNSEDKSIRIWDANKRTGIQTIRREHDRFWILSAHPEMNLLAAG  307



>ref|XP_007131781.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
 gb|ESW03775.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
Length=1221

 Score =   525 bits (1353),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA+FHPKED+VVSASLDQTVRVWDIG+L++K   PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCATFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHPEMNLLAAG  308



>ref|XP_004496148.1| PREDICTED: coatomer subunit alpha-1-like [Cicer arietinum]
Length=1218

 Score =   525 bits (1352),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 243/258 (94%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIG+L++K  SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGSLKRKNASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKNASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>emb|CDX90339.1| BnaA08g16450D [Brassica napus]
Length=904

 Score =   516 bits (1329),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK+VSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKSVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKSVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_003607006.1| Coatomer alpha subunit-like protein [Medicago truncatula]
 gb|AES89203.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1206

 Score =   525 bits (1351),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            M TKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MFTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K   P+DDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPPSDDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPPSDDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHPEMNLLAAG  308



>sp|Q9AUR7.1|COPA2_ORYSJ RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Oryza sativa Japonica Group]
 gb|AAK18837.1|AC082645_7 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98514.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY91611.1| hypothetical protein OsI_13245 [Oryza sativa Indica Group]
 gb|EAZ28340.1| hypothetical protein OsJ_12318 [Oryza sativa Japonica Group]
Length=1218

 Score =   524 bits (1350),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI ALRKK+VSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDISALRKKSVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHECPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDISALRKKSVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_003537852.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1221

 Score =   524 bits (1350),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K    ADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPAADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHEDPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPAADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHPEMNLLAAG  308



>gb|KHN39822.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1221

 Score =   524 bits (1350),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKED+VVSASLDQTVRVWDIG+L++K    ADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASLDQTVRVWDIGSLKRKAGPAADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + + VS   
Sbjct  96   IRTVQFHHEDPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDIVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKRKAGPAADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHPEMNLLAAG  308



>ref|XP_010472129.1| PREDICTED: coatomer subunit alpha-2-like, partial [Camelina sativa]
Length=1118

 Score =   521 bits (1342),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>gb|KEH43347.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1216

 Score =   524 bits (1349),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPK+DLVVSASLDQTVRVWDIG+L++K+ SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKDDLVVSASLDQTVRVWDIGSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVKIWRMNDTKAWE
Sbjct  181  LGQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>ref|XP_010430239.1| PREDICTED: coatomer subunit alpha-1 [Camelina sativa]
Length=1216

 Score =   523 bits (1347),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETK+NRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKNNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQ LFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQSLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI+R
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGGVDA+VKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  LTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDIMRLTQMNSDLFGGVDAIVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|XP_003556297.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1218

 Score =   523 bits (1346),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI +L++K+ SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISSLKRKSASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>ref|XP_003536291.1| PREDICTED: coatomer subunit alpha-1-like [Glycine max]
Length=1218

 Score =   523 bits (1346),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI +L++K+ SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISSLKRKSASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>ref|XP_009388919.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388927.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388935.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   522 bits (1345),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/258 (95%), Positives = 251/258 (97%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI ALRK+ VSPA+DILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISALRKR-VSPAEDILR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGG DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMND+KAWE
Sbjct  180  LSQMNTDLFGGTDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  240  VDTLRGHMNNVSCVMFHA  257


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 81/180 (45%), Gaps = 28/180 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------CLFTLLGHLDYIRTVQFHHEY  535
            D  ++VW+    R                            + L GH   +    FH   
Sbjct  156  DQTVRVWDISALRKRVSPAEDILRLSQMNTDLFGGTDAVVKYVLEGHDRGVNWASFHPTL  215

Query  536  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+WD
Sbjct  216  PLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIWD  275


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSCVMFHAK  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  259  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  307



>gb|KHN37868.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   522 bits (1345),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI +L++K+ SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISSLKRKSASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>ref|XP_010429041.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1224

 Score =   522 bits (1345),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_003564667.1| PREDICTED: coatomer subunit alpha-3-like [Brachypodium distachyon]
Length=1219

 Score =   522 bits (1345),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 237/258 (92%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDI+R
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKSASPADDIMRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_006404585.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 ref|XP_006404586.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46038.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46039.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
Length=1214

 Score =   522 bits (1344),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+LRKKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLRKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLRKKTVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_010066199.1| PREDICTED: coatomer subunit alpha-1 [Eucalyptus grandis]
Length=1218

 Score =   522 bits (1344),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 242/258 (94%), Positives = 248/258 (96%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI AL+ KT SP DD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDISALKNKTASPGDDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L QMNTD FGGVD VVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LGQMNTDLFGGVDVVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISALKNKTASPGDDLLRLGQMNTDLFGGVDVVVKYVLEGHDRGVNWASFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 76/167 (46%), Gaps = 29/167 (17%)
 Frame = +2

Query  266  SFHSKRPWILASLHSGVIQLWD---------------YRMGTL-IDRF-----------D  364
            SFH K   ++++     +++WD                R+G +  D F           +
Sbjct  142  SFHPKEDLVVSASLDQTVRVWDISALKNKTASPGDDLLRLGQMNTDLFGGVDVVVKYVLE  201

Query  365  EHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYP  538
             HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +  
Sbjct  202  GHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQD  261

Query  539  WIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
             IVS S+D++IRIW+   RT I      +      S HP+ +L+ + 
Sbjct  262  IIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHPEMNLLAAG  308



>ref|XP_010429048.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
 ref|XP_010429049.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
Length=1220

 Score =   522 bits (1344),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_010229358.1| PREDICTED: coatomer subunit alpha-3 [Brachypodium distachyon]
Length=1218

 Score =   522 bits (1344),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 237/258 (92%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDI+R
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSSSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLI+SGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIISGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKSSSPADDIMRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P I+S +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIISGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL +SG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIISGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAAHPEMNLLAAG  308



>gb|EPS70817.1| hypothetical protein M569_03938, partial [Genlisea aurea]
Length=1229

 Score =   522 bits (1345),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 244/259 (94%), Positives = 252/259 (97%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDG-PVRGVHF  397
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGT ID+FDEH G PVRGVHF
Sbjct  11   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTRIDQFDEHAGVPVRGVHF  70

Query  398  HKSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRI  577
            HKSQPLFVSGGDD+KIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQTIRI
Sbjct  71   HKSQPLFVSGGDDFKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQTIRI  130

Query  578  WNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIL  757
            WNWQSR CISVLTGHNHYVM ASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP++D +
Sbjct  131  WNWQSRACISVLTGHNHYVMSASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPSEDFI  190

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            RL QMNTDFFGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW
Sbjct  191  RLPQMNTDFFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  250

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGHMNNVSCVLFH+
Sbjct  251  EVDTLRGHMNNVSCVLFHA  269


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            V+ + FH + PWI+++     I++W+++    I     H+  V    FH  + L VS   
Sbjct  107  VRTVQFHHEYPWIVSASDDQTIRIWNWQSRACISVLTGHNHYVMSASFHPKEDLVVSASL  166

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  167  DQTVRVWDIGALRKKTVSPSEDFIRLPQMNTDFFGGIDAVVKYVLEGHDRGVNWASFHPT  226

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  227  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVW  286

Query  707  D  709
            D
Sbjct  287  D  287


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  211  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  270

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  271  QDIIVSNSEDKSIRVWDSTKRTGLQNFRREHDRFWILAAHPEMNLLAAG  319



>ref|NP_179734.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
 sp|Q9SJT9.1|COPA2_ARATH RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Arabidopsis thaliana]
 gb|AAD23699.1| coatomer alpha subunit [Arabidopsis thaliana]
 dbj|BAF00596.1| coatomer alpha subunit [Arabidopsis thaliana]
 gb|AEC07173.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
Length=1218

 Score =   522 bits (1344),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_010416888.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1221

 Score =   522 bits (1344),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 239/258 (93%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_007144262.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 ref|XP_007144263.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16256.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16257.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
Length=1218

 Score =   521 bits (1343),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 249/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI +L++K+ SPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHP LPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPVLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISSLKRKSASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPV  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH   PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPVLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   +  AD + 
Sbjct  319  ERERPAFIVSADSLF  333



>gb|AAS58474.1| coatomer alpha subunit [Hordeum vulgare subsp. vulgare]
Length=1218

 Score =   521 bits (1342),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIR+W
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDI+R
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSSSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  241  VDTLRGHMNNVSCVLFHA  258


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRVWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKSSSPADDIMRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAAHPEMNLLAAG  308



>gb|KHN00939.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   521 bits (1342),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+CISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI +L++K+ SPADDILR
Sbjct  121  NWQSRSCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDISSLKRKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVS ADDRQVK+WRMNDTKAWE
Sbjct  181  LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 85/181 (47%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRSCISVLTGHNHYVMCALFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDISSLKRKSASPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVSA+DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R   V   D + 
Sbjct  319  ERERPAFVVSGDSLF  333



>ref|XP_006293578.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 ref|XP_006293579.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26476.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26477.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
Length=1220

 Score =   521 bits (1341),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRLW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I+LW+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRLWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSASPADDLMRFSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_006650487.1| PREDICTED: coatomer subunit alpha-3-like [Oryza brachyantha]
Length=1219

 Score =   520 bits (1340),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  ALRKK+VSPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDTSALRKKSVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHECPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDTSALRKKSVSPADDILRLTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IRIW+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGVQTFRREHDRFWILAAHPEMNLLAAG  308



>ref|XP_001771211.1| predicted protein [Physcomitrella patens]
 gb|EDQ63922.1| predicted protein [Physcomitrella patens]
Length=1223

 Score =   520 bits (1340),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIGAL+KK+VSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHIKEDLVVSASLDQTVRVWDIGALKKKSVSPADDMMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG D+VVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGGDSVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHIKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSVSPADDMMRLTQMNTDLFGGGDSVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DM  277


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSAHPEVNLLAAG  308



>ref|XP_011622877.1| PREDICTED: coatomer subunit alpha-1 [Amborella trichopoda]
Length=1221

 Score =   519 bits (1336),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/256 (94%), Positives = 247/256 (96%), Gaps = 0/256 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ML KFETKSNRVKGLSFH KRPWILASLH+GVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLIKFETKSNRVKGLSFHGKRPWILASLHTGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVNFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLV SASLDQTVRVWDIGALRKKTVSPADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVASASLDQTVRVWDIGALRKKTVSPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGGDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLF  988
            VDTL+GH NNVSCV+F
Sbjct  241  VDTLKGHANNVSCVMF  256


 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 78/181 (43%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ ++FH + PWI+++     I++W+++  T I     H+  V    FH  + L  S   
Sbjct  96   IRTVNFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVASASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGGDAVVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  F  K D++VS S D+ +RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLKGHANNVSCVMFVAKHDIIVSNSEDKNIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V F  +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLKGHANNVSCVMFVAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  IVS S+D+ IR+W+   R  +      +      + HP  +L+ + 
Sbjct  260  HDIIVSNSEDKNIRVWDASRRVVLMTFRREHDRFWVLAAHPSMNLLAAG  308



>ref|XP_002966115.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
 gb|EFJ32142.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
Length=1139

 Score =   516 bits (1330),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDI ALRKKTVSPA+D+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHVKEDLVVSASLDQTVRVWDISALRKKTVSPAEDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGG DAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNSDLFGGGDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHQEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHVKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDISALRKKTVSPAEDLLRLTQMNSDLFGGGDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+T+R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSEDKTIRIW  275

Query  707  DI  712
            D+
Sbjct  276  DM  277


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 98/221 (44%), Gaps = 12/221 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D+TIRIW+   R+ +      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKTIRIWDMSKRSGVHTFRREHDRFWILSGHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNT---DFFGGVDAVVKYVLEGHDRGVNWA----SFHPT--  865
               R         +  + + +    DF  G D  +  +      G+N A    S++P   
Sbjct  319  ERERPAYTVSGGVLYYVKERHLRTYDFATGKDNPLIAIRRPGSTGMNQAPRTMSYNPAEN  378

Query  866  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLF  988
              L+ S  D+   +++ ++     + DT      + S  +F
Sbjct  379  AVLLCSDVDNGSYELYVISKDSIGKNDTQEAKKGSGSSAVF  419



>ref|XP_001766709.1| predicted protein [Physcomitrella patens]
 gb|EDQ68562.1| predicted protein [Physcomitrella patens]
Length=1215

 Score =   518 bits (1334),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 252/258 (98%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHS+RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHSRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTV+FHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVKFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIGAL+KK+VSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHIKEDLVVSASLDQTVRVWDIGALKKKSVSPADDMMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG D+VVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LAQMNTDLFGGGDSVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCVLFH+
Sbjct  241  VDTLRGHVNNVSCVLFHA  258


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 85/182 (47%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVKFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHIKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGALKKKSVSPADDMMRLAQMNTDLFGGGDSVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVLFHARQDVIVSNSEDKSIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DM  277


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  260  QDVIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSVHPEMNLLAAG  308



>ref|XP_008672096.1| PREDICTED: uncharacterized protein LOC100192909 isoform X1 [Zea 
mays]
Length=1217

 Score =   518 bits (1334),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/258 (91%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCV+FH+
Sbjct  241  VDTLRGHMNNVSCVMFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHECPWIVSASDDQTIRIWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKSASPADDILRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ ++IW         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 69/145 (48%), Gaps = 3/145 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT I      +      + HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNTDFF  787
               R       D +  +      FF
Sbjct  319  ERERPAFCVSGDTVFYVKDRFLKFF  343



>emb|CDY53168.1| BnaA06g40470D [Brassica napus]
Length=1208

 Score =   518 bits (1333),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_006411687.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
 gb|ESQ53140.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
Length=1221

 Score =   518 bits (1334),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/258 (92%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDY IKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYTIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPK+DLVVSASLDQTVRVWDIG+LR+K+VSPADD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASLDQTVRVWDIGSLRQKSVSPADDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQ+K+WRMN+TKAWE
Sbjct  181  LSQMNADLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  532
            D  ++VW+                +L +    L G +D I         R V    FH  
Sbjct  156  DQTVRVWDIGSLRQKSVSPADDLLRLSQMNADLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ I++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQIKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHPEMNLLAAG  308



>ref|XP_002982185.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
 gb|EFJ16853.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
Length=1216

 Score =   518 bits (1333),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDI ALRKKTVSPA+D+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHVKEDLVVSASLDQTVRVWDISALRKKTVSPAEDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGG DAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNSDLFGGGDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHQEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHVKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDISALRKKTVSPAEDLLRLTQMNSDLFGGGDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+T+R+W
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSEDKTIRIW  275

Query  707  DI  712
            D+
Sbjct  276  DM  277


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 98/221 (44%), Gaps = 12/221 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D+TIRIW+   R+ +      +      S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKTIRIWDMSKRSGVHTFRREHDRFWILSGHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMNT---DFFGGVDAVVKYVLEGHDRGVNWA----SFHPT--  865
               R         +  + + +    DF  G D  +  +      G+N A    S++P   
Sbjct  319  ERERPAYTVSGGVLYYVKERHLRTYDFATGKDNPLIAIRRPGSTGMNQAPRTMSYNPAEN  378

Query  866  LPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLF  988
              L+ S  D+   +++ ++     + DT      + S  +F
Sbjct  379  AVLLCSDVDNGSYELYVISKDSIGKNDTQEAKKGSGSSAVF  419



>ref|XP_009101859.1| PREDICTED: coatomer subunit alpha-2 [Brassica rapa]
Length=1220

 Score =   518 bits (1333),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKY LEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYFLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLFT---------LLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKYFLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_001753855.1| predicted protein [Physcomitrella patens]
 gb|EDQ81177.1| predicted protein [Physcomitrella patens]
Length=1217

 Score =   517 bits (1332),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 238/258 (92%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIGALRKK+V+PA D+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHIKEDLVVSASLDQTVRVWDIGALRKKSVAPAVDMLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMNTD FGG D+VVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  181  LTQMNTDLFGGGDSVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH+NNVSCV+FH+
Sbjct  241  VDTLRGHVNNVSCVMFHA  258


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (45%), Gaps = 9/177 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   RT +             S HP+ +L ++A  D  + V+ +
Sbjct  260  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREQDRFWILSAHPEMNL-LAAGHDSGMIVFKL  318

Query  713  GALRKKTVSPADDILRLSQMN--TDFFGGVDAVVKYVLEGHDRGVNWA----SFHPT  865
               R       D +  +   N  T  F G D  +  +      G+N      S++P 
Sbjct  319  ERERPACAVQGDTLYYVKDRNLRTYDFAGRDNTLISIRRAGSTGLNQGPRTLSYNPA  375



>ref|XP_009109461.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1221

 Score =   517 bits (1332),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 251/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIG+L+KK+VSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKSVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIGSLKKKSVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHPEINLLAAG  308



>ref|XP_009101857.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1230

 Score =   517 bits (1332),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/258 (91%), Positives = 250/258 (97%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI +L+KKTVSPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIASLKKKTVSPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             +QMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW+                   +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWDIASLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V    FH K+D++VS S D+++RVW
Sbjct  216  LPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAVHPEINLLAAG  308



>ref|XP_009407817.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1215

 Score =   516 bits (1330),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 241/258 (93%), Positives = 249/258 (97%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR CISVLTGHNHYVMCASFHPKEDL+VSASLDQT+RVWDI +LRKK VSPADDILR
Sbjct  121  NWQSRNCISVLTGHNHYVMCASFHPKEDLIVSASLDQTIRVWDISSLRKK-VSPADDILR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L QMN D FGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMND+KAWE
Sbjct  180  LGQMNADLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  240  VDTLRGHMNNVSSVMFHA  257


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 79/166 (48%), Gaps = 28/166 (17%)
 Frame = +2

Query  266  SFHSKRPWILASLHSGVIQLWD--------------YRMGTL-IDRFDEHDGPV------  382
            SFH K   I+++     I++WD               R+G +  D F   D  V      
Sbjct  142  SFHPKEDLIVSASLDQTIRVWDISSLRKKVSPADDILRLGQMNADLFGGVDAVVKYVLEG  201

Query  383  --RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
              RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +   
Sbjct  202  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSSVMFHAKQDI  261

Query  542  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            IVS S+D++IRIW+   RT I      +      + HP+ +L+ + 
Sbjct  262  IVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  307



>ref|XP_009397879.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   513 bits (1321),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 240/258 (93%), Positives = 249/258 (97%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDY MGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYSMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQT+RVWDIG+LR+K V PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTIRVWDIGSLRQKVV-PADDILR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMND+KAWE
Sbjct  180  LSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVS V+FH+
Sbjct  240  VDTLRGHTNNVSSVMFHT  257


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 28/180 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWN--------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHEY  535
            D  I+VW+               +L +    L G +D +         R V    FH   
Sbjct  156  DQTIRVWDIGSLRQKVVPADDILRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTL  215

Query  536  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            P IVS +DD+ +++W         +  L GH + V    FH K D++VS S D+++RVWD
Sbjct  216  PLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSSVMFHTKMDIIVSNSEDKSIRVWD  275


 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 16/169 (9%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD-YRMGTL-IDRFDEHDGPV---  382
            M   F  K + V   S   + R W + SL   V+   D  R+  +  D F   D  V   
Sbjct  139  MCASFHPKEDLVVSASLDQTIRVWDIGSLRQKVVPADDILRLSQMNTDLFGGIDAVVKYV  198

Query  383  -----RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
                 RGV+   FH + PL VSG DD ++K+W     +   + TL GH + + +V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSSVMFHTK  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP  +L+ + 
Sbjct  259  MDIIVSNSEDKSIRVWDATKRTGVQTFRREHDRFWILAVHPAMNLLAAG  307



>ref|XP_002878550.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54809.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
Length=1197

 Score =   512 bits (1319),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 236/255 (93%), Positives = 246/255 (96%), Gaps = 0/255 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGAL+KK+ SPADD++R
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALKKKSASPADDLMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
             SQMN+D FGGVDA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN+TKAWE
Sbjct  181  FSQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVL  985
            VDTL  HMNNVS V+
Sbjct  241  VDTLPSHMNNVSSVM  255



>ref|XP_002957821.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
 gb|EFJ41149.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
Length=1224

 Score =   510 bits (1313),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/259 (91%), Positives = 246/259 (95%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP-ADDIL  757
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDI  LRKKTV+P  +D+L
Sbjct  121  NWQSRTCISVLTGHNHYVMCAVFHPKEDLVVSASLDQTVRVWDISGLRKKTVAPGGEDVL  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            RL QMN D FGG DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WR N++KAW
Sbjct  181  RLPQMNADLFGGGDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNESKAW  240

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGH NNVSCV+FH+
Sbjct  241  EVDTLRGHTNNVSCVMFHA  259


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 83/183 (45%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCAVFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHRCLFTLLGHLDYIRTVQ----------------------------FHH  529
            D  ++VW+    R      G  D +R  Q                            FH 
Sbjct  156  DQTVRVWDISGLRKKTVAPGGEDVLRLPQMNADLFGGGDAVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W +       +  L GH + V C  FH ++DL++S S D+++RV
Sbjct  216  TLPLIVSGADDRQVKLWRYNESKAWEVDTLRGHTNNVSCVMFHARQDLIISNSEDKSIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDM  278


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W Y   +   + TL GH + +  V FH  
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNESKAWEVDTLRGHTNNVSCVMFHAR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  261  QDLIISNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAS-HPEINLLAAG  309



>ref|XP_005651719.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27175.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
Length=1233

 Score =   509 bits (1312),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 236/259 (91%), Positives = 247/259 (95%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH EYPW+VSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHQEYPWVVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP-ADDIL  757
            NWQSRTCISVLTGHNHYVM A FHPK+DLVVSASLDQTVRVWDI  LRKKTV+P  +D+L
Sbjct  121  NWQSRTCISVLTGHNHYVMSACFHPKDDLVVSASLDQTVRVWDISGLRKKTVAPGGEDML  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            RL QMN+D FGG DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAW
Sbjct  181  RLPQMNSDLFGGGDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAW  240

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGH+NNVSCV+FH+
Sbjct  241  EVDTLRGHVNNVSCVMFHA  259


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PW++++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHQEYPWVVSASDDQTIRIWNWQSRTCISVLTGHNHYVMSACFHPKDDLVVSASL  155

Query  434  DYKIKVWNYKLHRCLFTLLGHLDYIRTVQ----------------------------FHH  529
            D  ++VW+    R      G  D +R  Q                            FH 
Sbjct  156  DQTVRVWDISGLRKKTVAPGGEDMLRLPQMNSDLFGGGDAVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RV
Sbjct  216  TLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSEDKSIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDM  278


 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  652
               IVS S+D++IR+W+   RT +           ++  H+   + A+ H
Sbjct  261  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWIMAAHSEVNLLAAGH  310



>ref|XP_001693686.1| alpha-COP [Chlamydomonas reinhardtii]
 gb|EDP08940.1| alpha-COP [Chlamydomonas reinhardtii]
Length=1256

 Score =   509 bits (1311),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/259 (90%), Positives = 245/259 (95%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPW+LASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWVLASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP-ADDIL  757
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIG LRKKTV+P  +D+L
Sbjct  121  NWQSRTCISVLTGHNHYVMCAMFHPKEDLVVSASLDQTVRVWDIGGLRKKTVAPGGEDVL  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            R+ QMN D FGG DAVVKYVLEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WR N  KAW
Sbjct  181  RMPQMNADLFGGGDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNGNKAW  240

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGH NNVSCV+FH+
Sbjct  241  EVDTLRGHTNNVSCVMFHA  259


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 83/183 (45%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCAMFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHRCLFTLLGHLDYIRTVQ----------------------------FHH  529
            D  ++VW+    R      G  D +R  Q                            FH 
Sbjct  156  DQTVRVWDIGGLRKKTVAPGGEDVLRMPQMNADLFGGGDAVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W +       +  L GH + V C  FH ++DL++S S D+++RV
Sbjct  216  TLPLIVSGADDRQVKLWRYNGNKAWEVDTLRGHTNNVSCVMFHARQDLIISNSEDKSIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDM  278


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W Y  ++   + TL GH + +  V FH  
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNGNKAWEVDTLRGHTNNVSCVMFHAR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      H+ + + AS HP+ +L+ + 
Sbjct  261  QDLIISNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAS-HPEINLLAAG  309



>ref|XP_009400691.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400692.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   504 bits (1299),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 233/258 (90%), Positives = 249/258 (97%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ML+KFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMG+LIDRF+EHDGPVRG+HFH
Sbjct  1    MLSKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGSLIDRFEEHDGPVRGLHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KLQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCIS LTGHNH+VM ASFHPKEDL+VSASLDQT+RVWDI ALRKK ++PADDIL 
Sbjct  121  NWQSRTCISALTGHNHFVMSASFHPKEDLLVSASLDQTIRVWDISALRKK-MAPADDILH  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            LSQMN+DFFGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMND+KAWE
Sbjct  180  LSQMNSDFFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVSCV+FH+
Sbjct  240  VDTLRGHTNNVSCVMFHA  257


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 87/187 (47%), Gaps = 10/187 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IRIW+   RT I      +      + HP+ +L  +A  D  + V+ +
Sbjct  259  MEIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHPEMNL-FAAGHDSGMIVFKL  317

Query  713  GALRKK-TVSP------ADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP  871
               R   TVS        D +LRL + +T     V  + +      ++G    S+ PT  
Sbjct  318  ERERPAFTVSGDALYYVKDRLLRLHEFSTQKDNQVVPIRRPGSINLNQGPRAMSYSPTEN  377

Query  872  LIVSGAD  892
             ++  +D
Sbjct  378  AVLICSD  384



>ref|XP_002990232.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
 gb|EFJ08647.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
Length=1213

 Score =   501 bits (1289),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 230/258 (89%), Positives = 244/258 (95%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFH K+DLVVSASLDQTVRVWDI +LRKKTVSPA+D+L 
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHVKDDLVVSASLDQTVRVWDISSLRKKTVSPAEDLLM  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGG D VVKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WR+NDTKAWE
Sbjct  181  LTQMNSDLFGGGDVVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVSCVLFH+
Sbjct  241  VDTLRGHTNNVSCVLFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHQEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHVKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDISSLRKKTVSPAEDLLMLTQMNSDLFGGGDVVVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+T+RVW
Sbjct  216  LPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHARQDIIVSNSEDKTIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DL  277


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHY-VMCASFHPKEDLVVSA  679
               IVS S+D+TIR+W+   R+ +      H+ + V+C   HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKTIRVWDLSKRSAVQTFRRDHDRFWVICG--HPEMNLLAAG  308



>ref|XP_002961902.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
 gb|EFJ37162.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
Length=1213

 Score =   500 bits (1288),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/258 (89%), Positives = 244/258 (95%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRG+HFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGIHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVLTGHNHYVMCASFH K+DLVVSASLDQTVRVWDI +LRKKTVSPA+D+L 
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHVKDDLVVSASLDQTVRVWDISSLRKKTVSPAEDLLM  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+QMN+D FGG D VVKYVLEGHDRGVNWA+FHP+LPLIVSGADDRQVK+WR+NDTKAWE
Sbjct  181  LTQMNSDLFGGGDVVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGH NNVSCVLFH+
Sbjct  241  VDTLRGHTNNVSCVLFHA  258


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (45%), Gaps = 29/182 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHQEYPWIVSASDDQTIRIWNWQSRTCVSVLTGHNHYVMCASFHVKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDISSLRKKTVSPAEDLLMLTQMNSDLFGGGDVVVKYVLEGHDRGVNWAAFHPS  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+T+RVW
Sbjct  216  LPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHARQDIIVSNSEDKTIRVW  275

Query  707  DI  712
            D+
Sbjct  276  DL  277


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHAR  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHY-VMCASFHPKEDLVVSA  679
               IVS S+D+TIR+W+   R+ +      H+ + V+C   HP+ +L+ + 
Sbjct  260  QDIIVSNSEDKTIRVWDLSKRSAVQTFRRDHDRFWVICG--HPEMNLLAAG  308



>ref|XP_003057643.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57594.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1238

 Score =   500 bits (1288),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/259 (90%), Positives = 244/259 (94%), Gaps = 1/259 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FH EYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVAFHPEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR CISVLTGHNHYVM A FHPKEDLVVSASLDQTVRVWDIG LRKK+V+P DD++R
Sbjct  121  NWQSRNCISVLTGHNHYVMSAMFHPKEDLVVSASLDQTVRVWDIGGLRKKSVAPGDDLMR  180

Query  761  LSQ-MNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            L Q +N + FGG DAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMNDTKAW
Sbjct  181  LPQAVNNELFGGGDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAW  240

Query  938  EVDTLRGHMNNVSCVLFHS  994
            EVDTLRGH+NNVSCV+FH+
Sbjct  241  EVDTLRGHVNNVSCVMFHA  259


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 85/183 (46%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ ++FH + PWI+++     I++W+++    I     H+  V    FH  + L VS   
Sbjct  96   IRTVAFHPEYPWIVSASDDQTIRIWNWQSRNCISVLTGHNHYVMSAMFHPKEDLVVSASL  155

Query  434  DYKIKVWN---------------YKLHRCL-------------FTLLGHLDYIRTVQFHH  529
            D  ++VW+                +L + +             + L GH   +    FH 
Sbjct  156  DQTVRVWDIGGLRKKSVAPGDDLMRLPQAVNNELFGGGDAVVKYVLEGHDRGVNWASFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+++RV
Sbjct  216  SLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSEDKSIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDM  278


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  201  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      S HP+ +L+ + 
Sbjct  261  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSAHPEVNLLAAG  309



>ref|XP_011398207.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
 gb|KFM25315.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
Length=1032

 Score =   493 bits (1268),  Expect = 2e-162, Method: Composition-based stats.
 Identities = 218/264 (83%), Positives = 241/264 (91%), Gaps = 6/264 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEH+GPVRG+HFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHEGPVRGIHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQT+R+W
Sbjct  61   PTQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTLRLW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK------TVSP  742
            NWQSRTCI+VLTGHNHYVMCA FHP++DLV SASLDQTVRVWD+ ALRKK         P
Sbjct  121  NWQSRTCIAVLTGHNHYVMCAQFHPRDDLVASASLDQTVRVWDVSALRKKGAAPGGAGPP  180

Query  743  ADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            +DD +RL  +N+D FGG DAVVKYVLEGHDRGVNWA+FHPTLPL+VSGADDRQ+K+WRMN
Sbjct  181  SDDSMRLPPINSDLFGGSDAVVKYVLEGHDRGVNWAAFHPTLPLVVSGADDRQIKLWRMN  240

Query  923  DTKAWEVDTLRGHMNNVSCVLFHS  994
            ++KAWEVDTLRGH+NNVS V+FH+
Sbjct  241  ESKAWEVDTLRGHVNNVSSVIFHA  264


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 47/188 (25%), Positives = 79/188 (42%), Gaps = 35/188 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     ++LW+++  T I     H+  V    FH    L  S   
Sbjct  96   IRTVQFHHESPWIVSASDDQTLRLWNWQSRTCIAVLTGHNHYVMCAQFHPRDDLVASASL  155

Query  434  DYKIKVWNYKLHR---------------------------------CLFTLLGHLDYIRT  514
            D  ++VW+    R                                   + L GH   +  
Sbjct  156  DQTVRVWDVSALRKKGAAPGGAGPPSDDSMRLPPINSDLFGGSDAVVKYVLEGHDRGVNW  215

Query  515  VQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLD  688
              FH   P +VS +DD+ I++W         +  L GH + V    FH K+DL++S S D
Sbjct  216  AAFHPTLPLVVSGADDRQIKLWRMNESKAWEVDTLRGHVNNVSSVIFHAKQDLIISDSED  275

Query  689  QTVRVWDI  712
            +++RVWD+
Sbjct  276  KSLRVWDL  283


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 2/106 (2%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +   
Sbjct  209  HDRGVNWAAFHPTLPLVVSGADDRQIKLWRMNESKAWEVDTLRGHVNNVSSVIFHAKQDL  268

Query  542  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            I+S S+D+++R+W+   R  +      +      + HP  +L+ + 
Sbjct  269  IISDSEDKSLRVWDLSKRVGVQTFRREHDRFWILAGHPSINLLAAG  314



>gb|KCW64034.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
 gb|KCW64035.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
Length=234

 Score =   459 bits (1181),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 220/234 (94%), Positives = 224/234 (96%), Gaps = 0/234 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI AL+ KT SP DD+LR
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDISALKNKTASPGDDLLR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            L QMNTD FGGVD VVKYVLEGHDRGVNWASFHP LPLIVSGADDRQVK+WRMN
Sbjct  181  LGQMNTDLFGGVDVVVKYVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMN  234



>ref|XP_008383465.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1021

 Score =   486 bits (1250),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 227/234 (97%), Positives = 229/234 (98%), Gaps = 0/234 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCA FHPKEDLVVSASLDQTVRVWDIGALRKKTV+PADDILR
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALRKKTVAPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            LSQMN DFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN
Sbjct  181  LSQMNADFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMN  234



>gb|ACN31006.1| unknown [Zea mays]
Length=251

 Score =   458 bits (1179),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 227/235 (97%), Gaps = 0/235 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  235



>ref|XP_003567287.2| PREDICTED: coatomer subunit alpha-1-like [Brachypodium distachyon]
Length=277

 Score =   456 bits (1174),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 212/234 (91%), Positives = 229/234 (98%), Gaps = 0/234 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKG++FH +RPWILASLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGVAFHPRRPWILASLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYV+CASFHPKEDLVVSASLDQTVRVWDIGALRKK+VSPADDI+R
Sbjct  121  NWQSRTCVAVLTGHNHYVICASFHPKEDLVVSASLDQTVRVWDIGALRKKSVSPADDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRMN
Sbjct  181  LTQMNTDMFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMN  234



>ref|XP_007508098.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20589.1| predicted protein [Bathycoccus prasinos]
Length=1253

 Score =   487 bits (1254),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 242/264 (92%), Gaps = 6/264 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   TNQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHVEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVS------P  742
            NWQSR CISVLTGHNHYVMCASFH K+DLVVSASLDQTVRVWDI ALRKK  S      P
Sbjct  121  NWQSRNCISVLTGHNHYVMCASFHLKDDLVVSASLDQTVRVWDIVALRKKVASPGGPQRP  180

Query  743  ADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            ++  L++ QMN D FGG DAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVK+WRMN
Sbjct  181  SELDLKIPQMNADLFGGGDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMN  240

Query  923  DTKAWEVDTLRGHMNNVSCVLFHS  994
            DTKAWEVDTLRGH+NNVSCV+FH+
Sbjct  241  DTKAWEVDTLRGHVNNVSCVMFHA  264


 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 80/188 (43%), Gaps = 35/188 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++    I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHVEHPWIVSASDDQTIRIWNWQSRNCISVLTGHNHYVMCASFHLKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------------CLFTLLGHLDYIRT  514
            D  ++VW+    R                                   + L GH   +  
Sbjct  156  DQTVRVWDIVALRKKVASPGGPQRPSELDLKIPQMNADLFGGGDAVVKYVLEGHDRGVNW  215

Query  515  VQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLD  688
              FH   P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D
Sbjct  216  ASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDIIVSNSED  275

Query  689  QTVRVWDI  712
            +++RVWD+
Sbjct  276  KSIRVWDM  283


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  206  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  265

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   R+        N      S HP  +L+ + 
Sbjct  266  QDIIVSNSEDKSIRVWDMSKRSGAQTFRRENDRFWILSAHPNLNLLAAG  314



>ref|XP_001417203.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95496.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1222

 Score =   486 bits (1251),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/258 (87%), Positives = 241/258 (93%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVW+YKL RC+FTLLGHLDYIRTV+FH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWSYKLRRCMFTLLGHLDYIRTVEFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+ I+VLTGHNHYVMCA FH K+DLVVSASLDQTVRVWDI  LR+K VSPAD+ LR
Sbjct  121  NWQSRSSIAVLTGHNHYVMCARFHHKDDLVVSASLDQTVRVWDISGLRRKAVSPADE-LR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            + QMN D FGG D VVKY+LEGHDRGVNWA+FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  180  MPQMNNDLFGGGDTVVKYILEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VD+LRGH+NNVSCV FH+
Sbjct  240  VDSLRGHVNNVSCVAFHA  257


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 85/181 (47%), Gaps = 28/181 (15%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH    L VS   
Sbjct  96   IRTVEFHQEYPWIVSASDDQTIRIWNWQSRSSIAVLTGHNHYVMCARFHHKDDLVVSASL  155

Query  434  DYKIKVWNY-----------------KLHRCLF---------TLLGHLDYIRTVQFHHEY  535
            D  ++VW+                  +++  LF          L GH   +    FH   
Sbjct  156  DQTVRVWDISGLRRKAVSPADELRMPQMNNDLFGGGDTVVKYILEGHDRGVNWAAFHPTL  215

Query  536  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            P IVS +DD+ +++W         +  L GH + V C +FH ++D++VS S D+++RVWD
Sbjct  216  PLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHARQDVIVSNSEDKSIRVWD  275

Query  710  I  712
            +
Sbjct  276  M  276


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + +L GH++ +  V FH  
Sbjct  199  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHAR  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   R         N      + HP+ +L+ + 
Sbjct  259  QDVIVSNSEDKSIRVWDMSKRADAQTFRRENDRFWILAAHPEVNLLAAG  307



>tpg|DAA52914.1| TPA: hypothetical protein ZEAMMB73_412502 [Zea mays]
Length=258

 Score =   455 bits (1171),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 213/234 (91%), Positives = 226/234 (97%), Gaps = 0/234 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  234



>gb|KDD75879.1| hypothetical protein H632_c457p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=313

 Score =   456 bits (1174),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 234/263 (89%), Gaps = 5/263 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWIL SLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILTSLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV-----SPA  745
            NWQSR+CI+VLTGHNHYVMCA FHP+EDL+ SASLDQTVRVWD+  L K++        A
Sbjct  121  NWQSRSCIAVLTGHNHYVMCAQFHPREDLIASASLDQTVRVWDMSGLHKRSSVGGAPGAA  180

Query  746  DDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
            ++ LR   ++ D FGG DAV+KYVLEGHDRGVNW SFHP+LPL+VSGADDR VK+WRMND
Sbjct  181  EEGLRFPPVSADLFGGGDAVIKYVLEGHDRGVNWVSFHPSLPLLVSGADDRTVKLWRMND  240

Query  926  TKAWEVDTLRGHMNNVSCVLFHS  994
            +KAWEVDTLRGH+NNVSC LFH+
Sbjct  241  SKAWEVDTLRGHVNNVSCALFHA  263


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 86/187 (46%), Gaps = 34/187 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH  + L  S   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRVWNWQSRSCIAVLTGHNHYVMCAQFHPREDLIASASL  155

Query  434  DYKIKVWNYK-LHR-------------------------------CLFTLLGHLDYIRTV  517
            D  ++VW+   LH+                                 + L GH   +  V
Sbjct  156  DQTVRVWDMSGLHKRSSVGGAPGAAEEGLRFPPVSADLFGGGDAVIKYVLEGHDRGVNWV  215

Query  518  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQ  691
             FH   P +VS +DD+T+++W         +  L GH + V CA FH ++DLVVS S D+
Sbjct  216  SFHPSLPLLVSGADDRTVKLWRMNDSKAWEVDTLRGHVNNVSCALFHARQDLVVSDSEDK  275

Query  692  TVRVWDI  712
            ++RVWD+
Sbjct  276  SLRVWDL  282


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V  V FH S PL VSG DD  +K+W     +   + TL GH++ +    FH  
Sbjct  205  LEGHDRGVNWVSFHPSLPLLVSGADDRTVKLWRMNDSKAWEVDTLRGHVNNVSCALFHAR  264

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               +VS S+D+++R+W+   R  +      +      + HP  +L+ + 
Sbjct  265  QDLVVSDSEDKSLRVWDLSKRIGLQTFRREHDRFWILAAHPSINLLAAG  313



>ref|XP_002878551.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54810.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
Length=1151

 Score =   481 bits (1239),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 220/258 (85%), Positives = 241/258 (93%), Gaps = 0/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKF+TKSNRVKGLSFH KRPWILASLHSGVIQLWDYR+GTLID+FD H GPVRGVHFH
Sbjct  1    MLTKFKTKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRVGTLIDKFDGHQGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDD KIKVWNYK H CLFTLLGHLDYIRTVQFHHEYPWI+SASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDCKIKVWNYKTHWCLFTLLGHLDYIRTVQFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+SVL  HNHYVMCASFHPK+DLVVSASLDQTVRVW+IGAL+KKTVSP+DDI+R
Sbjct  121  NWQSRTCVSVLAAHNHYVMCASFHPKDDLVVSASLDQTVRVWEIGALKKKTVSPSDDIMR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            L+++N+D F  VD  VKYVLEGH+RGV WA+FHP LPLIVSG+DDRQVK+WRMN+TKAWE
Sbjct  181  LAEINSDLFDSVDVTVKYVLEGHERGVIWAAFHPNLPLIVSGSDDRQVKLWRMNETKAWE  240

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVS V+FH+
Sbjct  241  VDTLRGHMNNVSSVMFHA  258


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 80/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL++     I++W+++  T +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSASDDQTIRIWNWQSRTCVSVLAAHNHYVMCASFHPKDDLVVSASL  155

Query  434  DYKIKVWNY------------------KLHRCLF---------TLLGHLDYIRTVQFHHE  532
            D  ++VW                    +++  LF          L GH   +    FH  
Sbjct  156  DQTVRVWEIGALKKKTVSPSDDIMRLAEINSDLFDSVDVTVKYVLEGHERGVIWAAFHPN  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS SDD+ +++W         +  L GH + V    FH K+D++VS S D ++RVW
Sbjct  216  LPLIVSGSDDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDNSIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 78/170 (46%), Gaps = 17/170 (10%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHD-----  373
            M   F  K + V   S   + R W + +L    +   D   R+  +  D FD  D     
Sbjct  139  MCASFHPKDDLVVSASLDQTVRVWEIGALKKKTVSPSDDIMRLAEINSDLFDSVDVTVKY  198

Query  374  ---GPVRGV---HFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
               G  RGV    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  199  VLEGHERGVIWAAFHPNLPLIVSGSDDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHA  258

Query  530  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +   IVS S+D +IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  259  KQDIIVSNSEDNSIRVWDATKRTEIQTFRREHDRFWSLAVHPEINLLAAG  308



>ref|XP_002501894.1| coatomer protein complex [Micromonas sp. RCC299]
 gb|ACO63152.1| coatomer protein complex [Micromonas sp. RCC299]
Length=1236

 Score =   483 bits (1242),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/263 (86%), Positives = 237/263 (90%), Gaps = 5/263 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVSFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYKL RCL+TLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLRRCLYTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDI--  754
            NWQSR+CISVLTGHNHYVMCASFH KEDLVVSASLDQTVRVWDIG LRKK+V+P  +   
Sbjct  121  NWQSRSCISVLTGHNHYVMCASFHVKEDLVVSASLDQTVRVWDIGGLRKKSVAPGGEDPF  180

Query  755  ---LRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
               +       D FGG DAVVKYVLEGHDRGVNWA FHP+LPLIVSGADDRQVK+WRMND
Sbjct  181  SRHMPKEMRGDDLFGGGDAVVKYVLEGHDRGVNWAGFHPSLPLIVSGADDRQVKLWRMND  240

Query  926  TKAWEVDTLRGHMNNVSCVLFHS  994
            TKAWEVDTLRGH+NNVSC +FH+
Sbjct  241  TKAWEVDTLRGHVNNVSCCMFHA  263


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 82/187 (44%), Gaps = 34/187 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHQEYPWIVSASDDQTIRIWNWQSRSCISVLTGHNHYVMCASFHVKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------------CLFTLLGHLDYIRTV  517
            D  ++VW+    R                                  + L GH   +   
Sbjct  156  DQTVRVWDIGGLRKKSVAPGGEDPFSRHMPKEMRGDDLFGGGDAVVKYVLEGHDRGVNWA  215

Query  518  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQ  691
             FH   P IVS +DD+ +++W         +  L GH + V C  FH ++D++VS S D+
Sbjct  216  GFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCCMFHARQDIIVSNSEDK  275

Query  692  TVRVWDI  712
            ++RVWD+
Sbjct  276  SIRVWDM  282


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +    FH  
Sbjct  205  LEGHDRGVNWAGFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCCMFHAR  264

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT +      +      + HP+ +L+ + 
Sbjct  265  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAAHPEVNLLAAG  313



>emb|CDY13820.1| BnaA09g43220D [Brassica napus]
Length=486

 Score =   459 bits (1182),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/261 (83%), Positives = 235/261 (90%), Gaps = 6/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EHDGPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMATLIDTFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+SVL GHNHYVMCASFHPKEDL+VSASLDQTVRVWDI  LR K  +P    DD
Sbjct  121  NWQSRTCVSVLAGHNHYVMCASFHPKEDLLVSASLDQTVRVWDIAPLRNKKKTPLADDDD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            I+ L+QMN+D F   DA VKYVLEGHDRGVNWA+FHPTLPLIVSGADDR+VK+WR N+TK
Sbjct  181  IMGLTQMNSDLF---DATVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETK  237

Query  932  AWEVDTLRGHMNNVSCVLFHS  994
            AWEVDTLRGH +NVS V+FH+
Sbjct  238  AWEVDTLRGHSSNVSSVMFHA  258


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 79/181 (44%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHECPWIVSASDDQTIRIWNWQSRTCVSVLAGHNHYVMCASFHPKEDLLVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIAPLRNKKKTPLADDDDIMGLTQMNSDLFDATVKYVLEGHDRGVNWAAFHPT  215

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH+  V    FH K D++VS S D+T+RVW
Sbjct  216  LPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAKHDVIVSNSEDKTIRVW  275

Query  707  D  709
            D
Sbjct  276  D  276


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 70/148 (47%), Gaps = 13/148 (9%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA-SLDQTVRVWD  709
            +  IVS S+D+TIR+W+   RT I      N      + HP+ +L+ +    D+ +R   
Sbjct  260  HDVIVSNSEDKTIRVWDATKRTEIKTFRRENDRFWILAAHPETNLLAAGHDSDEELR---  316

Query  710  IGALRKKTVSPADDILRLSQMNTDFFGG  793
               L  K  +P      L  M  D F G
Sbjct  317  -EVLGIKNFAP------LKSMLLDLFSG  337



>emb|CEF97511.1| Coatomer, alpha subunit, C-terminal [Ostreococcus tauri]
Length=1222

 Score =   476 bits (1226),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/258 (86%), Positives = 236/258 (91%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVGFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTV+FH EYPWIVSASDDQTIRIW
Sbjct  61   ASQPLFVSGGDDYKIKVWSYKLRRCLFTLLGHLDYIRTVEFHAEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+ I VLTGHNHYVMCA FH K+DLVVSASLDQTVRVWDI  LR+K VSP D+ LR
Sbjct  121  NWQSRSSIGVLTGHNHYVMCARFHHKDDLVVSASLDQTVRVWDISGLRRKAVSPQDE-LR  179

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
            + QMN D FGG D  VKY+LEGHDRGVNW +FHPTLPLIVSGADDRQVK+WRMNDTKAWE
Sbjct  180  MPQMNNDLFGGGDTCVKYILEGHDRGVNWVAFHPTLPLIVSGADDRQVKLWRMNDTKAWE  239

Query  941  VDTLRGHMNNVSCVLFHS  994
            VD+LRGH+NNVSCV FH+
Sbjct  240  VDSLRGHVNNVSCVAFHA  257


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 86/181 (48%), Gaps = 28/181 (15%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  + I     H+  V    FH    L VS   
Sbjct  96   IRTVEFHAEYPWIVSASDDQTIRIWNWQSRSSIGVLTGHNHYVMCARFHHKDDLVVSASL  155

Query  434  DYKIKVWNYKLHR-------------------------CL-FTLLGHLDYIRTVQFHHEY  535
            D  ++VW+    R                         C+ + L GH   +  V FH   
Sbjct  156  DQTVRVWDISGLRRKAVSPQDELRMPQMNNDLFGGGDTCVKYILEGHDRGVNWVAFHPTL  215

Query  536  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            P IVS +DD+ +++W         +  L GH + V C +FH ++D++VS S D+++RVWD
Sbjct  216  PLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHARQDVIVSNSEDKSIRVWD  275

Query  710  I  712
            +
Sbjct  276  M  276


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V  V FH + PL VSG DD ++K+W     +   + +L GH++ +  V FH  
Sbjct  199  LEGHDRGVNWVAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHAR  258

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   R         +      + HP+ +L+ + 
Sbjct  259  QDVIVSNSEDKSIRVWDMSKRADAQTFRREHDRFWILATHPEVNLLAAG  307



>ref|XP_003523472.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006578995.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Glycine 
max]
Length=1206

 Score =   474 bits (1221),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 221/258 (86%), Positives = 236/258 (91%), Gaps = 10/258 (4%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTL+DRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHKKRPWILASLHSGVIQLWDYRMGTLVDRFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIK+WNYKLHRCLF+LLGHLDY+RTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   DSQPLFVSGGDDYKIKLWNYKLHRCLFSLLGHLDYVRTVQFHHESPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCISVLTGHNHYVMCASFHP++DL+VSASLDQT+RVWDI  LRKK  SP+ D + 
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHPRDDLLVSASLDQTLRVWDISPLRKK--SPSSDDMP  178

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE  940
                    FG  DAVVKYVLEGHDRGVNWASFHP LPLIVS ADDRQ+K+WRMNDTKAWE
Sbjct  179  --------FGSPDAVVKYVLEGHDRGVNWASFHPALPLIVSAADDRQLKLWRMNDTKAWE  230

Query  941  VDTLRGHMNNVSCVLFHS  994
            VDTLRGHMNNVSCVLFH+
Sbjct  231  VDTLRGHMNNVSCVLFHA  248


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 81/171 (47%), Gaps = 19/171 (11%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            V+ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   VRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPRDDLLVSASL  155

Query  434  DYKIKVWNYKLHR-----------------CLFTLLGHLDYIRTVQFHHEYPWIVSASDD  562
            D  ++VW+    R                   + L GH   +    FH   P IVSA+DD
Sbjct  156  DQTLRVWDISPLRKKSPSSDDMPFGSPDAVVKYVLEGHDRGVNWASFHPALPLIVSAADD  215

Query  563  QTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD  709
            + +++W         +  L GH + V C  FH K+D++VS S D+++RVWD
Sbjct  216  RQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVWD  266


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  190  LEGHDRGVNWASFHPALPLIVSAADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  249

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  250  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHPEMNLLAAG  298



>gb|EWM26143.1| Coatomer, WD associated region [Nannochloropsis gaditana]
Length=1272

 Score =   476 bits (1224),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/262 (84%), Positives = 238/262 (91%), Gaps = 5/262 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGLSFH  RPWI+ SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPVRPWIITSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPL VSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIR+W
Sbjct  61   KTQPLIVSGGDDYKVKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA----D  748
            NWQSRTCISVLTGHNHYVMCA+FHPKEDL+VSASLDQTVRVWD   LRKKTV  A    D
Sbjct  121  NWQSRTCISVLTGHNHYVMCAAFHPKEDLIVSASLDQTVRVWDTTGLRKKTVRGAPGAVD  180

Query  749  DILRL-SQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
            D   + S++N D FGG D VVKYVLEGHDRGVNWASFHPTLPL++SGADDRQVK+WRMND
Sbjct  181  DAANMVSRVNNDLFGGGDVVVKYVLEGHDRGVNWASFHPTLPLVISGADDRQVKLWRMND  240

Query  926  TKAWEVDTLRGHMNNVSCVLFH  991
            TKAWEVDTLRGH NNVSCV+FH
Sbjct  241  TKAWEVDTLRGHTNNVSCVIFH  262


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 86/187 (46%), Gaps = 34/187 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHNEYPWIVSASDDQTIRVWNWQSRTCISVLTGHNHYVMCAAFHPKEDLIVSASL  155

Query  434  DYKIKVWNY-----------------------KLHRCLF---------TLLGHLDYIRTV  517
            D  ++VW+                        +++  LF          L GH   +   
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPGAVDDAANMVSRVNNDLFGGGDVVVKYVLEGHDRGVNWA  215

Query  518  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQ  691
             FH   P ++S +DD+ +++W         +  L GH + V C  FHPK +L+VS S D+
Sbjct  216  SFHPTLPLVISGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVIFHPKFELIVSNSEDR  275

Query  692  TVRVWDI  712
            ++RVWDI
Sbjct  276  SIRVWDI  282


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL +SG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  205  LEGHDRGVNWASFHPTLPLVISGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVIFHPK  264

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  IVS S+D++IR+W+   R  +      +      + HP+++L+ + 
Sbjct  265  FELIVSNSEDRSIRVWDISKRLGVQTFRRESDRFWILAAHPEQNLLAAG  313



>emb|CBN77093.1| Vesicle coat complex COPI, alpha subunit [Ectocarpus siliculosus]
Length=1258

 Score =   473 bits (1217),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 216/261 (83%), Positives = 238/261 (91%), Gaps = 4/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGLSFH  RPWIL SLH+G+IQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPIRPWILTSLHNGIIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPL VSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWI+SASDDQTIRIW
Sbjct  61   KTQPLIVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIISASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTCI+VLTGHNHYVMCA+FHPK+DLVVSASLDQTVRVWD   LRKKTV  A   ++
Sbjct  121  NWQSRTCIAVLTGHNHYVMCAAFHPKDDLVVSASLDQTVRVWDTTGLRKKTVRGAPSAMQ  180

Query  761  ----LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDT  928
                +S+MN+D FGG DAVVKYVLEGHDRGVNWASFHPTLPL++SGADDRQVK+WRMN+T
Sbjct  181  HDDMVSKMNSDLFGGTDAVVKYVLEGHDRGVNWASFHPTLPLVISGADDRQVKLWRMNET  240

Query  929  KAWEVDTLRGHMNNVSCVLFH  991
            KAWEV T+ GH NNVSCV+FH
Sbjct  241  KAWEVHTMTGHTNNVSCVIFH  261


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 33/186 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH++ PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHNEYPWIISASDDQTIRIWNWQSRTCIAVLTGHNHYVMCAAFHPKDDLVVSASL  155

Query  434  DYKIKVWNY----------------------KLHRCLF---------TLLGHLDYIRTVQ  520
            D  ++VW+                       K++  LF          L GH   +    
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSAMQHDDMVSKMNSDLFGGTDAVVKYVLEGHDRGVNWAS  215

Query  521  FHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQT  694
            FH   P ++S +DD+ +++W         +  +TGH + V C  FHPK +L+VS S D++
Sbjct  216  FHPTLPLVISGADDRQVKLWRMNETKAWEVHTMTGHTNNVSCVIFHPKRELIVSNSEDRS  275

Query  695  VRVWDI  712
            +RVWDI
Sbjct  276  IRVWDI  281


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL +SG DD ++K+W     +   + T+ GH + +  V FH +
Sbjct  204  LEGHDRGVNWASFHPTLPLVISGADDRQVKLWRMNETKAWEVHTMTGHTNNVSCVIFHPK  263

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   R  +      N      + HP+++L+ + 
Sbjct  264  RELIVSNSEDRSIRVWDISQRMGVQTFRRENDRFWILAAHPEQNLLAAG  312



>emb|CDQ86226.1| unnamed protein product [Oncorhynchus mykiss]
Length=512

 Score =   451 bits (1159),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 229/258 (89%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHH+YPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHDYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP+     
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPSAVETE  180

Query  761  LSQMN-TDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            +  ++  D FG  DAVVK+VLEGHDRGVNWA+FHP++PLIVSGADDRQVKIWRMN++KAW
Sbjct  181  VRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAW  240

Query  938  EVDTLRGHMNNVSCVLFH  991
            E+DT RGH NNVSC +FH
Sbjct  241  ELDTCRGHYNNVSCAVFH  258


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 84/183 (46%), Gaps = 38/183 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH   PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHDYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPSAVETEVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DIG  715
            D+ 
Sbjct  277  DMS  279


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005851353.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
 gb|EFN59251.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
Length=726

 Score =   457 bits (1176),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 220/263 (84%), Positives = 230/263 (87%), Gaps = 13/263 (5%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP----AD  748
            NWQSR CI+VLTGHNHYVMCA FHPKEDLV SASLDQTVRVWDI ALRKKTV+P     D
Sbjct  121  NWQSRNCIAVLTGHNHYVMCAQFHPKEDLVASASLDQTVRVWDIAALRKKTVAPGAGGGD  180

Query  749  DILRL--SQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            D+      +MNTD FGG DA+VKYVLEGHDRGVNWASFHP+LPLIV        +  R  
Sbjct  181  DMRGPGGGRMNTDLFGGGDAIVKYVLEGHDRGVNWASFHPSLPLIVK-------RRGRPP  233

Query  923  DTKAWEVDTLRGHMNNVSCVLFH  991
            DTKAWEVDTLRGH+NNVSCV+FH
Sbjct  234  DTKAWEVDTLRGHVNNVSCVIFH  256



>dbj|BAE02266.1| unnamed protein product [Macaca fascicularis]
Length=672

 Score =   454 bits (1169),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 85/183 (46%), Gaps = 38/183 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DIG  715
            D+ 
Sbjct  277  DMS  279


 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004333061.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR11048.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
Length=1217

 Score =   469 bits (1206),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 218/260 (84%), Positives = 235/260 (90%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTK ETKSNRVKGLSFH KRPWILASLH+G+IQLWDYR+ TL+DRFDEHDGPVRG+ FH
Sbjct  1    MLTKLETKSNRVKGLSFHPKRPWILASLHNGLIQLWDYRIRTLLDRFDEHDGPVRGISFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGH+DYIRTVQFHHEYPWI+SASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHMDYIRTVQFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTCI+VLTGHNHYVM A FHPKEDLVVSASLDQTVR+WDI  L+KK VSP    DD
Sbjct  121  NWQSRTCIAVLTGHNHYVMSAYFHPKEDLVVSASLDQTVRIWDISGLKKKNVSPTGGLDD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
             LRL+Q   D FG  + VVKYVLEGHDRGVNWA+FHP+LPLIVSGADDR VK+WRMNDTK
Sbjct  181  PLRLAQ--NDLFGNPNVVVKYVLEGHDRGVNWAAFHPSLPLIVSGADDRSVKLWRMNDTK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDTLRGH NNVSCV+FH
Sbjct  239  AWEVDTLRGHYNNVSCVIFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (46%), Gaps = 30/183 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL++     I++W+++  T I     H+  V   +FH  + L VS   
Sbjct  96   IRTVQFHHEYPWILSASDDQTIRIWNWQSRTCIAVLTGHNHYVMSAYFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------CLFTLLGHLDYIRTVQFHH  529
            D  +++W+    +                              + L GH   +    FH 
Sbjct  156  DQTVRIWDISGLKKKNVSPTGGLDDPLRLAQNDLFGNPNVVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRV  703
              P IVS +DD+++++W         +  L GH + V C  FHP ++L++S S D+T+RV
Sbjct  216  SLPLIVSGADDRSVKLWRMNDTKAWEVDTLRGHYNNVSCVIFHPHQELILSNSEDKTIRV  275

Query  704  WDI  712
            WD+
Sbjct  276  WDM  278


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/214 (25%), Positives = 93/214 (43%), Gaps = 10/214 (5%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD  +K+W     +   + TL GH + +  V FH  
Sbjct  201  LEGHDRGVNWAAFHPSLPLIVSGADDRSVKLWRMNDTKAWEVDTLRGHYNNVSCVIFHPH  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               I+S S+D+TIR+W+   R+ +      +      + HP+ +L  +A  D  + V+ +
Sbjct  261  QELILSNSEDKTIRVWDMSKRSAVQTFRREHDRFWIIAAHPENNL-FAAGHDSGLIVFKL  319

Query  713  GALRKKTVSPADDILRLSQ---MNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLP--LI  877
               R   V+    +  + +      DF    D  V  +     +     S++P     L+
Sbjct  320  ERERPAYVAHKGALFYVKERYLRTYDFASARDVPVMSIRRAVAKSPRSLSYNPAEKAVLL  379

Query  878  VSGADDRQVKIWRM--NDTKAWEVDTLRGHMNNV  973
             S AD    + +++  +   A  V++ +G  N+ 
Sbjct  380  YSDADGGTYEFYKLPADGRSADSVESKKGAANSA  413



>ref|XP_002896974.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
 gb|EEY66455.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
Length=1243

 Score =   466 bits (1199),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPSSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPSSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>ref|XP_002455000.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
 gb|EES00120.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
Length=1122

 Score =   462 bits (1190),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 211/234 (90%), Positives = 224/234 (96%), Gaps = 0/234 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RP I +SLHSGVIQ+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPRIRSSLHSGVIQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC++VLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKK+ SPADDILR
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDILR  180

Query  761  LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMN  922
            L+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHP+LPLIVSGADDRQVKIWRMN
Sbjct  181  LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQVKIWRMN  234



>gb|ETL92039.1| hypothetical protein L917_09539 [Phytophthora parasitica]
 gb|ETO74204.1| hypothetical protein F444_10006 [Phytophthora parasitica P1976]
Length=1243

 Score =   465 bits (1197),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>gb|ETK85490.1| hypothetical protein L915_09709 [Phytophthora parasitica]
 gb|ETP43418.1| hypothetical protein F442_09816 [Phytophthora parasitica P10297]
Length=1243

 Score =   465 bits (1197),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>gb|ETI45564.1| hypothetical protein F443_09913 [Phytophthora parasitica P1569]
 gb|ETL38915.1| hypothetical protein L916_09614 [Phytophthora parasitica]
Length=1243

 Score =   465 bits (1197),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>gb|ETP15371.1| hypothetical protein F441_09860 [Phytophthora parasitica CJ01A1]
Length=1243

 Score =   465 bits (1196),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>ref|XP_008892963.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
 gb|ETN21137.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
Length=1243

 Score =   465 bits (1196),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKTV    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRYELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            Y  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  YELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>ref|XP_008862869.1| hypothetical protein H310_01524 [Aphanomyces invadans]
 gb|ETW09064.1| hypothetical protein H310_01524 [Aphanomyces invadans]
Length=1240

 Score =   464 bits (1195),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 216/267 (81%), Positives = 230/267 (86%), Gaps = 10/267 (4%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L SLH+GVIQLWD+RMGTLIDRFDEHDGPVR V FH
Sbjct  1    MLTKFESKSNRVKGLCFHPSRPWVLTSLHNGVIQLWDFRMGTLIDRFDEHDGPVRSVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWIVS SDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+C+SVLTGHNHYVM   FHPKEDL+VSASLDQTVRVWD   LRKKTV  A   L 
Sbjct  121  NWQSRSCVSVLTGHNHYVMSCQFHPKEDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSLE  180

Query  761  ----------LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKI  910
                      L +  TD FG  DAVVKYVLEGHDRGVNWASFHPTLPLIVSG+DDRQVK+
Sbjct  181  DSIPVPSPHGLGRSGTDIFGATDAVVKYVLEGHDRGVNWASFHPTLPLIVSGSDDRQVKL  240

Query  911  WRMNDTKAWEVDTLRGHMNNVSCVLFH  991
            WRMNDTKAWEVDT+RGH NNVSCV+FH
Sbjct  241  WRMNDTKAWEVDTMRGHTNNVSCVIFH  267


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 82/193 (42%), Gaps = 39/193 (20%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI++      I++W+++  + +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSCSDDQTIRIWNWQSRSCVSVLTGHNHYVMSCQFHPKEDLIVSASL  155

Query  434  DYKIKVWNYKLHR-------------------------------------CLFTLLGHLD  502
            D  ++VW+    R                                       + L GH  
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSLEDSIPVPSPHGLGRSGTDIFGATDAVVKYVLEGHDR  215

Query  503  YIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVS  676
             +    FH   P IVS SDD+ +++W         +  + GH + V C  FHP+++L++S
Sbjct  216  GVNWASFHPTLPLIVSGSDDRQVKLWRMNDTKAWEVDTMRGHTNNVSCVIFHPRQELIIS  275

Query  677  ASLDQTVRVWDIG  715
             S D+++RVWDI 
Sbjct  276  NSEDRSIRVWDIA  288


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + +  V FH  
Sbjct  210  LEGHDRGVNWASFHPTLPLIVSGSDDRQVKLWRMNDTKAWEVDTMRGHTNNVSCVIFHPR  269

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   R  +      N        HP ++L+ + 
Sbjct  270  QELIISNSEDRSIRVWDIAKRMGLQTFRRENDRFWMLQAHPTQNLLAAG  318



>gb|ETM45336.1| hypothetical protein L914_09580 [Phytophthora parasitica]
Length=1243

 Score =   464 bits (1194),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 213/264 (81%), Positives = 235/264 (89%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV----SPAD  748
            NWQSR+C+S+LTGHNHYVMCA FHPK+DL+VSASLDQTVRVWD   LRKKT+    S  D
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASLDQTVRVWDTTGLRKKTMRGAPSSMD  180

Query  749  DIL---RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
            D++        N D FG  DA+VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVK+WRM
Sbjct  181  DMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            N+TKAWEVDT+RGH NN+SCVLFH
Sbjct  241  NETKAWEVDTMRGHTNNISCVLFH  264


 Score = 79.3 bits (194),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 36/189 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTIRIWNWQSRSCVSILTGHNHYVMCAQFHPKDDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTMRGAPSSMDDMVGPPTSRSNNHDIFGASDAIVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS +DD+ +++W         +  + GH + + C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRHELIISNSE  275

Query  686  DQTVRVWDI  712
            D+++RVWDI
Sbjct  276  DRSIRVWDI  284


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP ++L+ + 
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHPTQNLLAAG  315



>ref|XP_009117406.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-2 [Brassica 
rapa]
Length=1062

 Score =   460 bits (1183),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 234/261 (90%), Gaps = 6/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EH+GPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMTTLIDTFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+SVL GHNHYVMCASFHPKEDL+VSASLDQTVRVWDI  LR K  +P    DD
Sbjct  121  NWQSRTCVSVLAGHNHYVMCASFHPKEDLLVSASLDQTVRVWDIAPLRNKKKTPLADDDD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            I+  +QMN+D F   DA VKYVLEGHDRGVNWA+FHPTLPLIVSGADDR+VK+WR N+TK
Sbjct  181  IMGFTQMNSDLF---DATVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETK  237

Query  932  AWEVDTLRGHMNNVSCVLFHS  994
            AWEVDTLRGH +NVS V+FH+
Sbjct  238  AWEVDTLRGHSSNVSSVMFHA  258


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 3/135 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
            +  IVS S+D+TIR+W+   RT I      N      + HP+ +L ++A  D  + V+ +
Sbjct  260  HDVIVSNSEDKTIRVWDATKRTEIKTFRRENDRFWILAAHPETNL-LAAGHDSGLIVFKL  318

Query  713  GALRKKTVSPADDIL  757
               R       D +L
Sbjct  319  ERERPAFALSGDSLL  333



>ref|XP_008610604.1| coatomer protein complex, subunit alpha (xenin) [Saprolegnia 
diclina VS20]
 gb|EQC35842.1| coatomer protein complex, subunit alpha (xenin) [Saprolegnia 
diclina VS20]
Length=1225

 Score =   461 bits (1187),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 215/264 (81%), Positives = 229/264 (87%), Gaps = 7/264 (3%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L SLH+GVIQLWD+RMGTLIDRFDEHDGPVR V FH
Sbjct  1    MLTKFESKSNRVKGLCFHPSRPWVLTSLHNGVIQLWDFRMGTLIDRFDEHDGPVRSVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            KSQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWIVS SDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+C+SVLTGHNHYVM   FHPKEDL+VSASLDQTVRVWD   LRKKTV  A   + 
Sbjct  121  NWQSRSCVSVLTGHNHYVMSCMFHPKEDLIVSASLDQTVRVWDTTGLRKKTVRGAPSTME  180

Query  761  LS-------QMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRM  919
             S       +   D FG  DAVVKYVLEGHDRGVNWASFHPTLPLIVSG+DDRQVK+WRM
Sbjct  181  DSLPPGVGGRSGADLFGASDAVVKYVLEGHDRGVNWASFHPTLPLIVSGSDDRQVKLWRM  240

Query  920  NDTKAWEVDTLRGHMNNVSCVLFH  991
            NDTKAWEVDT+RGH NNVSCV+FH
Sbjct  241  NDTKAWEVDTMRGHTNNVSCVIFH  264


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/278 (24%), Positives = 109/278 (39%), Gaps = 53/278 (19%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI++      I++W+++  + +     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSCSDDQTIRIWNWQSRSCVSVLTGHNHYVMSCMFHPKEDLIVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------------CLFTLLGHLDYIR  511
            D  ++VW+    R                                    + L GH   + 
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSTMEDSLPPGVGGRSGADLFGASDAVVKYVLEGHDRGVN  215

Query  512  TVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASL  685
               FH   P IVS SDD+ +++W         +  + GH + V C  FHP+ +L++S S 
Sbjct  216  WASFHPTLPLIVSGSDDRQVKLWRMNDTKAWEVDTMRGHTNNVSCVIFHPRHELIISNSE  275

Query  686  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDA--VVKYVLEGHDRGV---NWA  850
            D+++RVWDI              L+  +   D F  + A      +  GHD G+      
Sbjct  276  DRSIRVWDIAKRMG---------LQTFRRENDRFWMLQAHPTQNLLAAGHDSGMIVFKLE  326

Query  851  SFHPTLPLIVSG---ADDRQVKIWRMNDTKAWEVDTLR  955
               P L  +  G     DR V+ ++  D     V TLR
Sbjct  327  RERPALDFVDGGVLYVKDRYVRRYKFVDGSDNPVATLR  364



>ref|XP_005768226.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD15797.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
Length=803

 Score =   449 bits (1156),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 215/285 (75%), Positives = 232/285 (81%), Gaps = 28/285 (10%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FHS RPW+LASLH+GV+QLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLAFHSSRPWVLASLHNGVVQLWDFRMGTLIDRFDEHDGPVRGVCFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            +SQPLFV+GGDDYKIKVWNYKL RCLF+LLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   QSQPLFVTGGDDYKIKVWNYKLRRCLFSLLGHLDYIRTVQFHVEHPWIVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQ R+C+SVLTGHNHYVMCA FH K+DLV+SASLDQTVRVWDIG LRKKT+        
Sbjct  121  NWQQRSCVSVLTGHNHYVMCAQFHVKDDLVLSASLDQTVRVWDIGGLRKKTLPETVTPEE  180

Query  761  LSQMN----------------------------TDFFGGVDAVVKYVLEGHDRGVNWASF  856
             S M                              D FGG DA VKYVLEGHDRGVNWASF
Sbjct  181  RSAMGPPMPDPAGSSPGGSLSSKLGKAIPNMKVEDLFGGNDATVKYVLEGHDRGVNWASF  240

Query  857  HPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFH  991
            H TLPLIVSGADDRQVK+WRMN+TKAWEVDTLRGH+NNVSC LFH
Sbjct  241  HSTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHINNVSCALFH  285


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 14/106 (13%)
 Frame = +2

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K + LF  GG+D  +K          + L GH   +    FH   P IVS +DD+ +++W
Sbjct  212  KVEDLF--GGNDATVK----------YVLEGHDRGVNWASFHSTLPLIVSGADDRQVKLW  259

Query  581  NWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
                     +  L GH + V CA FHPK++L++S S D+++RVWD+
Sbjct  260  RMNETKAWEVDTLRGHINNVSCALFHPKQELIISNSEDKSIRVWDM  305


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 54/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +    FH +
Sbjct  228  LEGHDRGVNWASFHSTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHINNVSCALFHPK  287

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   R  +      +      + H + +L+ + 
Sbjct  288  QELIISNSEDKSIRVWDMSKRQGVQTFRREHDRFWILAVHQESNLLAAG  336



>gb|ABM68600.1| AAEL013098-PA [Aedes aegypti]
Length=694

 Score =   446 bits (1146),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 207/261 (79%), Positives = 228/261 (87%), Gaps = 5/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKS RVKGLSFH KRPWILASLHSGVIQLWDYR+ TLI++FDEHDGPVRG+ FH
Sbjct  1    MLTNFETKSARVKGLSFHPKRPWILASLHSGVIQLWDYRISTLIEKFDEHDGPVRGIAFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
              QPLFVSGGDD+KIKVWNYK  RC+F+LLGHLDY+RT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   SQQPLFVSGGDDFKIKVWNYKQRRCIFSLLGHLDYVRTTVFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA----D  748
            NWQSR+CI VLTGHNHYVMCA FHP +D++VSASLDQTVR+WDI  LRKK V+P     D
Sbjct  121  NWQSRSCICVLTGHNHYVMCAQFHPTDDIIVSASLDQTVRIWDISGLRKKNVAPGPSGLD  180

Query  749  DILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDT  928
            D L+ +   TD FG  DAVVK+VLEGHDRGVNWASFHPTLPLIVSGADDRQ+K+WRMN+ 
Sbjct  181  DHLK-NPTATDLFGQADAVVKHVLEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNEY  239

Query  929  KAWEVDTLRGHMNNVSCVLFH  991
            KAWEVDT RGH NNVSCVLFH
Sbjct  240  KAWEVDTCRGHYNNVSCVLFH  260


 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (45%), Gaps = 6/179 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD +IK+W    ++   + T  GH + +  V FH  
Sbjct  203  LEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNEYKAWEVDTCRGHYNNVSCVLFHPR  262

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDI  712
               IVS S+D++IR+W+   R CI      +      + HP  +L  +A  D  + V+ +
Sbjct  263  AELIVSNSEDKSIRVWDMTKRQCIHTFRREHERFWILAAHPNLNL-FAAGHDSGMIVFKL  321

Query  713  GALRKKTVSPADDILRLSQ---MNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIV  880
               R       + +  + +      DF    D+VV  +  G    V   S++P L  ++
Sbjct  322  ERERPAYAVYGNCLYYVKERFLRELDFNTTTDSVVMTIRGGGKTPVYSMSYNPALNAVL  380



>ref|XP_009039560.1| hypothetical protein AURANDRAFT_38357 [Aureococcus anophagefferens]
 gb|EGB05721.1| hypothetical protein AURANDRAFT_38357 [Aureococcus anophagefferens]
Length=1221

 Score =   459 bits (1182),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/262 (81%), Positives = 235/262 (90%), Gaps = 5/262 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHPHRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            ++QPL VSGGDDY+IKVW+YKL RCLFTLLGHLDYIRTV FH +YPW+VSASDDQTIRIW
Sbjct  61   QAQPLIVSGGDDYRIKVWDYKLRRCLFTLLGHLDYIRTVCFHGDYPWLVSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTV-----SPA  745
            NWQSR+C+SVLTGHNHYVMCASFH ++DL+VSASLDQTVRVWDI  LRKK V     S A
Sbjct  121  NWQSRSCVSVLTGHNHYVMCASFHTRDDLIVSASLDQTVRVWDITGLRKKNVRGAPTSGA  180

Query  746  DDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
                 +S++N D FGG DAVVKYVLEGHDRGVNWASFHPTLPLI+SGADDRQVK+WRMN+
Sbjct  181  GTASVVSRVNADLFGGNDAVVKYVLEGHDRGVNWASFHPTLPLIISGADDRQVKLWRMNE  240

Query  926  TKAWEVDTLRGHMNNVSCVLFH  991
            TKAWEVDT+RGH NNVSCV+FH
Sbjct  241  TKAWEVDTMRGHTNNVSCVVFH  262


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (43%), Gaps = 34/187 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH   PW++++     I++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVCFHGDYPWLVSASDDQTIRIWNWQSRSCVSVLTGHNHYVMCASFHTRDDLIVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------------CLFTLLGHLDYIRTV  517
            D  ++VW+    R                                  + L GH   +   
Sbjct  156  DQTVRVWDITGLRKKNVRGAPTSGAGTASVVSRVNADLFGGNDAVVKYVLEGHDRGVNWA  215

Query  518  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQ  691
             FH   P I+S +DD+ +++W         +  + GH + V C  FHPK +L++S S D+
Sbjct  216  SFHPTLPLIISGADDRQVKLWRMNETKAWEVDTMRGHTNNVSCVVFHPKHELIISNSEDR  275

Query  692  TVRVWDI  712
            ++RVWDI
Sbjct  276  SIRVWDI  282


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL +SG DD ++K+W     +   + T+ GH + +  V FH +
Sbjct  205  LEGHDRGVNWASFHPTLPLIISGADDRQVKLWRMNETKAWEVDTMRGHTNNVSCVVFHPK  264

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D++IR+W+   R  +      N      + HP+++L+ + 
Sbjct  265  HELIISNSEDRSIRVWDISKRLGVQTFRRENDRFWILAAHPEQNLLAAG  313



>ref|XP_010788149.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha [Notothenia 
coriiceps]
Length=972

 Score =   453 bits (1166),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHH+YPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHDYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  +S    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIS--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH   PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHDYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>emb|CDQ67339.1| unnamed protein product [Oncorhynchus mykiss]
Length=1223

 Score =   459 bits (1181),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 214/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  +S    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIS--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>emb|CCA26666.1| predicted protein putative [Albugo laibachii Nc14]
Length=1240

 Score =   459 bits (1182),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 211/260 (81%), Positives = 234/260 (90%), Gaps = 3/260 (1%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL +LH+GVIQLWDYRM TL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHINRPWILTALHNGVIQLWDYRMCTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQT+RIW
Sbjct  61   KTQPLFVSGGDDYKLKVWDYKLKRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTVRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPAD---D  751
            NWQSR+C+S+LTGHNHYVM ASFHPK+DL+VSASLDQTVRVWD   LRKKTV  A    D
Sbjct  121  NWQSRSCVSILTGHNHYVMSASFHPKDDLLVSASLDQTVRVWDTTGLRKKTVRGAPSGLD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
             L  S++N D FG  DA+VKYVLEGHDRGVNWA+FHP LPLIVSGADDRQVK+WRMN+TK
Sbjct  181  DLVPSRVNNDIFGASDAIVKYVLEGHDRGVNWATFHPNLPLIVSGADDRQVKLWRMNETK  240

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDTLRGH +NVSCV+FH
Sbjct  241  AWEVDTLRGHTSNVSCVIFH  260


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (43%), Gaps = 32/185 (17%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL+      +++W+++  + +     H+  V    FH    L VS   
Sbjct  96   IRTVQFHHEYPWILSCSDDQTVRIWNWQSRSCVSILTGHNHYVMSASFHPKDDLLVSASL  155

Query  434  DYKIKVWNYKLHR------------------------------CLFTLLGHLDYIRTVQF  523
            D  ++VW+    R                                + L GH   +    F
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSGLDDLVPSRVNNDIFGASDAIVKYVLEGHDRGVNWATF  215

Query  524  HHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTV  697
            H   P IVS +DD+ +++W         +  L GH   V C  FHP+ +L++S S D+++
Sbjct  216  HPNLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHTSNVSCVIFHPRHELIISNSEDRSL  275

Query  698  RVWDI  712
            RVWDI
Sbjct  276  RVWDI  280


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH   +  V FH  
Sbjct  203  LEGHDRGVNWATFHPNLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHTSNVSCVIFHPR  262

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
            +  I+S S+D+++R+W+   R  +      N        HP ++L+ + 
Sbjct  263  HELIISNSEDRSLRVWDISKRVALQTFRRENDRFWILQAHPTQNLIAAG  311



>ref|XP_003487682.1| PREDICTED: coatomer subunit alpha-like, partial [Bombus impatiens]
Length=435

 Score =   435 bits (1119),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 222/260 (85%), Gaps = 3/260 (1%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKG+SFH KRPW+L SLH+G+IQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGISFHPKRPWVLVSLHNGIIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
              QPLFVSGGDDYKIKVWNYK  +CLFTLLGHLDYIRT+ FH EYPWI+SASDDQT+RIW
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRKCLFTLLGHLDYIRTIVFHQEYPWILSASDDQTVRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR CI VLTGHNHYVMCA FHP ED++VSASLDQTVR+WD+  LRKK V+P    L 
Sbjct  121  NWQSRACICVLTGHNHYVMCAQFHPTEDIIVSASLDQTVRIWDVSGLRKKNVAPGPGGLE  180

Query  761  LSQMN---TDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
                N   TD FG  DAVV+++L+ HDRGVNWA FHPTLPLIVSGADDRQ+K+WRMND K
Sbjct  181  DHLKNPGATDLFGQADAVVRHILDAHDRGVNWACFHPTLPLIVSGADDRQIKMWRMNDAK  240

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSCVLFH
Sbjct  241  AWEVDTCRGHYNNVSCVLFH  260


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 86/189 (46%), Gaps = 40/189 (21%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL++     +++W+++    I     H+  V    FH ++ + VS   
Sbjct  96   IRTIVFHQEYPWILSASDDQTVRIWNWQSRACICVLTGHNHYVMCAQFHPTEDIIVSASL  155

Query  434  DYKIKVWNYKLHR------------------CLFTLLGHLDYI---------RTVQ---F  523
            D  +++W+    R                      L G  D +         R V    F
Sbjct  156  DQTVRIWDVSGLRKKNVAPGPGGLEDHLKNPGATDLFGQADAVVRHILDAHDRGVNWACF  215

Query  524  HHEYPWIVSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  685
            H   P IVS +DD+ I++W       W+  TC     GH + V C  FHP++DL++S S 
Sbjct  216  HPTLPLIVSGADDRQIKMWRMNDAKAWEVDTC----RGHYNNVSCVLFHPRQDLILSNSE  271

Query  686  DQTVRVWDI  712
            D+++RVWD+
Sbjct  272  DKSIRVWDM  280


 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 62/142 (44%), Gaps = 10/142 (7%)
 Frame = +2

Query  260  GLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDY  439
            GL  H K P        G   L+      +    D HD  V    FH + PL VSG DD 
Sbjct  178  GLEDHLKNP--------GATDLFGQADAVVRHILDAHDRGVNWACFHPTLPLIVSGADDR  229

Query  440  KIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVL  613
            +IK+W     +   + T  GH + +  V FH     I+S S+D++IR+W+   RTC+   
Sbjct  230  QIKMWRMNDAKAWEVDTCRGHYNNVSCVLFHPRQDLILSNSEDKSIRVWDMSKRTCLHTF  289

Query  614  TGHNHYVMCASFHPKEDLVVSA  679
               +      + HP  +L  + 
Sbjct  290  RREHERFWVITAHPTLNLFAAG  311



>ref|XP_006999128.1| PREDICTED: LOW QUALITY PROTEIN: coatomer protein complex, subunit 
alpha [Peromyscus maniculatus bairdii]
Length=1133

 Score =   456 bits (1174),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>gb|EMT02979.1| Coatomer subunit alpha-3 [Aegilops tauschii]
Length=1184

 Score =   457 bits (1177),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = +2

Query  323  LWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLD  502
            +WDYRMGTL+DRFDEHDGPVRGVHFHK+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLD
Sbjct  1    MWDYRMGTLLDRFDEHDGPVRGVHFHKTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLD  60

Query  503  YIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSAS  682
            YIRTVQFH E+PWIVSASDDQTIR+WNWQSRTC++VLTGHNHYVMCASFHPKEDLVVSAS
Sbjct  61   YIRTVQFHDEHPWIVSASDDQTIRVWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSAS  120

Query  683  LDQTVRVWDIGALRKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHP  862
            LDQTVRVWDIGALRKK+ SPADDI+RL+QMNTD FGG+DAVVKYVLEGHDRGVNWASFHP
Sbjct  121  LDQTVRVWDIGALRKKSSSPADDIMRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHP  180

Query  863  TLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHS  994
            TLPLIVSGADDRQVK+WRMNDTKAWEVDTLRGHMNNVSCVLFH+
Sbjct  181  TLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHA  224


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 81/181 (45%), Gaps = 29/181 (16%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T +     H+  V    FH  + L VS   
Sbjct  62   IRTVQFHDEHPWIVSASDDQTIRVWNWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASL  121

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  122  DQTVRVWDIGALRKKSSSPADDIMRLTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPT  181

Query  533  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
             P IVS +DD+ +++W         +  L GH + V C  FH K+D++VS S D+++RVW
Sbjct  182  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVW  241

Query  707  D  709
            D
Sbjct  242  D  242


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  166  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  225

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               IVS S+D++IR+W+   RT I      +      + HP+ +L+ + 
Sbjct  226  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAAHPEMNLLAAG  274



>ref|XP_011503846.1| PREDICTED: coatomer subunit alpha [Ceratosolen solmsi marchali]
Length=1221

 Score =   458 bits (1178),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/261 (81%), Positives = 231/261 (89%), Gaps = 5/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFHSKRPWILASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHSKRPWILASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
              QP+FVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   NQQPIFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA----D  748
            NWQSRTCI VLTGHNHYVMCA FHP ED++VSASLDQTVRVWDI  LRKK V+P     D
Sbjct  121  NWQSRTCICVLTGHNHYVMCAQFHPTEDIIVSASLDQTVRVWDISGLRKKNVAPGPSGLD  180

Query  749  DILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDT  928
            D L+ +  +TD FG  DA+VK+VLEGHDRGVNWASFHPTLPLIVSGADDRQ+K+WRMND 
Sbjct  181  DHLK-NPGSTDLFGQADALVKHVLEGHDRGVNWASFHPTLPLIVSGADDRQIKMWRMNDA  239

Query  929  KAWEVDTLRGHMNNVSCVLFH  991
            KAWEVDT RGH NNVSCVLFH
Sbjct  240  KAWEVDTCRGHYNNVSCVLFH  260


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 86/189 (46%), Gaps = 40/189 (21%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++   FH + PWIL++     I++W+++  T I     H+  V    FH ++ + VS   
Sbjct  96   IRTTVFHHEYPWILSASDDQTIRVWNWQSRTCICVLTGHNHYVMCAQFHPTEDIIVSASL  155

Query  434  DYKIKVWNYKLHRC---------------------LF---------TLLGHLDYIRTVQF  523
            D  ++VW+    R                      LF          L GH   +    F
Sbjct  156  DQTVRVWDISGLRKKNVAPGPSGLDDHLKNPGSTDLFGQADALVKHVLEGHDRGVNWASF  215

Query  524  HHEYPWIVSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  685
            H   P IVS +DD+ I++W       W+  TC     GH + V C  FHP++D+++S + 
Sbjct  216  HPTLPLIVSGADDRQIKMWRMNDAKAWEVDTC----RGHYNNVSCVLFHPRQDIILSNAE  271

Query  686  DQTVRVWDI  712
            D+++RVWD+
Sbjct  272  DKSIRVWDM  280


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD +IK+W     +   + T  GH + +  V FH  
Sbjct  203  LEGHDRGVNWASFHPTLPLIVSGADDRQIKMWRMNDAKAWEVDTCRGHYNNVSCVLFHPR  262

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S ++D++IR+W+   RTC+      +      + HP  +L  + 
Sbjct  263  QDIILSNAEDKSIRVWDMTKRTCLHTFRREHERFWVLAAHPTLNLFAAG  311



>ref|XP_009821126.1| hypothetical protein H257_00241 [Aphanomyces astaci]
 gb|ETV88726.1| hypothetical protein H257_00241 [Aphanomyces astaci]
Length=1241

 Score =   458 bits (1179),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/267 (79%), Positives = 231/267 (87%), Gaps = 10/267 (4%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L+SLH+GVIQLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLCFHPTRPWVLSSLHNGVIQLWDFRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K+QPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIR+VQFHHEYPWI S SDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRSVQFHHEYPWITSCSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSR+C+SVLTGH+H+VM   FHPKEDL+VSASLDQTVRVWD   LRKKTV  A   L 
Sbjct  121  NWQSRSCVSVLTGHHHFVMSCQFHPKEDLIVSASLDQTVRVWDTTGLRKKTVRGAPSSLE  180

Query  761  ----------LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKI  910
                      L +  +D FG  DAVVKYVLEGHDRGVNWASFHPTLPLIVSG+DDRQVK+
Sbjct  181  DSIPVASPHGLGRSGSDIFGATDAVVKYVLEGHDRGVNWASFHPTLPLIVSGSDDRQVKL  240

Query  911  WRMNDTKAWEVDTLRGHMNNVSCVLFH  991
            WRMNDTKAWEVDT+RGH NNVSCV+FH
Sbjct  241  WRMNDTKAWEVDTMRGHTNNVSCVIFH  267


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 80/193 (41%), Gaps = 39/193 (20%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI +      I++W+++  + +     H   V    FH  + L VS   
Sbjct  96   IRSVQFHHEYPWITSCSDDQTIRIWNWQSRSCVSVLTGHHHFVMSCQFHPKEDLIVSASL  155

Query  434  DYKIKVWNYKLHR-------------------------------------CLFTLLGHLD  502
            D  ++VW+    R                                       + L GH  
Sbjct  156  DQTVRVWDTTGLRKKTVRGAPSSLEDSIPVASPHGLGRSGSDIFGATDAVVKYVLEGHDR  215

Query  503  YIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVS  676
             +    FH   P IVS SDD+ +++W         +  + GH + V C  FHP+++L++S
Sbjct  216  GVNWASFHPTLPLIVSGSDDRQVKLWRMNDTKAWEVDTMRGHTNNVSCVIFHPRQELILS  275

Query  677  ASLDQTVRVWDIG  715
             S D+++RVWDI 
Sbjct  276  NSEDRSIRVWDIA  288


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + +  V FH  
Sbjct  210  LEGHDRGVNWASFHPTLPLIVSGSDDRQVKLWRMNDTKAWEVDTMRGHTNNVSCVIFHPR  269

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   R  +      N        HP ++L+ + 
Sbjct  270  QELILSNSEDRSIRVWDIAKRMGLQTFRRENDRFWMLQAHPTQNLLAAG  318



>ref|XP_002801923.1| PREDICTED: coatomer subunit alpha-like [Macaca mulatta]
Length=1138

 Score =   456 bits (1173),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004078629.1| PREDICTED: coatomer subunit alpha [Oryzias latipes]
Length=1219

 Score =   457 bits (1177),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 213/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  +S    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIS--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005710742.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
 emb|CDF40448.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
Length=1269

 Score =   459 bits (1180),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 206/262 (79%), Positives = 234/262 (89%), Gaps = 5/262 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH  RPWILASLH+G IQLWDYRMGTLIDRFDEH+GPVRG+ FH
Sbjct  1    MLTKFETKSNRVKGLAFHPTRPWILASLHNGAIQLWDYRMGTLIDRFDEHEGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            +SQPLFVSGGDDYKIKVWNYKL RC+FTL+GHLDYIRTV FHHE PWIVSASDDQT+RIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKLRRCIFTLIGHLDYIRTVYFHHESPWIVSASDDQTVRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQ+R+C++VLTGH+HY M A F P EDLVVSASLDQT+RVWDI +LR+K+V P+D + +
Sbjct  121  NWQNRSCLAVLTGHSHYCMSAMFSPNEDLVVSASLDQTIRVWDISSLRQKSVRPSDVMAQ  180

Query  761  L-----SQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMND  925
            +     + +N D FGG DAVVKYVLEGH RGVNWASFHPTLPLIVSGADDRQVK+WRM+D
Sbjct  181  VRGQLPAAVNADLFGGTDAVVKYVLEGHTRGVNWASFHPTLPLIVSGADDRQVKLWRMSD  240

Query  926  TKAWEVDTLRGHMNNVSCVLFH  991
            TKAWE+DT RGH+NNVSC +FH
Sbjct  241  TKAWELDTFRGHLNNVSCAMFH  262


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 81/187 (43%), Gaps = 34/187 (18%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     +++W+++  + +     H        F  ++ L VS   
Sbjct  96   IRTVYFHHESPWIVSASDDQTVRIWNWQNRSCLAVLTGHSHYCMSAMFSPNEDLVVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------------CLFTLLGHLDYIRTV  517
            D  I+VW+    R                                  + L GH   +   
Sbjct  156  DQTIRVWDISSLRQKSVRPSDVMAQVRGQLPAAVNADLFGGTDAVVKYVLEGHTRGVNWA  215

Query  518  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFHPKEDLVVSASLDQ  691
             FH   P IVS +DD+ +++W         +    GH + V CA FHP+++LV++ S D+
Sbjct  216  SFHPTLPLIVSGADDRQVKLWRMSDTKAWELDTFRGHLNNVSCAMFHPRKELVITDSEDK  275

Query  692  TVRVWDI  712
            T+RVWD+
Sbjct  276  TIRVWDL  282


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 5/108 (5%)
 Frame = +2

Query  371  DGPVRGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEY  535
            +G  RGV+   FH + PL VSG DD ++K+W     +   L T  GHL+ +    FH   
Sbjct  206  EGHTRGVNWASFHPTLPLIVSGADDRQVKLWRMSDTKAWELDTFRGHLNNVSCAMFHPRK  265

Query  536  PWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
              +++ S+D+TIR+W+   RTC+             + HP  +L+ + 
Sbjct  266  ELVITDSEDKTIRVWDLNRRTCLHTFRRDADRFWILTAHPTINLIAAG  313



>ref|NP_001133825.1| Coatomer subunit alpha [Salmo salar]
 gb|ACI33965.1| Coatomer subunit alpha [Salmo salar]
Length=1307

 Score =   459 bits (1182),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  +S    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIS--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_010888093.1| PREDICTED: coatomer subunit alpha [Esox lucius]
Length=1222

 Score =   457 bits (1177),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 211/258 (82%), Positives = 228/258 (88%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR  760
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP      
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETE  180

Query  761  LSQMN-TDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
            +  ++  D FG  DAVVK+VLEGHDRGVNWA+FHP++PLIVSGADDRQVKIWRMN++KAW
Sbjct  181  VRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAW  240

Query  938  EVDTLRGHMNNVSCVLFH  991
            E+DT RGH NNVSC +FH
Sbjct  241  ELDTCRGHYNNVSCAVFH  258


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETEVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005102617.1| PREDICTED: coatomer subunit alpha-like [Aplysia californica]
Length=1228

 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/261 (81%), Positives = 230/261 (88%), Gaps = 5/261 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GV+QLWDYRM TLID+FDEHDGPVRG++FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHTGVVQLWDYRMCTLIDKFDEHDGPVRGINFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            + QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRT  FHHEYPWI+S+SDDQTIRIW
Sbjct  61   QQQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTTFFHHEYPWILSSSDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA----D  748
            NWQSRTCISVLTGH+HYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK V+P     +
Sbjct  121  NWQSRTCISVLTGHSHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNVAPGPGGIE  180

Query  749  DILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDT  928
            D LR     TD FG  DA+VK+VLEGHDRGVNWA+FHPTLPLIVSGADDRQ+K+WRMN+ 
Sbjct  181  DRLR-GPGQTDLFGTSDAIVKHVLEGHDRGVNWAAFHPTLPLIVSGADDRQIKLWRMNEA  239

Query  929  KAWEVDTLRGHMNNVSCVLFH  991
            KAWEVDT RGH NNVSC LFH
Sbjct  240  KAWEVDTCRGHYNNVSCCLFH  260


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 83/184 (45%), Gaps = 40/184 (22%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL+S     I++W+++  T I     H   V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSSSDDQTIRIWNWQSRTCISVLTGHSHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC---------------------LF---------TLLGHLDYIRTVQFHHEYP  538
            VW+    R                      LF          L GH   +    FH   P
Sbjct  161  VWDISGLRKKNVAPGPGGIEDRLRGPGQTDLFGTSDAIVKHVLEGHDRGVNWAAFHPTLP  220

Query  539  WIVSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVR  700
             IVS +DD+ I++W       W+  TC     GH + V C  FHP+++L++S S D+++R
Sbjct  221  LIVSGADDRQIKLWRMNEAKAWEVDTC----RGHYNNVSCCLFHPRQELILSNSEDKSIR  276

Query  701  VWDI  712
            VWD+
Sbjct  277  VWDM  280


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD +IK+W     +   + T  GH + +    FH  
Sbjct  203  LEGHDRGVNWAAFHPTLPLIVSGADDRQIKLWRMNEAKAWEVDTCRGHYNNVSCCLFHPR  262

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  263  QELILSNSEDKSIRVWDMSKRTGVQTFRREHDRFWVMGAHPTLNLFAAG  311



>ref|XP_005981769.1| PREDICTED: coatomer subunit alpha isoform X2 [Pantholops hodgsonii]
Length=1224

 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|NP_001001941.2| coatomer subunit alpha [Danio rerio]
 gb|AAT68072.1| cotamer alpha [Danio rerio]
Length=1224

 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 213/258 (83%), Positives = 227/258 (88%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP-ADDIL  757
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP A D  
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVDTE  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
                   D FG  DAVVK+VLEGHDRGVNWA+FHP++PLIVSGADDRQVKIWRMN++KAW
Sbjct  181  VRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAW  240

Query  938  EVDTLRGHMNNVSCVLFH  991
            E+DT RGH NNVSC +FH
Sbjct  241  ELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVDTEVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_006096970.1| PREDICTED: coatomer subunit alpha isoform X2 [Myotis lucifugus]
Length=1223

 Score =   457 bits (1175),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008152468.1| PREDICTED: coatomer subunit alpha isoform X2 [Eptesicus fuscus]
Length=1223

 Score =   457 bits (1175),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_005796611.1| PREDICTED: coatomer subunit alpha-like isoform X2 [Xiphophorus 
maculatus]
Length=1222

 Score =   457 bits (1175),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 14/140 (10%)
 Frame = +2

Query  299  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  445
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  446  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTG  619
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  620  HNHYVMCASFHPKEDLVVSA  679
             +        HP  +L  + 
Sbjct  290  DHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005981768.1| PREDICTED: coatomer subunit alpha isoform X1 [Pantholops hodgsonii]
Length=1233

 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008152467.1| PREDICTED: coatomer subunit alpha isoform X1 [Eptesicus fuscus]
Length=1232

 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006096969.1| PREDICTED: coatomer subunit alpha isoform X1 [Myotis lucifugus]
Length=1232

 Score =   457 bits (1176),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006895530.1| PREDICTED: coatomer subunit alpha isoform X2 [Elephantulus edwardii]
Length=1224

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004688439.1| PREDICTED: coatomer subunit alpha isoform X2 [Condylura cristata]
Length=1224

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_011595606.1| PREDICTED: coatomer subunit alpha [Aquila chrysaetos canadensis]
Length=1224

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004002718.1| PREDICTED: coatomer subunit alpha isoform X2 [Ovis aries]
 ref|XP_005677280.1| PREDICTED: coatomer subunit alpha isoform X2 [Capra hircus]
 ref|XP_012013945.1| PREDICTED: coatomer subunit alpha isoform X2 [Ovis aries musimon]
Length=1224

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008432228.1| PREDICTED: coatomer subunit alpha [Poecilia reticulata]
Length=1222

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 14/140 (10%)
 Frame = +2

Query  299  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  445
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  446  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTG  619
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  620  HNHYVMCASFHPKEDLVVSA  679
             +        HP  +L  + 
Sbjct  290  DHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005796610.1| PREDICTED: coatomer subunit alpha-like isoform X1 [Xiphophorus 
maculatus]
Length=1232

 Score =   457 bits (1175),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 229/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWE+DT RGH NNVSC +FH
Sbjct  239  AWELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVETDVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 14/140 (10%)
 Frame = +2

Query  299  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  445
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  446  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTG  619
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  620  HNHYVMCASFHPKEDLVVSA  679
             +        HP  +L  + 
Sbjct  290  DHDRFWVLGAHPNLNLFAAG  309



>ref|XP_010562443.1| PREDICTED: coatomer subunit alpha [Haliaeetus leucocephalus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006861712.1| PREDICTED: coatomer subunit alpha isoform X1 [Chrysochloris asiatica]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_003500327.1| PREDICTED: coatomer subunit alpha [Cricetulus griseus]
 ref|XP_007627497.1| PREDICTED: coatomer subunit alpha [Cricetulus griseus]
 gb|EGV93396.1| Coatomer subunit alpha [Cricetulus griseus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004775910.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
 ref|XP_004819831.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004671175.1| PREDICTED: coatomer subunit alpha isoform X2 [Jaculus jaculus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_010282036.1| PREDICTED: coatomer subunit alpha [Phaethon lepturus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006267538.1| PREDICTED: coatomer subunit alpha [Alligator mississippiensis]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_009474826.1| PREDICTED: coatomer subunit alpha [Nipponia nippon]
 ref|XP_009887821.1| PREDICTED: coatomer subunit alpha isoform X2 [Charadrius vociferus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|NP_001099115.1| coatomer subunit alpha [Bos taurus]
 ref|XP_010845189.1| PREDICTED: coatomer subunit alpha [Bison bison bison]
 gb|AAI53252.1| COPA protein [Bos taurus]
 tpg|DAA31942.1| TPA: coatomer subunit alpha [Bos taurus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004775909.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
 ref|XP_004819830.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_007945901.1| PREDICTED: coatomer subunit alpha isoform X2 [Orycteropus afer 
afer]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>sp|Q27954.1|COPA_BOVIN RecName: Full=Coatomer subunit alpha; AltName: Full=Alpha-coat 
protein; Short=Alpha-COP; AltName: Full=HEP-COP; Short=HEPCOP; 
Contains: RecName: Full=Xenin; AltName: Full=Xenopsin-related 
peptide; Contains: RecName: Full=Proxenin [Bos taurus]
 emb|CAA65543.1| alpha-cop protein [Bos primigenius]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008494291.1| PREDICTED: coatomer subunit alpha isoform X2 [Calypte anna]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008698915.1| PREDICTED: coatomer subunit alpha isoform X1 [Ursus maritimus]
 ref|XP_008698916.1| PREDICTED: coatomer subunit alpha isoform X1 [Ursus maritimus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006060555.1| PREDICTED: coatomer subunit alpha isoform X2 [Bubalus bubalis]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_002928486.1| PREDICTED: coatomer subunit alpha [Ailuropoda melanoleuca]
 ref|XP_011234602.1| PREDICTED: coatomer subunit alpha [Ailuropoda melanoleuca]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|NP_001026576.1| coatomer subunit alpha [Gallus gallus]
 emb|CAH65430.1| hypothetical protein RCJMB04_34d13 [Gallus gallus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_007129697.1| PREDICTED: coatomer subunit alpha isoform X2 [Physeter catodon]
Length=1217

 Score =   456 bits (1174),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_009080612.1| PREDICTED: coatomer subunit alpha [Acanthisitta chloris]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006174003.1| PREDICTED: coatomer subunit alpha isoform X2 [Camelus ferus]
 ref|XP_006215715.1| PREDICTED: coatomer subunit alpha isoform X2 [Vicugna pacos]
 ref|XP_010953944.1| PREDICTED: coatomer subunit alpha isoform X2 [Camelus bactrianus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004589141.1| PREDICTED: coatomer subunit alpha isoform X2 [Ochotona princeps]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004442851.1| PREDICTED: coatomer subunit alpha isoform 1 [Ceratotherium simum 
simum]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>gb|AAI62474.1| Copa protein [Danio rerio]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 227/258 (88%), Gaps = 1/258 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSP-ADDIL  757
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWD+  LRKK +SP A D  
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDVSGLRKKNLSPGAVDTE  180

Query  758  RLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAW  937
                   D FG  DAVVK+VLEGHDRGVNWA+FHP++PLIVSGADDRQVKIWRMN++KAW
Sbjct  181  VRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAW  240

Query  938  EVDTLRGHMNNVSCVLFH  991
            E+DT RGH NNVSC +FH
Sbjct  241  ELDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDVSGLRKKNLSPGAVDTEVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +        HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAG  309



>ref|XP_005400264.1| PREDICTED: coatomer subunit alpha isoform X2 [Chinchilla lanigera]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004613819.1| PREDICTED: coatomer subunit alpha isoform X2 [Sorex araneus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004448470.1| PREDICTED: coatomer subunit alpha isoform 2 [Dasypus novemcinctus]
Length=1224

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_006895529.1| PREDICTED: coatomer subunit alpha isoform X1 [Elephantulus edwardii]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004589140.1| PREDICTED: coatomer subunit alpha isoform X1 [Ochotona princeps]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004002719.1| PREDICTED: coatomer subunit alpha isoform X1 [Ovis aries]
 ref|XP_005677279.1| PREDICTED: coatomer subunit alpha isoform X1 [Capra hircus]
 ref|XP_012013944.1| PREDICTED: coatomer subunit alpha isoform X1 [Ovis aries musimon]
Length=1233

 Score =   457 bits (1175),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_001928742.1| PREDICTED: coatomer subunit alpha isoform 2 [Sus scrofa]
Length=1224

 Score =   456 bits (1174),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_003213999.1| PREDICTED: coatomer subunit alpha [Meleagris gallopavo]
Length=1224

 Score =   456 bits (1174),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_007945900.1| PREDICTED: coatomer subunit alpha isoform X1 [Orycteropus afer 
afer]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_005400263.1| PREDICTED: coatomer subunit alpha isoform X1 [Chinchilla lanigera]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_003892963.1| PREDICTED: coatomer subunit alpha isoform X1 [Papio anubis]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008518688.1| PREDICTED: coatomer subunit alpha isoform X1 [Equus przewalskii]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_007974682.1| PREDICTED: coatomer subunit alpha isoform X1 [Chlorocebus sabaeus]
 ref|XP_011923019.1| PREDICTED: coatomer subunit alpha isoform X1 [Cercocebus atys]
 ref|XP_011825766.1| PREDICTED: coatomer subunit alpha isoform X1 [Mandrillus leucophaeus]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004407935.1| PREDICTED: coatomer subunit alpha isoform 1 [Odobenus rosmarus 
divergens]
Length=1233

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_008518689.1| PREDICTED: coatomer subunit alpha isoform X2 [Equus przewalskii]
Length=1224

 Score =   456 bits (1174),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



>ref|XP_004284479.1| PREDICTED: coatomer subunit alpha isoform 2 [Orcinus orca]
 ref|XP_004312716.1| PREDICTED: coatomer subunit alpha isoform 2 [Tursiops truncatus]
 ref|XP_007459992.1| PREDICTED: coatomer subunit alpha isoform X2 [Lipotes vexillifer]
Length=1224

 Score =   456 bits (1174),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/260 (82%), Positives = 228/260 (88%), Gaps = 5/260 (2%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  580
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  581  NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPA---DD  751
            NWQSRTC+ VLTGHNHYVMCA FHP EDLVVSASLDQTVRVWDI  LRKK +SP     D
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD  180

Query  752  ILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTK  931
            +  ++    D FG  DAVVK+VLEGHDRGVNWA+FHPT+PLIVSGADDRQVKIWRMN++K
Sbjct  181  VRGIT--GVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESK  238

Query  932  AWEVDTLRGHMNNVSCVLFH  991
            AWEVDT RGH NNVSC +FH
Sbjct  239  AWEVDTCRGHYNNVSCAVFH  258


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 38/182 (21%)
 Frame = +2

Query  269  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  448
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  449  VWNYKLHRC-------------------LF---------TLLGHLDYIRTVQFHHEYPWI  544
            VW+    R                    LF          L GH   +    FH   P I
Sbjct  161  VWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLI  220

Query  545  VSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVW  706
            VS +DD+ ++IW       W+  TC     GH + V CA FHP+++L++S S D+++RVW
Sbjct  221  VSGADDRQVKIWRMNESKAWEVDTC----RGHYNNVSCAVFHPRQELILSNSEDKSIRVW  276

Query  707  DI  712
            D+
Sbjct  277  DM  278


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 2/109 (2%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPR  260

Query  533  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSA  679
               I+S S+D++IR+W+   RT +      +      + HP  +L  + 
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAG  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2475370696162