BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4389

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002281748.1|  PREDICTED: myosin-2                                259   7e-76   Vitis vinifera
emb|CBI20376.3|  unnamed protein product                                259   7e-76   Vitis vinifera
ref|XP_010062907.1|  PREDICTED: myosin-2                                252   4e-73   Eucalyptus grandis [rose gum]
ref|XP_006841789.2|  PREDICTED: myosin-1                                245   1e-70   Amborella trichopoda
gb|ERN03464.1|  hypothetical protein AMTR_s00003p00267250               245   1e-70   Amborella trichopoda
gb|ERN09379.1|  hypothetical protein AMTR_s00029p00027850               243   5e-70   Amborella trichopoda
ref|XP_006847798.2|  PREDICTED: myosin-1                                243   6e-70   Amborella trichopoda
emb|CDP05853.1|  unnamed protein product                                241   9e-70   Coffea canephora [robusta coffee]
ref|XP_009773272.1|  PREDICTED: myosin-2-like isoform X3                240   2e-69   Nicotiana sylvestris
ref|XP_009773270.1|  PREDICTED: myosin-2-like isoform X1                241   2e-69   Nicotiana sylvestris
gb|EYU19161.1|  hypothetical protein MIMGU_mgv1a000383mg                242   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_009773271.1|  PREDICTED: myosin-2-like isoform X2                241   2e-69   Nicotiana sylvestris
ref|XP_009603977.1|  PREDICTED: myosin-2-like isoform X3                239   3e-69   Nicotiana tomentosiformis
ref|XP_008805849.1|  PREDICTED: myosin-1-like                           241   3e-69   Phoenix dactylifera
ref|XP_009603974.1|  PREDICTED: myosin-2-like isoform X1                241   3e-69   Nicotiana tomentosiformis
ref|XP_009603975.1|  PREDICTED: myosin-2-like isoform X2                240   4e-69   Nicotiana tomentosiformis
ref|XP_007021261.1|  Myosin 2 isoform 1                                 240   6e-69   
ref|XP_007021262.1|  Myosin 2 isoform 2                                 240   7e-69   
ref|XP_008800396.1|  PREDICTED: myosin-1-like                           240   7e-69   Phoenix dactylifera
ref|XP_002523758.1|  myosin vIII, putative                              238   3e-68   
ref|XP_011095261.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-2-like      237   3e-68   
ref|XP_009389227.1|  PREDICTED: myosin-1-like                           238   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG02807.1|  Myosin-J heavy chain                                    230   8e-68   Gossypium arboreum [tree cotton]
ref|XP_002525757.1|  myosin vIII, putative                              237   9e-68   Ricinus communis
gb|AAM14075.1|  putative myosin                                         237   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188630.1|  myosin 1                                              237   9e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CAB61875.1|  myosin                                                 236   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922002.1|  PREDICTED: myosin-1-like                           236   1e-67   Elaeis guineensis
ref|XP_007043232.1|  Myosin 1 isoform 2                                 235   1e-67   
ref|XP_008664832.1|  PREDICTED: myosin-1                                236   1e-67   Zea mays [maize]
ref|XP_010268832.1|  PREDICTED: myosin-2                                237   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_012072827.1|  PREDICTED: myosin-1-like isoform X4                236   2e-67   
ref|XP_009406771.1|  PREDICTED: myosin-1-like                           236   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012072826.1|  PREDICTED: myosin-1-like isoform X3                236   2e-67   
gb|ABJ53202.1|  myosin VIII-B                                           235   2e-67   Nicotiana benthamiana
ref|XP_012072822.1|  PREDICTED: myosin-1-like isoform X1                236   2e-67   Jatropha curcas
gb|KDO69893.1|  hypothetical protein CISIN_1g0010671mg                  231   2e-67   Citrus sinensis [apfelsine]
gb|KDP37497.1|  hypothetical protein JCGZ_05936                         234   3e-67   Jatropha curcas
ref|XP_008806763.1|  PREDICTED: myosin-1-like                           236   3e-67   Phoenix dactylifera
ref|XP_012072824.1|  PREDICTED: myosin-1-like isoform X2                235   3e-67   Jatropha curcas
gb|KDO69897.1|  hypothetical protein CISIN_1g0010671mg                  232   3e-67   Citrus sinensis [apfelsine]
gb|KDO69892.1|  hypothetical protein CISIN_1g0010671mg                  231   4e-67   Citrus sinensis [apfelsine]
ref|XP_007043231.1|  Myosin 1 isoform 1                                 235   4e-67   
ref|XP_006406435.1|  hypothetical protein EUTSA_v10019925mg             235   4e-67   
gb|KDO69895.1|  hypothetical protein CISIN_1g0010671mg                  232   5e-67   Citrus sinensis [apfelsine]
ref|XP_010905050.1|  PREDICTED: myosin-1                                235   5e-67   
gb|KJB13458.1|  hypothetical protein B456_002G076300                    229   7e-67   Gossypium raimondii
gb|KJB79817.1|  hypothetical protein B456_013G068300                    233   7e-67   Gossypium raimondii
ref|XP_011022009.1|  PREDICTED: myosin-1-like isoform X2                234   8e-67   Populus euphratica
gb|KJB79824.1|  hypothetical protein B456_013G068300                    232   1e-66   Gossypium raimondii
ref|XP_010557555.1|  PREDICTED: myosin-1-like                           234   1e-66   Tarenaya hassleriana [spider flower]
gb|KDO69891.1|  hypothetical protein CISIN_1g0010671mg                  232   1e-66   Citrus sinensis [apfelsine]
ref|XP_011022005.1|  PREDICTED: myosin-1-like isoform X1                234   1e-66   Populus euphratica
gb|KDO69889.1|  hypothetical protein CISIN_1g0010671mg                  232   1e-66   Citrus sinensis [apfelsine]
emb|CDY24591.1|  BnaC05g32750D                                          233   1e-66   Brassica napus [oilseed rape]
gb|KHG12024.1|  Myosin-2 heavy chain                                    227   1e-66   Gossypium arboreum [tree cotton]
gb|KHG10661.1|  Myosin-I heavy chain                                    223   1e-66   Gossypium arboreum [tree cotton]
gb|KDO74224.1|  hypothetical protein CISIN_1g000931mg                   232   1e-66   Citrus sinensis [apfelsine]
ref|XP_006393159.1|  hypothetical protein EUTSA_v10011193mg             233   2e-66   
ref|XP_010905572.1|  PREDICTED: myosin-1-like                           234   2e-66   
gb|KDO74223.1|  hypothetical protein CISIN_1g000931mg                   233   2e-66   Citrus sinensis [apfelsine]
ref|XP_010103613.1|  Myosin-2 heavy chain                               233   2e-66   
gb|EYU35564.1|  hypothetical protein MIMGU_mgv1a000458mg                233   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_006451994.1|  hypothetical protein CICLE_v10007271mg             233   2e-66   
gb|KDO74222.1|  hypothetical protein CISIN_1g000931mg                   233   2e-66   Citrus sinensis [apfelsine]
ref|XP_010249396.1|  PREDICTED: myosin-1-like                           233   2e-66   Nelumbo nucifera [Indian lotus]
emb|CDX82270.1|  BnaA03g35510D                                          233   2e-66   
gb|KJB13459.1|  hypothetical protein B456_002G076300                    230   2e-66   Gossypium raimondii
gb|KJB13460.1|  hypothetical protein B456_002G076300                    230   2e-66   Gossypium raimondii
gb|KJB13461.1|  hypothetical protein B456_002G076300                    230   2e-66   Gossypium raimondii
ref|XP_009145706.1|  PREDICTED: myosin-1 isoform X1                     233   3e-66   Brassica rapa
gb|KEH40947.1|  P-loop nucleoside triphosphate hydrolase superfam...    233   3e-66   Medicago truncatula
ref|XP_008797209.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-1-like      233   3e-66   Phoenix dactylifera
emb|CDP18554.1|  unnamed protein product                                232   3e-66   Coffea canephora [robusta coffee]
ref|XP_006451996.1|  hypothetical protein CICLE_v10007271mg             233   3e-66   Citrus clementina [clementine]
ref|XP_009145709.1|  PREDICTED: myosin-1 isoform X2                     232   3e-66   Brassica rapa
gb|KDO74218.1|  hypothetical protein CISIN_1g000931mg                   233   3e-66   Citrus sinensis [apfelsine]
ref|XP_007149632.1|  hypothetical protein PHAVU_005G085900g             229   3e-66   Phaseolus vulgaris [French bean]
ref|XP_002883217.1|  hypothetical protein ARALYDRAFT_479514             232   4e-66   
gb|KJB79825.1|  hypothetical protein B456_013G068300                    231   4e-66   Gossypium raimondii
ref|XP_010279450.1|  PREDICTED: myosin-1-like                           233   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004297721.1|  PREDICTED: myosin-1-like                           232   5e-66   Fragaria vesca subsp. vesca
ref|XP_002307152.1|  myosin-related family protein                      232   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008812673.1|  PREDICTED: myosin-1-like isoform X4                231   6e-66   Phoenix dactylifera
gb|KJB79823.1|  hypothetical protein B456_013G068300                    231   6e-66   Gossypium raimondii
emb|CDY25361.1|  BnaA05g19230D                                          233   6e-66   Brassica napus [oilseed rape]
ref|XP_002891568.1|  hypothetical protein ARALYDRAFT_474163             231   6e-66   
ref|XP_008812672.1|  PREDICTED: myosin-1-like isoform X3                232   6e-66   
ref|XP_008812671.1|  PREDICTED: myosin-1-like isoform X2                232   7e-66   Phoenix dactylifera
ref|XP_006464677.1|  PREDICTED: myosin-2-like isoform X6                231   8e-66   Citrus sinensis [apfelsine]
ref|XP_010479488.1|  PREDICTED: myosin-3-like                           231   8e-66   Camelina sativa [gold-of-pleasure]
gb|KHF99826.1|  Unconventional myosin-Va                                231   8e-66   Gossypium arboreum [tree cotton]
ref|XP_008812670.1|  PREDICTED: myosin-1-like isoform X1                231   8e-66   Phoenix dactylifera
gb|EMS56234.1|  Myosin-2 heavy chain                                    231   8e-66   Triticum urartu
gb|KJB79819.1|  hypothetical protein B456_013G068300                    231   8e-66   Gossypium raimondii
gb|KJB79818.1|  hypothetical protein B456_013G068300                    231   9e-66   Gossypium raimondii
ref|XP_006484499.1|  PREDICTED: myosin-1-like                           231   1e-65   Citrus sinensis [apfelsine]
gb|KJB79821.1|  hypothetical protein B456_013G068300                    231   1e-65   Gossypium raimondii
ref|XP_006437635.1|  hypothetical protein CICLE_v10030552mg             231   1e-65   
gb|KJB79822.1|  hypothetical protein B456_013G068300                    231   1e-65   Gossypium raimondii
gb|KJB31872.1|  hypothetical protein B456_005G212100                    231   1e-65   Gossypium raimondii
gb|KJB31871.1|  hypothetical protein B456_005G212100                    231   1e-65   Gossypium raimondii
gb|KJB13455.1|  hypothetical protein B456_002G076300                    229   1e-65   Gossypium raimondii
gb|KJB13456.1|  hypothetical protein B456_002G076300                    230   1e-65   Gossypium raimondii
ref|XP_009351748.1|  PREDICTED: myosin-1-like isoform X1                231   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_006464672.1|  PREDICTED: myosin-2-like isoform X1                231   1e-65   Citrus sinensis [apfelsine]
gb|KJB13457.1|  hypothetical protein B456_002G076300                    231   2e-65   Gossypium raimondii
gb|KJB13453.1|  hypothetical protein B456_002G076300                    231   2e-65   Gossypium raimondii
ref|XP_010463346.1|  PREDICTED: myosin-3-like                           229   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009127101.1|  PREDICTED: myosin-2                                230   2e-65   Brassica rapa
ref|XP_008389065.1|  PREDICTED: myosin-1-like                           230   2e-65   
gb|KJB13454.1|  hypothetical protein B456_002G076300                    230   2e-65   Gossypium raimondii
gb|AAD31926.1|AF147738_1  myosin VIII ZMM3                              229   2e-65   Zea mays [maize]
ref|XP_009147843.1|  PREDICTED: myosin-3                                230   2e-65   Brassica rapa
emb|CDY22791.1|  BnaA06g02860D                                          230   2e-65   Brassica napus [oilseed rape]
ref|XP_002467046.1|  hypothetical protein SORBIDRAFT_01g018770          230   2e-65   Sorghum bicolor [broomcorn]
ref|XP_006401589.1|  hypothetical protein EUTSA_v10012475mg             230   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_009135657.1|  PREDICTED: myosin-1-like                           229   3e-65   Brassica rapa
ref|XP_006279905.1|  hypothetical protein CARUB_v10025758mg             230   3e-65   
ref|XP_004231522.1|  PREDICTED: myosin-1                                229   3e-65   Solanum lycopersicum
ref|XP_010466165.1|  PREDICTED: myosin-1                                229   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007149634.1|  hypothetical protein PHAVU_005G085900g             229   4e-65   Phaseolus vulgaris [French bean]
ref|XP_007149633.1|  hypothetical protein PHAVU_005G085900g             229   4e-65   Phaseolus vulgaris [French bean]
dbj|BAJ99526.1|  predicted protein                                      230   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010688651.1|  PREDICTED: myosin-1-like                           229   4e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN23106.1|  Unconventional myosin-Va                                228   5e-65   Glycine soja [wild soybean]
ref|XP_002310637.2|  hypothetical protein POPTR_0007s07320g             229   5e-65   
gb|KHG19058.1|  Myosin-2 heavy chain                                    228   6e-65   Gossypium arboreum [tree cotton]
ref|XP_010918414.1|  PREDICTED: myosin-1-like                           229   6e-65   Elaeis guineensis
gb|KHM99077.1|  Myosin-J heavy chain                                    229   6e-65   Glycine soja [wild soybean]
ref|XP_006605841.1|  PREDICTED: myosin-1-like isoform X3                228   7e-65   
ref|XP_011012310.1|  PREDICTED: myosin-1-like isoform X1                229   7e-65   Populus euphratica
ref|XP_011012313.1|  PREDICTED: myosin-1-like isoform X3                229   7e-65   Populus euphratica
ref|XP_004487659.1|  PREDICTED: myosin-J heavy chain-like isoform X2    228   7e-65   
ref|XP_009351750.1|  PREDICTED: myosin-1-like isoform X2                229   7e-65   Pyrus x bretschneideri [bai li]
ref|XP_010508266.1|  PREDICTED: myosin-1-like                           229   7e-65   Camelina sativa [gold-of-pleasure]
gb|KHG13556.1|  Myosin-2 heavy chain                                    228   7e-65   Gossypium arboreum [tree cotton]
ref|XP_011012312.1|  PREDICTED: myosin-1-like isoform X2                229   7e-65   Populus euphratica
ref|XP_010067014.1|  PREDICTED: myosin-1                                229   7e-65   Eucalyptus grandis [rose gum]
gb|AAB71526.1|  unconventional myosin                                   228   7e-65   Helianthus annuus
ref|XP_003589748.1|  Myosin-like protein                                230   8e-65   
ref|XP_003556592.1|  PREDICTED: myosin-1-like                           229   8e-65   Glycine max [soybeans]
ref|XP_007142759.1|  hypothetical protein PHAVU_007G014600g             225   8e-65   Phaseolus vulgaris [French bean]
ref|XP_006296853.1|  hypothetical protein CARUB_v10012840mg             229   8e-65   
ref|XP_006306608.1|  hypothetical protein CARUB_v10008120mg             229   8e-65   
emb|CDY42506.1|  BnaC06g03520D                                          228   8e-65   Brassica napus [oilseed rape]
ref|XP_010487954.1|  PREDICTED: myosin-1-like                           228   1e-64   Camelina sativa [gold-of-pleasure]
ref|NP_568806.3|  myosin 2                                              227   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487658.1|  PREDICTED: myosin-J heavy chain-like isoform X1    228   1e-64   Cicer arietinum [garbanzo]
ref|XP_010278387.1|  PREDICTED: myosin-1 isoform X3                     227   1e-64   
ref|XP_010935561.1|  PREDICTED: myosin-1-like                           228   1e-64   Elaeis guineensis
emb|CDY14319.1|  BnaA10g07360D                                          228   1e-64   Brassica napus [oilseed rape]
ref|XP_003541859.1|  PREDICTED: myosin-2-like                           228   1e-64   Glycine max [soybeans]
ref|XP_010278386.1|  PREDICTED: myosin-2 isoform X2                     227   1e-64   
ref|XP_008221075.1|  PREDICTED: myosin-1                                228   1e-64   Prunus mume [ume]
ref|XP_006589741.1|  PREDICTED: myosin-1-like isoform X2                227   1e-64   
ref|XP_006345301.1|  PREDICTED: myosin-1-like                           228   1e-64   Solanum tuberosum [potatoes]
ref|XP_006605839.1|  PREDICTED: myosin-1-like isoform X1                228   1e-64   Glycine max [soybeans]
dbj|BAB10751.1|  myosin heavy chain                                     227   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340434.1|  PREDICTED: myosin-1 isoform X2                     228   2e-64   
emb|CAA84065.1|  myosin                                                 227   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340433.1|  PREDICTED: myosin-1 isoform X1                     228   2e-64   Malus domestica [apple tree]
gb|KJB49958.1|  hypothetical protein B456_008G147000                    228   2e-64   Gossypium raimondii
ref|XP_006661886.1|  PREDICTED: myosin-1-like                           228   2e-64   Oryza brachyantha
ref|XP_010482837.1|  PREDICTED: myosin-2-like                           228   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_004958024.1|  PREDICTED: unconventional myosin-Va-like           228   2e-64   
emb|CDY52239.1|  BnaC02g44600D                                          228   2e-64   Brassica napus [oilseed rape]
ref|NP_001064913.1|  Os10g0488800                                       226   2e-64   
ref|XP_010500596.1|  PREDICTED: myosin-3                                227   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003574095.1|  PREDICTED: myosin-1-like                           228   2e-64   Brachypodium distachyon [annual false brome]
gb|EYU39409.1|  hypothetical protein MIMGU_mgv1a000419mg                227   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_006592898.1|  PREDICTED: myosin-2-like isoform X3                226   2e-64   Glycine max [soybeans]
dbj|BAF01329.1|  myosin heavy chain                                     228   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078755.1|  myosin 2                                           228   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443003.1|  PREDICTED: myosin-2                                228   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_004498109.1|  PREDICTED: myosin-J heavy chain-like               227   2e-64   Cicer arietinum [garbanzo]
ref|XP_008445889.1|  PREDICTED: myosin-1-like                           227   2e-64   Cucumis melo [Oriental melon]
ref|XP_011070461.1|  PREDICTED: myosin-1                                227   3e-64   Sesamum indicum [beniseed]
ref|XP_010446745.1|  PREDICTED: myosin-2-like                           228   3e-64   Camelina sativa [gold-of-pleasure]
gb|ABB47808.1|  Myosin head family protein, expressed                   226   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802972.1|  PREDICTED: myosin-1-like                           227   3e-64   Phoenix dactylifera
ref|XP_003562871.1|  PREDICTED: myosin-3                                227   3e-64   Brachypodium distachyon [annual false brome]
ref|XP_010278385.1|  PREDICTED: myosin-2 isoform X1                     227   4e-64   Nelumbo nucifera [Indian lotus]
gb|KHN28019.1|  Myosin-J heavy chain                                    227   4e-64   Glycine soja [wild soybean]
gb|AFW68522.1|  hypothetical protein ZEAMMB73_631881                    227   4e-64   
ref|XP_011098363.1|  PREDICTED: myosin-2-like                           227   4e-64   Sesamum indicum [beniseed]
ref|XP_004497241.1|  PREDICTED: myosin-J heavy chain-like isoform X2    226   4e-64   
gb|KHN37364.1|  Myosin-J heavy chain                                    226   5e-64   Glycine soja [wild soybean]
gb|AAQ87013.1|  myosin heavy chain class VIII A2 protein                226   5e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003592738.1|  Myosin-like protein                                226   5e-64   
ref|XP_003536741.2|  PREDICTED: myosin-1-like isoform X1                226   5e-64   Glycine max [soybeans]
ref|XP_003539582.1|  PREDICTED: myosin-2-like isoform X1                226   6e-64   Glycine max [soybeans]
ref|XP_004497240.1|  PREDICTED: myosin-J heavy chain-like isoform X1    226   6e-64   Cicer arietinum [garbanzo]
ref|NP_001059992.1|  Os07g0562800                                       226   6e-64   
emb|CBI35399.3|  unnamed protein product                                226   6e-64   Vitis vinifera
ref|XP_007225432.1|  hypothetical protein PRUPE_ppa000435mg             226   6e-64   
ref|XP_006592897.1|  PREDICTED: myosin-2-like isoform X2                226   6e-64   Glycine max [soybeans]
ref|XP_002273898.1|  PREDICTED: myosin-1                                226   7e-64   Vitis vinifera
gb|EEC82270.1|  hypothetical protein OsI_26483                          226   7e-64   Oryza sativa Indica Group [Indian rice]
emb|CDY29324.1|  BnaA05g15910D                                          226   7e-64   Brassica napus [oilseed rape]
ref|NP_175453.2|  myosin VIIIA                                          226   8e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82090.1|  hypothetical protein VITISV_032704                     226   8e-64   Vitis vinifera
dbj|BAD93813.1|  myosin                                                 226   8e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50052.1|AC007980_17  Highly similar to myosin                     226   9e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81875.1|  hypothetical protein B456_013G166000                    223   1e-63   Gossypium raimondii
ref|XP_009124542.1|  PREDICTED: myosin-3-like                           225   1e-63   Brassica rapa
gb|EMT14738.1|  Myosin-2 heavy chain                                    226   1e-63   
gb|KJB81873.1|  hypothetical protein B456_013G166000                    223   1e-63   Gossypium raimondii
gb|EEC67214.1|  hypothetical protein OsI_34110                          225   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_009119961.1|  PREDICTED: myosin-2-like                           225   1e-63   Brassica rapa
ref|XP_004982778.1|  PREDICTED: myosin-J heavy chain-like isoform X2    225   1e-63   Setaria italica
ref|XP_009589782.1|  PREDICTED: myosin-2-like isoform X3                224   1e-63   Nicotiana tomentosiformis
ref|XP_009589783.1|  PREDICTED: myosin-2-like isoform X4                224   1e-63   Nicotiana tomentosiformis
gb|AAL31066.1|AC090120_12  putative myosin                              225   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67412.1|  hypothetical protein OsJ_24744                          226   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982777.1|  PREDICTED: myosin-J heavy chain-like isoform X1    225   2e-63   
ref|XP_009589778.1|  PREDICTED: myosin-2-like isoform X1                225   2e-63   Nicotiana tomentosiformis
ref|XP_009589781.1|  PREDICTED: myosin-2-like isoform X2                225   2e-63   Nicotiana tomentosiformis
emb|CDY18321.1|  BnaC09g30710D                                          225   2e-63   Brassica napus [oilseed rape]
gb|EPS70501.1|  hypothetical protein M569_04240                         224   2e-63   Genlisea aurea
emb|CDY53932.1|  BnaCnng25790D                                          224   3e-63   Brassica napus [oilseed rape]
ref|XP_009792550.1|  PREDICTED: myosin-2-like isoform X3                223   3e-63   Nicotiana sylvestris
ref|XP_009792551.1|  PREDICTED: myosin-2-like isoform X4                223   3e-63   Nicotiana sylvestris
ref|XP_010933291.1|  PREDICTED: myosin-1-like                           224   3e-63   Elaeis guineensis
gb|KJB81876.1|  hypothetical protein B456_013G166000                    223   3e-63   Gossypium raimondii
gb|KHN46512.1|  Myosin-J heavy chain                                    223   3e-63   Glycine soja [wild soybean]
ref|XP_009622620.1|  PREDICTED: myosin-1-like                           224   3e-63   Nicotiana tomentosiformis
ref|XP_009783184.1|  PREDICTED: myosin-1-like                           224   3e-63   Nicotiana sylvestris
gb|KJB81874.1|  hypothetical protein B456_013G166000                    223   4e-63   Gossypium raimondii
ref|XP_004147135.1|  PREDICTED: myosin-1-like                           224   4e-63   Cucumis sativus [cucumbers]
ref|XP_007212835.1|  hypothetical protein PRUPE_ppa020758mg             224   4e-63   
emb|CDY28777.1|  BnaA02g09690D                                          224   4e-63   Brassica napus [oilseed rape]
ref|XP_009792549.1|  PREDICTED: myosin-2-like isoform X2                224   4e-63   Nicotiana sylvestris
ref|XP_009792547.1|  PREDICTED: myosin-2-like isoform X1                224   4e-63   Nicotiana sylvestris
ref|XP_010694426.1|  PREDICTED: myosin-2 isoform X1                     224   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694427.1|  PREDICTED: myosin-2 isoform X2                     224   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007142760.1|  hypothetical protein PHAVU_007G014600g             224   5e-63   Phaseolus vulgaris [French bean]
ref|XP_007153036.1|  hypothetical protein PHAVU_003G002200g             224   5e-63   Phaseolus vulgaris [French bean]
ref|XP_009105704.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-4-like      220   6e-63   
ref|XP_003533701.1|  PREDICTED: myosin-1-like isoform X1                223   8e-63   
gb|EPS68761.1|  hypothetical protein M569_06006                         222   9e-63   Genlisea aurea
ref|XP_010520892.1|  PREDICTED: myosin-2-like                           223   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_002866036.1|  predicted protein                                  223   1e-62   
gb|KDP38945.1|  hypothetical protein JCGZ_00702                         219   2e-62   Jatropha curcas
ref|XP_010523208.1|  PREDICTED: myosin-1-like                           222   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_006370337.1|  hypothetical protein POPTR_0001s41770g             221   4e-62   
ref|XP_011044539.1|  PREDICTED: myosin-2                                221   4e-62   Populus euphratica
ref|XP_002463024.1|  hypothetical protein SORBIDRAFT_02g036390          221   4e-62   
ref|XP_009334587.1|  PREDICTED: myosin-2 isoform X4                     219   4e-62   Pyrus x bretschneideri [bai li]
gb|EMT12170.1|  Myosin-J heavy chain                                    221   5e-62   
gb|ABJ53200.1|  myosin VIII-1                                           221   6e-62   Nicotiana benthamiana
gb|KJB62696.1|  hypothetical protein B456_009G430900                    221   6e-62   Gossypium raimondii
ref|XP_009334586.1|  PREDICTED: myosin-2 isoform X3                     220   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_008671324.1|  PREDICTED: uncharacterized protein LOC103648678    218   6e-62   
ref|XP_009334584.1|  PREDICTED: myosin-2 isoform X1                     220   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_009334585.1|  PREDICTED: myosin-2 isoform X2                     220   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_009143365.1|  PREDICTED: myosin-4                                220   7e-62   Brassica rapa
ref|XP_010324345.1|  PREDICTED: myosin-2-like isoform X3                219   9e-62   Solanum lycopersicum
ref|XP_008226710.1|  PREDICTED: myosin-2 isoform X1                     220   9e-62   Prunus mume [ume]
ref|XP_010324344.1|  PREDICTED: myosin-2-like isoform X2                220   1e-61   Solanum lycopersicum
ref|XP_010324342.1|  PREDICTED: myosin-2-like isoform X1                220   1e-61   Solanum lycopersicum
ref|XP_004294488.1|  PREDICTED: myosin-2                                219   2e-61   Fragaria vesca subsp. vesca
ref|XP_008226711.1|  PREDICTED: myosin-2 isoform X2                     218   2e-61   Prunus mume [ume]
ref|XP_012070658.1|  PREDICTED: myosin-2                                219   2e-61   Jatropha curcas
gb|EMS67686.1|  Myosin-J heavy chain                                    219   2e-61   Triticum urartu
ref|XP_006657835.1|  PREDICTED: myosin-2-like                           219   3e-61   Oryza brachyantha
ref|XP_009412435.1|  PREDICTED: myosin-1-like                           218   7e-61   
ref|XP_010536993.1|  PREDICTED: myosin-2-like isoform X1                216   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_003541108.1|  PREDICTED: myosin-2-like                           214   9e-60   Glycine max [soybeans]
ref|XP_010536994.1|  PREDICTED: myosin-2-like isoform X2                214   9e-60   Tarenaya hassleriana [spider flower]
ref|XP_009342451.1|  PREDICTED: myosin-2 isoform X3                     213   1e-59   
ref|XP_009342453.1|  PREDICTED: myosin-2 isoform X4                     212   1e-59   
ref|XP_009342454.1|  PREDICTED: myosin-2 isoform X5                     214   1e-59   
ref|XP_009342449.1|  PREDICTED: myosin-2 isoform X1                     213   1e-59   
ref|XP_009342450.1|  PREDICTED: myosin-2 isoform X2                     213   1e-59   
ref|XP_011029402.1|  PREDICTED: myosin-2-like                           214   1e-59   Populus euphratica
gb|KEH19592.1|  P-loop nucleoside triphosphate hydrolase superfam...    213   2e-59   Medicago truncatula
ref|XP_008345270.1|  PREDICTED: myosin-2-like isoform X2                213   2e-59   Malus domestica [apple tree]
ref|XP_004510018.1|  PREDICTED: unconventional myosin-Va-like           213   3e-59   
ref|XP_008345272.1|  PREDICTED: myosin-2-like isoform X4                212   3e-59   
ref|XP_008345269.1|  PREDICTED: myosin-2-like isoform X1                213   3e-59   
ref|XP_008345271.1|  PREDICTED: myosin-2-like isoform X3                213   3e-59   
ref|XP_008366431.1|  PREDICTED: myosin-2 isoform X4                     211   3e-59   
gb|ABJ53201.1|  myosin VIII-2                                           213   5e-59   
ref|XP_008366419.1|  PREDICTED: myosin-2 isoform X2                     212   5e-59   
ref|XP_008366413.1|  PREDICTED: myosin-2 isoform X1                     212   5e-59   
ref|XP_008366425.1|  PREDICTED: myosin-2 isoform X3                     212   5e-59   
ref|XP_002316933.2|  hypothetical protein POPTR_0011s12670g             211   1e-58   
gb|EYU33558.1|  hypothetical protein MIMGU_mgv1a000433mg                210   3e-58   
ref|XP_007133144.1|  hypothetical protein PHAVU_011G155300g             210   3e-58   
gb|AAG49341.1|  myosin subfamily VIII heavy chain                       210   4e-58   
ref|XP_006413084.1|  hypothetical protein EUTSA_v10024254mg             209   4e-58   
tpg|DAA63129.1|  TPA: hypothetical protein ZEAMMB73_109792              209   6e-58   
ref|XP_008654108.1|  PREDICTED: myosin-1-like                           209   6e-58   
gb|KFK29251.1|  hypothetical protein AALP_AA7G109000                    208   8e-58   
gb|KFK29252.1|  hypothetical protein AALP_AA7G109000                    208   9e-58   
gb|AES66739.2|  P-loop nucleoside triphosphate hydrolase superfam...    209   9e-58   
ref|XP_008454630.1|  PREDICTED: myosin-2-like                           209   1e-57   
ref|XP_004146844.1|  PREDICTED: myosin-2                                208   1e-57   
ref|XP_003596488.1|  Myosin-like protein                                208   2e-57   
ref|XP_010448147.1|  PREDICTED: myosin-4-like                           206   6e-57   
ref|XP_006283030.1|  hypothetical protein CARUB_v10004022mg             206   7e-57   
ref|XP_006362936.1|  PREDICTED: myosin-2-like isoform X3                205   1e-56   
ref|XP_006362935.1|  PREDICTED: myosin-2-like isoform X2                206   1e-56   
ref|XP_006362934.1|  PREDICTED: myosin-2-like isoform X1                206   1e-56   
dbj|BAL60532.2|  myosin VIII                                            205   3e-56   
ref|XP_010438625.1|  PREDICTED: myosin-4-like                           204   4e-56   
gb|KHN46956.1|  Myosin-J heavy chain                                    203   8e-56   
ref|XP_002867507.1|  hypothetical protein ARALYDRAFT_492062             203   8e-56   
emb|CAB81387.1|  myosin heavy chain-like protein                        201   1e-55   
ref|NP_194467.5|  myosin heavy chain-like protein                       202   2e-55   
emb|CAA19731.1|  myosin heavy chain-like protein                        202   2e-55   
ref|XP_006582193.1|  PREDICTED: myosin-2-like isoform X2                201   4e-55   
ref|XP_003526112.1|  PREDICTED: myosin-2-like isoform X1                201   4e-55   
ref|XP_010101784.1|  Myosin-2 heavy chain                               200   1e-54   
ref|XP_010327149.1|  PREDICTED: myosin-2-like isoform X4                197   6e-54   
ref|XP_010327148.1|  PREDICTED: myosin-2-like isoform X3                197   6e-54   
ref|XP_010327147.1|  PREDICTED: myosin-2-like isoform X2                198   6e-54   
ref|XP_004248278.1|  PREDICTED: myosin-2-like isoform X1                198   7e-54   
ref|XP_001755337.1|  predicted protein                                  191   2e-51   
gb|ACN26349.1|  unknown                                                 182   1e-50   
gb|AEM05968.1|  myosin VIII D                                           187   6e-50   
ref|XP_001777862.1|  predicted protein                                  184   3e-49   
gb|AEM05967.1|  myosin VIII B                                           180   2e-47   
gb|KHG28219.1|  Myosin-J heavy chain                                    178   3e-47   
ref|XP_001768683.1|  predicted protein                                  178   3e-47   
ref|XP_001775964.1|  predicted protein                                  176   3e-46   
ref|XP_002975651.1|  hypothetical protein SELMODRAFT_103418             175   5e-46   
ref|XP_002978834.1|  hypothetical protein SELMODRAFT_109322             175   6e-46   
ref|XP_001774306.1|  predicted protein                                  172   5e-45   
gb|AEM05969.1|  myosin VIII E                                           172   7e-45   
ref|NP_001154628.2|  myosin 1                                           172   8e-45   
emb|CDY36068.1|  BnaC03g41300D                                          170   3e-44   
gb|EPS70842.1|  hypothetical protein M569_03917                         169   4e-44   
tpg|DAA39644.1|  TPA: hypothetical protein ZEAMMB73_370141              154   2e-39   
ref|XP_002993349.1|  hypothetical protein SELMODRAFT_137032             153   3e-38   
ref|XP_002972734.1|  hypothetical protein SELMODRAFT_98074              153   3e-38   
gb|EPS65807.1|  hypothetical protein M569_08970                         148   1e-36   
gb|AAB93521.1|  unconventional myosin                                   145   8e-36   
ref|XP_003057663.1|  predicted protein                                  134   8e-32   
ref|XP_005651048.1|  hypothetical protein COCSUDRAFT_64521              127   4e-29   
emb|CAE54277.1|  putative myosin heavy chain class VIII A1 protein      116   3e-28   
ref|XP_011271752.1|  Myosin-7                                           123   7e-28   
ref|XP_002501869.1|  predicted protein                                  122   1e-27   
dbj|BAJ94273.1|  predicted protein                                      123   1e-27   
gb|EMT12962.1|  Myosin-J heavy chain                                    122   2e-27   
ref|XP_002173636.1|  myosin type-2 heavy chain 2                        121   3e-27   
gb|EMS63508.1|  Myosin-J heavy chain                                    121   4e-27   
gb|ACF17814.1|  truncated myosin II cysteine-lite mutant                119   7e-27   
gb|EEE50777.1|  hypothetical protein OsJ_31135                          120   7e-27   
ref|XP_004983116.1|  PREDICTED: myosin-J heavy chain-like isoform X2    120   7e-27   
ref|XP_004983115.1|  PREDICTED: myosin-J heavy chain-like isoform X1    120   8e-27   
ref|XP_006648000.1|  PREDICTED: myosin-15-like                          120   1e-26   
ref|XP_004954102.1|  PREDICTED: myosin-H heavy chain-like isoform X2    119   1e-26   
emb|CDY24585.1|  BnaC05g32690D                                          112   1e-26   
ref|XP_427876.4|  PREDICTED: unconventional myosin-Vb isoform X2        119   1e-26   
ref|XP_004954101.1|  PREDICTED: myosin-H heavy chain-like isoform X1    119   1e-26   
gb|KFP42881.1|  Unconventional myosin-Vb                                118   2e-26   
dbj|BAD16972.1|  putative myosin heavy chain                            119   2e-26   
gb|EEE57903.1|  hypothetical protein OsJ_08588                          119   2e-26   
pdb|1YV3|A  Chain A, The Structural Basis Of Blebbistatin Inhibit...    118   2e-26   
pdb|3MYH|X  Chain X, Insights Into The Importance Of Hydrogen Bon...    118   2e-26   
pdb|3MNQ|A  Chain A, Crystal Structure Of Myosin-2 Motor Domain I...    118   2e-26   
pdb|1MMD|A  Chain A, Truncated Head Of Myosin From Dictyostelium ...    118   2e-26   
gb|EEC74103.1|  hypothetical protein OsI_09152                          119   2e-26   
pdb|2JHR|A  Chain A, Crystal Structure Of Myosin-2 Motor Domain I...    118   2e-26   
pdb|1W9L|A  Chain A, Myosin Ii Dictyostelium Discoideum Motor Dom...    118   2e-26   
pdb|1D0X|A  Chain A, Dictyostelium Myosin S1dc (Motor Domain Frag...    118   2e-26   
pdb|2XEL|A  Chain A, Molecular Mechanism Of Pentachloropseudilin ...    118   2e-26   
pdb|2XO8|A  Chain A, Crystal Structure Of Myosin-2 In Complex Wit...    118   2e-26   
pdb|1W9J|A  Chain A, Myosin Ii Dictyostelium Discoideum Motor Dom...    118   2e-26   
ref|NP_001048291.2|  Os02g0777700                                       119   2e-26   
pdb|1FMV|A  Chain A, Crystal Structure Of The Apo Motor Domain Of...    118   3e-26   
pdb|2AKA|A  Chain A, Structure Of The Nucleotide-Free Myosin Ii M...    118   3e-26   
pdb|1JWY|A  Chain A, Crystal Structure Of The Dynamin A Gtpase Do...    118   3e-26   
pdb|1G8X|A  Chain A, Structure Of A Genetically Engineered Molecu...    118   3e-26   
ref|XP_002452906.1|  hypothetical protein SORBIDRAFT_04g034830          118   3e-26   
gb|AFW64277.1|  hypothetical protein ZEAMMB73_923224                    118   3e-26   
ref|XP_008679264.1|  PREDICTED: myosin-15                               118   3e-26   
ref|XP_004948778.1|  PREDICTED: unconventional myosin-Vb isoform X3     118   4e-26   
gb|ESW97231.1|  Type II myosin heavy chain, required for wild-typ...    118   5e-26   
ref|XP_010236041.1|  PREDICTED: myosin-15                               117   7e-26   
pdb|1W9K|A  Chain A, Dictyostelium Discoideum Myosin Ii Motor Dom...    116   8e-26   
pdb|1W9I|A  Chain A, Myosin Ii Dictyostelium Discoideum Motor Dom...    116   8e-26   
gb|AAM22736.1|AC092388_20  putative myosin heavy chain                  117   8e-26   
pdb|1MMA|A  Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, ...    116   9e-26   
ref|XP_010723121.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    117   1e-25   
ref|XP_003685758.1|  hypothetical protein TPHA_0E02320                  117   1e-25   
ref|XP_009872790.1|  PREDICTED: unconventional myosin-Vb-like           115   1e-25   
gb|EEC66759.1|  hypothetical protein OsI_33135                          117   1e-25   
gb|AAK98715.1|AC090483_5  Putative myosin heavy chain                   117   1e-25   
pdb|1MMG|A  Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, ...    115   1e-25   
ref|XP_006661742.1|  PREDICTED: myosin-15-like                          117   1e-25   
ref|XP_001644234.1|  hypothetical protein Kpol_1051p25                  117   1e-25   
pdb|2Y0R|X  Chain X, Structural Basis For The Allosteric Interfer...    115   1e-25   
gb|KFV81357.1|  Unconventional myosin-Vb                                115   2e-25   
ref|XP_002493055.1|  Type II myosin heavy chain, required for wil...    115   3e-25   
ref|XP_009101754.1|  PREDICTED: myosin-6                                115   3e-25   
emb|CDY22325.1|  BnaA06g36470D                                          115   3e-25   
ref|XP_009944871.1|  PREDICTED: unconventional myosin-Vb-like           112   3e-25   
emb|CCA39331.1|  Myosin-10, non-muscle IIb;, type B                     115   3e-25   
ref|XP_010120639.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    115   4e-25   
pdb|1LVK|A  Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3...    114   4e-25   
emb|CDX94736.1|  BnaC07g17450D                                          115   4e-25   
gb|EFA84750.1|  myosin II heavy chain                                   115   5e-25   
gb|KCW83114.1|  hypothetical protein EUGRSUZ_B000724                    112   5e-25   
pdb|2Y9E|X  Chain X, Structural Basis For The Allosteric Interfer...    114   5e-25   
ref|XP_008868631.1|  hypothetical protein H310_05644                    114   6e-25   
gb|KFO11904.1|  Unconventional myosin-Vb                                114   7e-25   
ref|XP_008644868.1|  PREDICTED: myosin-15-like isoform X4               114   7e-25   
ref|XP_006403166.1|  hypothetical protein EUTSA_v10003130mg             114   7e-25   
ref|XP_008644865.1|  PREDICTED: myosin-15-like isoform X1               114   7e-25   
ref|XP_004755465.1|  PREDICTED: unconventional myosin-Vc                114   7e-25   
ref|XP_008644866.1|  PREDICTED: myosin-15-like isoform X2               114   7e-25   
ref|XP_008644867.1|  PREDICTED: myosin-15-like isoform X3               114   8e-25   
pdb|1MMN|A  Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, ...    113   8e-25   
ref|XP_007081951.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    114   8e-25   
ref|XP_637740.1|  myosin II heavy chain                                 114   9e-25   
gb|AAA33227.1|  myosin heavy chain                                      114   9e-25   
gb|KFV13425.1|  Unconventional myosin-Vb                                113   1e-24   
gb|KFV97035.1|  Unconventional myosin-Va                                113   1e-24   
ref|XP_006208395.1|  PREDICTED: unconventional myosin-Vc                114   1e-24   
ref|XP_004835439.1|  PREDICTED: unconventional myosin-Va isoform X2     114   1e-24   
gb|EHB18142.1|  Myosin-Va                                               114   1e-24   
ref|XP_004835438.1|  PREDICTED: unconventional myosin-Va isoform X1     114   1e-24   
ref|XP_004835440.1|  PREDICTED: unconventional myosin-Va isoform X3     114   1e-24   
ref|XP_009673325.1|  PREDICTED: unconventional myosin-Vb-like           114   1e-24   
ref|XP_004835441.1|  PREDICTED: unconventional myosin-Va isoform X4     114   1e-24   
ref|XP_005844313.1|  hypothetical protein CHLNCDRAFT_26915              113   1e-24   
ref|XP_003289465.1|  myosin II heavy chain                              114   1e-24   
gb|KFV52590.1|  Unconventional myosin-Va                                112   1e-24   
ref|XP_004908733.1|  PREDICTED: unconventional myosin-Va                114   1e-24   
ref|XP_008704283.1|  PREDICTED: unconventional myosin-Vc                114   1e-24   
ref|XP_009248123.1|  PREDICTED: unconventional myosin-Vc                114   1e-24   
ref|XP_008197063.1|  PREDICTED: unconventional myosin-XV                114   1e-24   
gb|EFA08775.1|  hypothetical protein TcasGA2_TC006465                   114   2e-24   
gb|EFA75546.1|  class VII unconventional myosin                         114   2e-24   
ref|XP_011281305.1|  PREDICTED: unconventional myosin-Vc                114   2e-24   
ref|XP_008118743.1|  PREDICTED: unconventional myosin-Va                113   2e-24   
gb|KFP55500.1|  Unconventional myosin-Va                                112   2e-24   
ref|XP_007480032.1|  PREDICTED: unconventional myosin-Va isoform X1     113   2e-24   
ref|XP_007480034.1|  PREDICTED: unconventional myosin-Va isoform X3     113   2e-24   
ref|XP_006733377.1|  PREDICTED: unconventional myosin-Vc                113   2e-24   
ref|XP_007480033.1|  PREDICTED: unconventional myosin-Va isoform X2     113   2e-24   
emb|CCE41378.1|  hypothetical protein CPAR2_303670                      113   2e-24   
ref|XP_007480035.1|  PREDICTED: unconventional myosin-Va isoform X4     113   2e-24   
gb|KFQ62191.1|  Unconventional myosin-Va                                112   2e-24   
gb|KFQ75959.1|  Unconventional myosin-Va                                112   2e-24   
gb|KFP29451.1|  Unconventional myosin-Va                                112   2e-24   
gb|KFZ57317.1|  Unconventional myosin-Va                                112   2e-24   
gb|KFP53066.1|  Unconventional myosin-Va                                112   2e-24   
ref|XP_004639105.1|  PREDICTED: unconventional myosin-Va                113   2e-24   
emb|CCJ31284.1|  unnamed protein product                                112   2e-24   
gb|KFO99514.1|  Unconventional myosin-Va                                112   2e-24   
ref|XP_006194965.1|  PREDICTED: unconventional myosin-Va isoform X3     113   2e-24   
ref|XP_010975467.1|  PREDICTED: unconventional myosin-Vc                113   2e-24   
ref|XP_010967830.1|  PREDICTED: unconventional myosin-Vc                113   2e-24   
ref|XP_006194963.1|  PREDICTED: unconventional myosin-Va isoform X1     113   2e-24   
gb|EPY73095.1|  myosin-Vc                                               113   3e-24   
ref|XP_006194964.1|  PREDICTED: unconventional myosin-Va isoform X2     113   3e-24   
ref|XP_006194966.1|  PREDICTED: unconventional myosin-Vc                113   3e-24   
ref|XP_003471832.1|  PREDICTED: unconventional myosin-Vc                113   3e-24   
gb|KFR02681.1|  Unconventional myosin-Va                                112   3e-24   
gb|KGL93889.1|  Unconventional myosin-Va                                112   3e-24   
gb|KFV07597.1|  Unconventional myosin-Va                                112   3e-24   
ref|XP_010441964.1|  PREDICTED: myosin-6 isoform X1                     112   3e-24   
gb|KFZ49710.1|  Unconventional myosin-Va                                112   3e-24   
gb|KFQ72178.1|  Unconventional myosin-Vb                                111   3e-24   
gb|EIF49478.1|  type ii myosin heavy required for wild-type cytok...    112   3e-24   
ref|XP_011281306.1|  PREDICTED: unconventional myosin-Va                112   3e-24   
ref|XP_011228884.1|  PREDICTED: unconventional myosin-Vc                112   3e-24   
ref|XP_005377197.1|  PREDICTED: unconventional myosin-Vc                112   3e-24   
gb|KFW72029.1|  Unconventional myosin-Va                                112   3e-24   
ref|XP_011228885.1|  PREDICTED: unconventional myosin-Va                112   3e-24   
gb|EFB21521.1|  hypothetical protein PANDA_013117                       112   3e-24   
gb|KFO21417.1|  Myosin-Vc                                               112   3e-24   
gb|KFV46040.1|  Unconventional myosin-Va                                112   4e-24   
gb|KFM05625.1|  Unconventional myosin-Va                                112   4e-24   
ref|XP_007081952.1|  PREDICTED: unconventional myosin-Va                112   4e-24   
ref|XP_006070173.1|  PREDICTED: unconventional myosin-Va                112   4e-24   
ref|XP_003756003.1|  PREDICTED: unconventional myosin-Va                112   4e-24   
ref|XP_010598393.1|  PREDICTED: unconventional myosin-Va isoform X5     112   4e-24   
ref|XP_010481806.1|  PREDICTED: myosin-6-like isoform X1                112   4e-24   
ref|XP_004908710.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    112   4e-24   
ref|XP_010607376.1|  PREDICTED: unconventional myosin-Va isoform X7     112   4e-24   
ref|XP_005992032.1|  PREDICTED: unconventional myosin-Vb-like           112   4e-24   
gb|KFQ47252.1|  Unconventional myosin-Va                                112   4e-24   
ref|XP_010607374.1|  PREDICTED: unconventional myosin-Va isoform X5     112   4e-24   
ref|XP_010607373.1|  PREDICTED: unconventional myosin-Va isoform X4     112   4e-24   
ref|XP_010598389.1|  PREDICTED: unconventional myosin-Va isoform X2     112   4e-24   
gb|KFU87253.1|  Unconventional myosin-Va                                111   4e-24   
ref|XP_010598391.1|  PREDICTED: unconventional myosin-Va isoform X4     112   4e-24   
ref|XP_010598396.1|  PREDICTED: unconventional myosin-Va isoform X8     112   4e-24   
ref|XP_010598390.1|  PREDICTED: unconventional myosin-Va isoform X3     112   4e-24   
ref|XP_010598388.1|  PREDICTED: unconventional myosin-Va isoform X1     112   4e-24   
ref|XP_010607370.1|  PREDICTED: unconventional myosin-Va isoform X1     112   4e-24   
ref|XP_010598395.1|  PREDICTED: unconventional myosin-Va isoform X7     112   4e-24   
ref|XP_006208394.1|  PREDICTED: LOW QUALITY PROTEIN: unconvention...    112   4e-24   
ref|XP_008644506.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-12          112   4e-24   
gb|KFQ10584.1|  Unconventional myosin-Va                                111   4e-24   



>ref|XP_002281748.1| PREDICTED: myosin-2 [Vitis vinifera]
Length=1229

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILLDGLYPQKQSV  202
            YD +GF EKNRD LHSD IQLLSSCS +LP+LFA++LLD SQK +SP+ L     QKQSV
Sbjct  700  YDTSGFLEKNRDPLHSDSIQLLSSCSCKLPQLFASNLLDHSQKQASPLSLGAFDSQKQSV  759

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LMQQL+NT+PHFI CIKPN+KQLPG++EK+LVL+QLR  GV E VRISRS
Sbjct  760  GTKFKDQLFKLMQQLENTSPHFIHCIKPNDKQLPGMYEKDLVLEQLRCCGVLEVVRISRS  819

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ FA +YGFLL  +N ++DPLS  V+VL+QFN+LP+LYQVGYTKLY R GQ+
Sbjct  820  GYPTRMTHQEFARRYGFLLPKDNEYQDPLSISVSVLQQFNILPDLYQVGYTKLYFRTGQI  879

Query  560  SNELWSM  580
             +EL  M
Sbjct  880  -DELEDM  885



>emb|CBI20376.3| unnamed protein product [Vitis vinifera]
Length=1197

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILLDGLYPQKQSV  202
            YD +GF EKNRD LHSD IQLLSSCS +LP+LFA++LLD SQK +SP+ L     QKQSV
Sbjct  668  YDTSGFLEKNRDPLHSDSIQLLSSCSCKLPQLFASNLLDHSQKQASPLSLGAFDSQKQSV  727

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LMQQL+NT+PHFI CIKPN+KQLPG++EK+LVL+QLR  GV E VRISRS
Sbjct  728  GTKFKDQLFKLMQQLENTSPHFIHCIKPNDKQLPGMYEKDLVLEQLRCCGVLEVVRISRS  787

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ FA +YGFLL  +N ++DPLS  V+VL+QFN+LP+LYQVGYTKLY R GQ+
Sbjct  788  GYPTRMTHQEFARRYGFLLPKDNEYQDPLSISVSVLQQFNILPDLYQVGYTKLYFRTGQI  847

Query  560  SNELWSM  580
             +EL  M
Sbjct  848  -DELEDM  853



>ref|XP_010062907.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 ref|XP_010062908.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 gb|KCW70053.1| hypothetical protein EUGRSUZ_F03356 [Eucalyptus grandis]
Length=1222

 Score =   252 bits (643),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS-SPILLDGLYPQKQSV  202
            YD +GF EKNRD L SD ++LLSSCS +LP LFA+ +L+QS KS SP+    +  QKQSV
Sbjct  692  YDTSGFLEKNRDPLPSDSVELLSSCSCQLPHLFASRVLEQSTKSASPLNHGAMESQKQSV  751

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK Q+F+LM QL+ T PHFI CIKPNNKQ+PG++EK+LVLQQLR  GV E VRISR+
Sbjct  752  GTKFKGQVFKLMHQLERTKPHFIRCIKPNNKQVPGLYEKDLVLQQLRCCGVLEVVRISRA  811

Query  383  GYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ FA++YGF LLD +V RDPLS  VAVL+QFNVLPE+YQVGYTKLYLR GQ+
Sbjct  812  GYPTRMTHQEFAERYGFLLLDTSVSRDPLSVSVAVLQQFNVLPEMYQVGYTKLYLRTGQI  871

Query  560  S  562
            +
Sbjct  872  A  872



>ref|XP_006841789.2| PREDICTED: myosin-1 [Amborella trichopoda]
Length=1236

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILL-DGLYPQKQS  199
            YD  GF EKNRD+LH D IQLLSSC+ +LP+ FA+++L+ SQK  SP+    G   QKQS
Sbjct  709  YDTTGFLEKNRDLLHCDSIQLLSSCNCQLPQKFASTMLNHSQKLVSPLWRHGGADSQKQS  768

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQ+L+NTTPHFI CIKPN+KQLPG +EK+LVLQQLR  GV E VRISR
Sbjct  769  VGTKFKGQLFKLMQRLENTTPHFIRCIKPNSKQLPGAYEKDLVLQQLRCCGVLEVVRISR  828

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTH +FA +YGFLL  NV  +DPLS  VA+L+QFN+LP++YQVGYTKL+ R GQ
Sbjct  829  SGYPTRMTHHHFARRYGFLLSENVTSQDPLSVSVAILQQFNILPDMYQVGYTKLFFRTGQ  888

Query  557  VS  562
            + 
Sbjct  889  IG  890



>gb|ERN03464.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
Length=1232

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILL-DGLYPQKQS  199
            YD  GF EKNRD+LH D IQLLSSC+ +LP+ FA+++L+ SQK  SP+    G   QKQS
Sbjct  705  YDTTGFLEKNRDLLHCDSIQLLSSCNCQLPQKFASTMLNHSQKLVSPLWRHGGADSQKQS  764

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQ+L+NTTPHFI CIKPN+KQLPG +EK+LVLQQLR  GV E VRISR
Sbjct  765  VGTKFKGQLFKLMQRLENTTPHFIRCIKPNSKQLPGAYEKDLVLQQLRCCGVLEVVRISR  824

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTH +FA +YGFLL  NV  +DPLS  VA+L+QFN+LP++YQVGYTKL+ R GQ
Sbjct  825  SGYPTRMTHHHFARRYGFLLSENVTSQDPLSVSVAILQQFNILPDMYQVGYTKLFFRTGQ  884

Query  557  VS  562
            + 
Sbjct  885  IG  886



>gb|ERN09379.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
Length=1164

 Score =   243 bits (619),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 147/182 (81%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQS  199
            Y+ +GF EKNRD+LHSD IQLLSSC  +LP++FA ++L+QS+KSS  L    G+  Q+QS
Sbjct  658  YNTSGFLEKNRDLLHSDSIQLLSSCRYKLPQVFAANMLNQSEKSSGQLWRSTGVDLQRQS  717

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQ+L++TTPHFI CIKPNN QLPG++E+ LVLQQL+  GV E VRISR
Sbjct  718  VATKFKGQLFRLMQRLESTTPHFIRCIKPNNMQLPGIYEQGLVLQQLKCCGVLEVVRISR  777

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTHQ FA +YGFLL  +V  RDPLS  VA+L QFN+LP++YQVGYTKL+ R GQ
Sbjct  778  SGYPTRMTHQKFARRYGFLLLEDVASRDPLSVSVAILHQFNILPDMYQVGYTKLFFRTGQ  837

Query  557  VS  562
            + 
Sbjct  838  IG  839



>ref|XP_006847798.2| PREDICTED: myosin-1 [Amborella trichopoda]
Length=1169

 Score =   243 bits (620),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 147/182 (81%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQS  199
            Y+ +GF EKNRD+LHSD IQLLSSC  +LP++FA ++L+QS+KSS  L    G+  Q+QS
Sbjct  663  YNTSGFLEKNRDLLHSDSIQLLSSCRYKLPQVFAANMLNQSEKSSGQLWRSTGVDLQRQS  722

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQ+L++TTPHFI CIKPNN QLPG++E+ LVLQQL+  GV E VRISR
Sbjct  723  VATKFKGQLFRLMQRLESTTPHFIRCIKPNNMQLPGIYEQGLVLQQLKCCGVLEVVRISR  782

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTHQ FA +YGFLL  +V  RDPLS  VA+L QFN+LP++YQVGYTKL+ R GQ
Sbjct  783  SGYPTRMTHQKFARRYGFLLLEDVASRDPLSVSVAILHQFNILPDMYQVGYTKLFFRTGQ  842

Query  557  VS  562
            + 
Sbjct  843  IG  844



>emb|CDP05853.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   241 bits (614),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 121/181 (67%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS-SPILLDG-LYPQKQS  199
            YD NGF EKNRD +HSD IQLL+SCS  L KLFA+S+L+   K+ SP+   G L  QKQS
Sbjct  380  YDTNGFLEKNRDPIHSDTIQLLASCSRHLSKLFASSVLNVLPKTASPLEQSGALGSQKQS  439

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQQL+NTTPHFI CIKPNNKQLPG+++K+LVL QLR  GV E VRISR
Sbjct  440  VGTKFKGQLFKLMQQLENTTPHFIRCIKPNNKQLPGIYDKDLVLDQLRCCGVLEVVRISR  499

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT++THQ F+ +YGF LL+++  +DPLS+ VA+L+QF VLPE+YQVGYTKL+ RAGQ
Sbjct  500  SGYPTRITHQDFSRRYGFLLLEDSESQDPLSSSVAILQQFGVLPEMYQVGYTKLFFRAGQ  559

Query  557  V  559
            +
Sbjct  560  I  560



>ref|XP_009773272.1| PREDICTED: myosin-2-like isoform X3 [Nicotiana sylvestris]
Length=979

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS + +LP+LFA+ S  + ++ SSP    G+   QKQ
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSNGQLPQLFASVSANEDTEFSSPSTYTGVPDFQKQ  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQQL+NTTPHFICCIKPNNKQ+PG+ +K+L++QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQQLENTTPHFICCIKPNNKQVPGMCDKDLIVQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  V++L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVSILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>ref|XP_009773270.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1157

 Score =   241 bits (616),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS + +LP+LFA+ S  + ++ SSP    G+   QKQ
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSNGQLPQLFASVSANEDTEFSSPSTYTGVPDFQKQ  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQQL+NTTPHFICCIKPNNKQ+PG+ +K+L++QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQQLENTTPHFICCIKPNNKQVPGMCDKDLIVQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  V++L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVSILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Erythranthe guttata]
Length=1199

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD   F EKNRD+LHS+IIQLLSSC+++L +LFA S+L Q QK  SSPI +     QKQS
Sbjct  688  YDTGEFLEKNRDLLHSEIIQLLSSCTSQLSQLFA-SMLKQPQKPASSPIQVGMPACQKQS  746

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQQL++TTPHFI CIKPNNK +PG+F+K LVL+QLR  GV E VRI+R
Sbjct  747  VATKFKDQLFKLMQQLESTTPHFIRCIKPNNKHIPGMFDKNLVLEQLRCCGVLEVVRIAR  806

Query  380  SGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTHQ F  +YGFLL +N+  +DPLST VA+L+QF++LPE+YQVGYTKLY R GQ
Sbjct  807  SGYPTRMTHQEFTRRYGFLLPENHTCQDPLSTSVAILQQFDILPEMYQVGYTKLYFRTGQ  866

Query  557  VSN  565
            + +
Sbjct  867  IGS  869



>ref|XP_009773271.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1156

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS + +LP+LFA+ S  + ++ SSP    G+   QKQ
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSNGQLPQLFASVSANEDTEFSSPSTYTGVPDFQKQ  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQQL+NTTPHFICCIKPNNKQ+PG+ +K+L++QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQQLENTTPHFICCIKPNNKQVPGMCDKDLIVQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  V++L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVSILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>ref|XP_009603977.1| PREDICTED: myosin-2-like isoform X3 [Nicotiana tomentosiformis]
Length=979

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS   +LP+LFA+ S  + ++ SSP    G+   QK 
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSGGQLPRLFASISANEDTEFSSPSTYTGVPDFQKH  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQ L+NTTPHFICCIKPNNKQ+PG+ +K+LV+QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQHLENTTPHFICCIKPNNKQVPGMCDKDLVIQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  VA+L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVAILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>ref|XP_008805849.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1167

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS-SPIL-LDGLYPQKQS  199
            Y+ NGF EKN D LHSD IQLL SC+ +LP+L A  LL+QSQ   SP+  L  +  QKQS
Sbjct  696  YETNGFLEKNGDPLHSDSIQLLLSCNCQLPQLLAAHLLNQSQNPVSPLRRLGSVESQKQS  755

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V  KFK QLF+LMQ+L+ TTPHFI CIKPNNKQLPG++E +LVLQQLR  GV E VRISR
Sbjct  756  VAIKFKGQLFKLMQRLERTTPHFIRCIKPNNKQLPGIYENDLVLQQLRCCGVLEVVRISR  815

Query  380  SGYPTKMTHQYFADKYGFLLDNNV-FRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYP++MTHQ FA++YGFLL  +V F+DPL   VA+L+QFN+LPE+YQVGYTKL+ RAGQ
Sbjct  816  SGYPSRMTHQQFAERYGFLLLEDVQFQDPLGVSVAILQQFNILPEMYQVGYTKLFFRAGQ  875

Query  557  VSN  565
            +++
Sbjct  876  IAS  878



>ref|XP_009603974.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1158

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS   +LP+LFA+ S  + ++ SSP    G+   QK 
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSGGQLPRLFASISANEDTEFSSPSTYTGVPDFQKH  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQ L+NTTPHFICCIKPNNKQ+PG+ +K+LV+QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQHLENTTPHFICCIKPNNKQVPGMCDKDLVIQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  VA+L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVAILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>ref|XP_009603975.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1157

 Score =   240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP-QKQ  196
            +YD  GF EKNRD LHSDIIQLLSS   +LP+LFA+ S  + ++ SSP    G+   QK 
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSGGQLPRLFASISANEDTEFSSPSTYTGVPDFQKH  700

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK  LF+LMQ L+NTTPHFICCIKPNNKQ+PG+ +K+LV+QQLR  GV E VRIS
Sbjct  701  SVATKFKDHLFKLMQHLENTTPHFICCIKPNNKQVPGMCDKDLVIQQLRSCGVLEVVRIS  760

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT++THQ F  +YGFLL  +N  +DPLS  VA+L+QF++LPELYQVGYTKLY RAG
Sbjct  761  RSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVAILQQFDILPELYQVGYTKLYFRAG  820

Query  554  QVS  562
            Q++
Sbjct  821  QIA  823



>ref|XP_007021261.1| Myosin 2 isoform 1 [Theobroma cacao]
 gb|EOY12786.1| Myosin 2 isoform 1 [Theobroma cacao]
Length=1221

 Score =   240 bits (613),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+ +LP+ FA+ +L+QS K +          KQSV 
Sbjct  700  YDTNGFLEKNRDPLNSELVQLLSSCNGQLPQSFASKMLNQSLKPAT----SFDASKQSVG  755

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK QLF+LM QL+NTTPHFI CIKPN K+LPG++E++LVLQQLR+ GV E VRISRSG
Sbjct  756  AKFKGQLFKLMNQLENTTPHFIRCIKPNCKKLPGMYEEDLVLQQLRWCGVLEIVRISRSG  815

Query  386  YPTKMTHQYFADKYGFLLD-NNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ FA++YGFLL   NV +DPLS  VAVL+QFNVLPE+YQ+GYTKLYLR GQ+ 
Sbjct  816  YPTRMTHQKFAERYGFLLSKTNVSQDPLSISVAVLQQFNVLPEMYQIGYTKLYLRTGQIG  875



>ref|XP_007021262.1| Myosin 2 isoform 2 [Theobroma cacao]
 gb|EOY12787.1| Myosin 2 isoform 2 [Theobroma cacao]
Length=1220

 Score =   240 bits (613),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+ +LP+ FA+ +L+QS K +          KQSV 
Sbjct  699  YDTNGFLEKNRDPLNSELVQLLSSCNGQLPQSFASKMLNQSLKPAT----SFDASKQSVG  754

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK QLF+LM QL+NTTPHFI CIKPN K+LPG++E++LVLQQLR+ GV E VRISRSG
Sbjct  755  AKFKGQLFKLMNQLENTTPHFIRCIKPNCKKLPGMYEEDLVLQQLRWCGVLEIVRISRSG  814

Query  386  YPTKMTHQYFADKYGFLLD-NNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ FA++YGFLL   NV +DPLS  VAVL+QFNVLPE+YQ+GYTKLYLR GQ+ 
Sbjct  815  YPTRMTHQKFAERYGFLLSKTNVSQDPLSISVAVLQQFNVLPEMYQIGYTKLYLRTGQIG  874



>ref|XP_008800396.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1247

 Score =   240 bits (613),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 147/185 (79%), Gaps = 9/185 (5%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS-----PILLDGLYPQ  190
            YD +GF EKNRD LHSD I+LL SCS +LP+LFA+++L QSQK S     P  +D    Q
Sbjct  690  YDTSGFLEKNRDPLHSDSIELLLSCSCQLPQLFASNILSQSQKESSPFRQPSRVDS---Q  746

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSV TKFK QLF+LMQQL+NTTPHFI CIKPN+KQLPG+++ +LV +QLR  GV E VR
Sbjct  747  KQSVGTKFKGQLFKLMQQLENTTPHFIRCIKPNSKQLPGMYQHDLVAEQLRCCGVLEVVR  806

Query  371  ISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSGYPT+MTHQ FA++YGF LL+N   +DPLS  VA+L+QFNV PE+YQVGYTKL+ R
Sbjct  807  ISRSGYPTRMTHQQFAERYGFLLLENLASQDPLSVSVAILQQFNVPPEMYQVGYTKLFFR  866

Query  548  AGQVS  562
             GQV+
Sbjct  867  TGQVA  871



>ref|XP_002523758.1| myosin vIII, putative [Ricinus communis]
 gb|EEF38607.1| myosin vIII, putative [Ricinus communis]
Length=1181

 Score =   238 bits (608),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L QSQK  P++       G   
Sbjct  666  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLTQSQK--PVVGPLYKAGGADS  723

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  724  QKLSVATKFKSQLFQLMQRLENTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVV  783

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL+N   +DPL   VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  784  RISRSGFPTRMSHQKFARRYGFLLLENAASQDPLGVSVAILHQFNILPEMYQVGYTKLFF  843

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  844  RTGQIG  849



>ref|XP_011095261.1| PREDICTED: LOW QUALITY PROTEIN: myosin-2-like [Sesamum indicum]
Length=1028

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCST-RLPKLFATSLLDQSQK--SSPILLDGLYPQKQ  196
            YD   F EKNRD LHS+I+QLLSSC+  +LP+ FA S+L+QS+K  SS   L     QKQ
Sbjct  507  YDTGEFLEKNRDALHSEIVQLLSSCTACQLPQWFA-SVLEQSEKLTSSAFQLGRPAYQKQ  565

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLF+LMQQL+ TTPHFI CIKPNNKQ+PG FEK+LVL+QLR  GV E VRIS
Sbjct  566  SVATKFKGQLFKLMQQLEKTTPHFIRCIKPNNKQIPGAFEKDLVLEQLRSCGVLEVVRIS  625

Query  377  RSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ F  +YGFL+ +N+  +DPLS  VA+L+QF++LPE+YQVGY KLY RAG
Sbjct  626  RSGYPTRMTHQEFTRRYGFLIPENSACQDPLSMSVAILQQFDILPEMYQVGYKKLYFRAG  685

Query  554  QVSN  565
            Q+ +
Sbjct  686  QIGS  689



>ref|XP_009389227.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1277

 Score =   238 bits (607),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 112/180 (62%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPILLDGLYPQKQS  199
            YD  GF EKNRD+LH DIIQLL++C   LP++FA+ +L QS+ S  SP   +    QK S
Sbjct  758  YDTTGFLEKNRDLLHMDIIQLLANCKCHLPQIFASKMLSQSENSAASPYRFNVADSQKLS  817

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V +KFK QLFQLMQ+L NTTPHFI CIKPNN QLP  +E+ L+LQQLR  GV E VRISR
Sbjct  818  VASKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQLPETYEQGLILQQLRCCGVLEVVRISR  877

Query  380  SGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            SGYPT+M+HQ FA +YGFLL+N   +DPLS  VA+L+QF+++PE+YQVGYTKL+ R GQ+
Sbjct  878  SGYPTRMSHQKFAKRYGFLLENVASQDPLSVSVAILQQFSIIPEMYQVGYTKLFFRTGQI  937



>gb|KHG02807.1| Myosin-J heavy chain [Gossypium arboreum]
Length=568

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 142/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+SD++Q LSSC++ LP+LFA   ++QS K +   +    P KQSV 
Sbjct  351  YDTNGFLEKNRDSLNSDLVQHLSSCNSELPRLFAKKRINQSLKPT---ISSDTP-KQSVG  406

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  407  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  466

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N ++DPLS  VAVLKQFNVLP++Y+VGYTKLYLR GQ+ 
Sbjct  467  YPTRMTHLEFAERYGFLLLETNAYQDPLSISVAVLKQFNVLPDMYRVGYTKLYLRTGQIG  526



>ref|XP_002525757.1| myosin vIII, putative [Ricinus communis]
 gb|EEF36593.1| myosin vIII, putative [Ricinus communis]
Length=1223

 Score =   237 bits (605),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD LHSD+ QLLSSCS RL +LF + + +Q   SS     GL   KQSV 
Sbjct  687  YDTNGFLEKNRDPLHSDLFQLLSSCSCRLAQLFVSKMSNQFVSSSFNQSYGLESSKQSVG  746

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM QL+NTTPHFI C+KPN+KQLPG  E +LVLQQLR  GV E VRISRSG
Sbjct  747  TKFKGQLFKLMHQLENTTPHFIRCLKPNSKQLPGEHEDDLVLQQLRCCGVLEVVRISRSG  806

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL N +V +DPLS  VAVL+QFN+LPE+YQVGYTK+YLR G ++
Sbjct  807  YPTRITHQDFAQRYGFLLSNTSVSQDPLSISVAVLQQFNILPEMYQVGYTKVYLRTGSIA  866



>gb|AAM14075.1| putative myosin [Arabidopsis thaliana]
Length=1166

 Score =   237 bits (604),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  647  TYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASSMLIQSEK--PVVGPLYKAGGADS  704

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PGV+E+ LVLQQLR  GV E V
Sbjct  705  QRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSPGVYEQGLVLQQLRCCGVLEVV  764

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ F+ +YGFLL  N+  RDPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  765  RISRSGFPTRMSHQKFSRRYGFLLVENIADRDPLSVSVAILHQFNILPEMYQVGYTKLFF  824

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  825  RTGQIG  830



>ref|NP_188630.1| myosin 1 [Arabidopsis thaliana]
 sp|Q9LHE9.1|MYO1_ARATH RecName: Full=Myosin-1; AltName: Full=AtATM1 [Arabidopsis thaliana]
 dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana]
 gb|AAN71940.1| putative myosin [Arabidopsis thaliana]
 gb|AEE76312.1| myosin 1 [Arabidopsis thaliana]
Length=1166

 Score =   237 bits (604),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  647  TYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASSMLIQSEK--PVVGPLYKAGGADS  704

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PGV+E+ LVLQQLR  GV E V
Sbjct  705  QRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSPGVYEQGLVLQQLRCCGVLEVV  764

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ F+ +YGFLL  N+  RDPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  765  RISRSGFPTRMSHQKFSRRYGFLLVENIADRDPLSVSVAILHQFNILPEMYQVGYTKLFF  824

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  825  RTGQIG  830



>emb|CAB61875.1| myosin [Arabidopsis thaliana]
Length=1166

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  647  TYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASSMLIQSEK--PVVGPLYKAGGADS  704

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PGV+E+ LVLQQLR  GV E V
Sbjct  705  QRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSPGVYEQGLVLQQLRCCGVLEVV  764

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ F+ +YGFLL  N+  RDPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  765  RISRSGFPTRMSHQKFSRRYGFLLVENIADRDPLSVSVAILHQFNILPEMYQVGYTKLFF  824

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  825  RTGQIG  830



>ref|XP_010922002.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1174

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS-SPIL-LDGLYPQKQS  199
            Y+ NGF EKN D LHSD IQLL SC+ +LP+L A  LL+QSQ   SP   L  +  QK S
Sbjct  696  YETNGFLEKNGDPLHSDSIQLLLSCNCQLPQLCAARLLNQSQNPVSPFWRLGSVESQKHS  755

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF LMQ+L+ TTPHFI CIKPN+KQLPG++E +LVLQQLR  GV E VRISR
Sbjct  756  VATKFKGQLFNLMQRLEGTTPHFIRCIKPNSKQLPGIYENDLVLQQLRCCGVLEVVRISR  815

Query  380  SGYPTKMTHQYFADKYGFLLDNNV-FRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYP++MTHQ FA++YGFLL  +V F+DPLS  VA+L+QFN+LPE+YQVGYTKL+ R GQ
Sbjct  816  SGYPSRMTHQQFAERYGFLLLEDVQFQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTGQ  875

Query  557  VS  562
            ++
Sbjct  876  IA  877



>ref|XP_007043232.1| Myosin 1 isoform 2 [Theobroma cacao]
 gb|EOX99063.1| Myosin 1 isoform 2 [Theobroma cacao]
Length=920

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+++L+QS+K  P++       G   
Sbjct  405  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQTFASNMLNQSEK--PVVGPLHKAGGADS  462

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  463  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVV  522

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  523  RISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  582

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  583  RTGQIG  588



>ref|XP_008664832.1| PREDICTED: myosin-1 [Zea mays]
 tpg|DAA49540.1| TPA: myosin VIII ZMM3 [Zea mays]
Length=1191

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS--PILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C T LPK+FA+ +L QS  S   P        QK 
Sbjct  673  AYDTSGFLEKNRDLLHMDSIQLLAKCKTSLPKMFASKMLVQSDNSMSVPYRSSAADSQKL  732

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  733  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  792

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            RSGYPT+MTHQ FA +YGFLL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R GQ
Sbjct  793  RSGYPTRMTHQKFARRYGFLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQ  852

Query  557  VSN  565
            + N
Sbjct  853  IGN  855



>ref|XP_010268832.1| PREDICTED: myosin-2 [Nelumbo nucifera]
Length=1223

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 14/180 (8%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD L SD IQLLSSCS +LP+LFA+++L +SQK             QSV 
Sbjct  701  YDTSGFLEKNRDPLPSDSIQLLSSCSCQLPQLFASNMLSKSQK-------------QSVG  747

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM+QL+NTTPHFI CIKPN+KQLPGV+EK+LVLQQLR  GV E VRISRSG
Sbjct  748  TKFKGQLFKLMKQLENTTPHFIRCIKPNSKQLPGVYEKDLVLQQLRCCGVLEVVRISRSG  807

Query  386  YPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++TH++FA +YGFLL  NV  +DPLS   A+L+QFN+LP++YQVGYTKL+LR GQ+ 
Sbjct  808  YPTRITHKHFAKRYGFLLSVNVVSQDPLSISAAILQQFNILPDMYQVGYTKLFLRTGQIG  867



>ref|XP_012072827.1| PREDICTED: myosin-1-like isoform X4 [Jatropha curcas]
Length=1150

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSCS+ LP++FA+ +L QS+K  P++       G   Q
Sbjct  633  YDTTGFLEKNRDLLHLDSIQLLSSCSSHLPQIFASRMLAQSEK--PVVGPLYKAGGADSQ  690

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VR
Sbjct  691  KLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVVR  750

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  751  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  810

Query  548  AGQVS  562
             GQ+ 
Sbjct  811  TGQIG  815



>ref|XP_009406771.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1222

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD  GF EKNRD+LH D IQLL+SC+  LP+ FA+ +L QS+   S+P    G   QK S
Sbjct  700  YDTTGFLEKNRDLLHMDSIQLLASCTCHLPQAFASKMLFQSENAASNPYRSGGADSQKLS  759

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V +KFK QLFQLMQ+L NTTPHFI CIKPNN QLP  +E+ LVLQQLR  GV E VRISR
Sbjct  760  VASKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQLPETYEQGLVLQQLRCCGVLEVVRISR  819

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  RDPLS  VA+L+QFN+LPE+YQVGYTKL+ R GQ
Sbjct  820  SGYPTRMSHQKFARRYGFLLLENVASRDPLSVSVAILQQFNILPEMYQVGYTKLFFRTGQ  879

Query  557  V  559
            +
Sbjct  880  I  880



>ref|XP_012072826.1| PREDICTED: myosin-1-like isoform X3 [Jatropha curcas]
Length=1163

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSCS+ LP++FA+ +L QS+K  P++       G   Q
Sbjct  646  YDTTGFLEKNRDLLHLDSIQLLSSCSSHLPQIFASRMLAQSEK--PVVGPLYKAGGADSQ  703

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VR
Sbjct  704  KLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVVR  763

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  764  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  823

Query  548  AGQVS  562
             GQ+ 
Sbjct  824  TGQIG  828



>gb|ABJ53202.1| myosin VIII-B [Nicotiana benthamiana]
Length=1156

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFAT-SLLDQSQKSSPILLDGLYP--QK  193
            +YD  GF EKNRD LHSDIIQLLSS S +LP+LFA+ S  + ++ SSP       P  QK
Sbjct  641  TYDATGFLEKNRDALHSDIIQLLSSSSGQLPQLFASVSANEDTEVSSPSTY-ARVPDFQK  699

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK  LF+LMQQL+NTTPHFICCIKPNNKQ+PG+ +K+L++QQLR  GV E VRI
Sbjct  700  QSVATKFKDHLFKLMQQLENTTPHFICCIKPNNKQVPGMCDKDLIIQQLRSCGVLEVVRI  759

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT++THQ F  +YGFLL  +N  +DPLS  VA+ +QF++LPELY VGYTKLY RA
Sbjct  760  SRSGYPTRLTHQEFTSRYGFLLVKDNACQDPLSMSVAIQQQFDILPELYLVGYTKLYFRA  819

Query  551  GQVS  562
            GQ++
Sbjct  820  GQIA  823



>ref|XP_012072822.1| PREDICTED: myosin-1-like isoform X1 [Jatropha curcas]
 ref|XP_012072823.1| PREDICTED: myosin-1-like isoform X1 [Jatropha curcas]
Length=1187

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSCS+ LP++FA+ +L QS+K  P++       G   Q
Sbjct  670  YDTTGFLEKNRDLLHLDSIQLLSSCSSHLPQIFASRMLAQSEK--PVVGPLYKAGGADSQ  727

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VR
Sbjct  728  KLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVVR  787

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  788  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  847

Query  548  AGQVS  562
             GQ+ 
Sbjct  848  TGQIG  852



>gb|KDO69893.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=668

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  393  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  450

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  451  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  510

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  511  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  570

Query  548  AGQVS  562
            AGQ+ 
Sbjct  571  AGQIG  575



>gb|KDP37497.1| hypothetical protein JCGZ_05936 [Jatropha curcas]
Length=923

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSCS+ LP++FA+ +L QS+K  P++       G   Q
Sbjct  406  YDTTGFLEKNRDLLHLDSIQLLSSCSSHLPQIFASRMLAQSEK--PVVGPLYKAGGADSQ  463

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VR
Sbjct  464  KLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVVR  523

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  524  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  583

Query  548  AGQV  559
             GQ+
Sbjct  584  TGQI  587



>ref|XP_008806763.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1252

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 9/185 (5%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS-----PILLDGLYPQ  190
            YD +GF EKNRD LH DIIQLL SCS +LP+LFA+++L QSQK S     P  +D    Q
Sbjct  695  YDTSGFLEKNRDPLHLDIIQLLLSCSCQLPQLFASNILSQSQKESNPLRQPSTVDS---Q  751

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSV TKFK QLF+LMQ+L+NT PHFI CIKPNN +LPG+++ +LVL+QLR  GV E VR
Sbjct  752  KQSVGTKFKGQLFKLMQRLENTAPHFIRCIKPNNNKLPGMYQHDLVLEQLRCCGVLEVVR  811

Query  371  ISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSGYPT+MTHQ FA++YGF LL+N   +DPLS  V +L+QFNV PELYQVGYTK++ R
Sbjct  812  ISRSGYPTRMTHQQFAERYGFLLLENLASQDPLSVSVGLLQQFNVPPELYQVGYTKIFFR  871

Query  548  AGQVS  562
             GQV+
Sbjct  872  TGQVA  876



>ref|XP_012072824.1| PREDICTED: myosin-1-like isoform X2 [Jatropha curcas]
 ref|XP_012072825.1| PREDICTED: myosin-1-like isoform X2 [Jatropha curcas]
Length=1174

 Score =   235 bits (600),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSCS+ LP++FA+ +L QS+K  P++       G   Q
Sbjct  657  YDTTGFLEKNRDLLHLDSIQLLSSCSSHLPQIFASRMLAQSEK--PVVGPLYKAGGADSQ  714

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VR
Sbjct  715  KLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVVR  774

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  775  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  834

Query  548  AGQVS  562
             GQ+ 
Sbjct  835  TGQIG  839



>gb|KDO69897.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69898.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=745

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  231  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  288

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  289  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  348

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  349  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  408

Query  548  AGQVS  562
            AGQ+ 
Sbjct  409  AGQIG  413



>gb|KDO69892.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=695

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  393  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  450

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  451  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  510

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  511  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  570

Query  548  AGQVS  562
            AGQ+ 
Sbjct  571  AGQIG  575



>ref|XP_007043231.1| Myosin 1 isoform 1 [Theobroma cacao]
 gb|EOX99062.1| Myosin 1 isoform 1 [Theobroma cacao]
Length=1153

 Score =   235 bits (599),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+++L+QS+K  P++       G   
Sbjct  638  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQTFASNMLNQSEK--PVVGPLHKAGGADS  695

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  696  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVV  755

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  756  RISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  815

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  816  RTGQIG  821



>ref|XP_006406435.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
 gb|ESQ47888.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
Length=1205

 Score =   235 bits (600),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L QS+K  P++       G   
Sbjct  685  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQVFASSMLIQSEK--PVVGPLYKAGGADS  742

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  743  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVV  802

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  803  RISRSGFPTRMSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  862

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  863  RTGQIG  868



>gb|KDO69895.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69896.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=793

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  279  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  336

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  337  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  396

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  397  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  456

Query  548  AGQVS  562
            AGQ+ 
Sbjct  457  AGQIG  461



>ref|XP_010905050.1| PREDICTED: myosin-1 [Elaeis guineensis]
Length=1266

 Score =   235 bits (600),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLD--GLYPQKQS  199
            YD +GF EKNRD LHSDIIQLL SCS +L +LFA+++L QSQK S +L     +  QKQ+
Sbjct  704  YDTSGFLEKNRDPLHSDIIQLLLSCSCQLSQLFASNVLSQSQKESNLLRQPCKVDSQKQN  763

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQ+L+NTTPHFI CI PN+KQLPG+++ +LVL+QLR  GV EAVRISR
Sbjct  764  VGTKFKGQLFKLMQRLENTTPHFIRCITPNSKQLPGMYQHDLVLEQLRCCGVLEAVRISR  823

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M HQ FA++YGFLL  N+  +DPLS  V VL+QFNV PE+YQVGYTKL+ R GQ
Sbjct  824  SGYPTRMRHQQFAERYGFLLLKNLASQDPLSVSVHVLRQFNVPPEMYQVGYTKLFFRTGQ  883

Query  557  VS  562
            V+
Sbjct  884  VA  885



>gb|KJB13458.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=666

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  278  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  333

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  334  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  393

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  394  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  453



>gb|KJB79817.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=924

 Score =   233 bits (593),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  409  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  466

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  467  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  526

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  527  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  586

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  587  RTGQIG  592



>ref|XP_011022009.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1118

 Score =   234 bits (596),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 9/187 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L QS+K  P++       G   
Sbjct  602  TYDTTGFLEKNRDLLHMDSIQLLSSCSCHLPQIFASNMLAQSEK--PVVGPLYKAGGADS  659

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  660  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  719

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF--RDPLSTVVAVLKQFNVLPELYQVGYTKLY  541
            RISRSG+PT+M+HQ FA +YGFLL  NV   +DPLS  VA+L QF++LPE+YQVGYTKL+
Sbjct  720  RISRSGFPTRMSHQKFARRYGFLLLENVAYSQDPLSISVAILHQFDILPEMYQVGYTKLF  779

Query  542  LRAGQVS  562
             R GQ+ 
Sbjct  780  FRTGQIG  786



>gb|KJB79824.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=892

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  378  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  435

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  436  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  495

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  496  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  555

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  556  RTGQIG  561



>ref|XP_010557555.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
 ref|XP_010557556.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1171

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +YD +GF EKNRD+LH D IQLLSSCS  LP+ FA S+L QS+K  + P+    G   Q+
Sbjct  654  TYDTSGFLEKNRDLLHLDSIQLLSSCSCHLPQAFAASMLIQSEKPIAGPLYKAGGADSQR  713

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRI
Sbjct  714  LSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRI  773

Query  374  SRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  774  SRSGFPTRMSHQKFARRYGFLLLEDIAVKDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  833

Query  551  GQVS  562
            GQ+ 
Sbjct  834  GQIG  837



>gb|KDO69891.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=906

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  392  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  449

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  450  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  509

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  510  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  569

Query  548  AGQVS  562
            AGQ+ 
Sbjct  570  AGQIG  574



>ref|XP_011022005.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022006.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022007.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022008.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1173

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 9/187 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L QS+K  P++       G   
Sbjct  657  TYDTTGFLEKNRDLLHMDSIQLLSSCSCHLPQIFASNMLAQSEK--PVVGPLYKAGGADS  714

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  715  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  774

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF--RDPLSTVVAVLKQFNVLPELYQVGYTKLY  541
            RISRSG+PT+M+HQ FA +YGFLL  NV   +DPLS  VA+L QF++LPE+YQVGYTKL+
Sbjct  775  RISRSGFPTRMSHQKFARRYGFLLLENVAYSQDPLSISVAILHQFDILPEMYQVGYTKLF  834

Query  542  LRAGQVS  562
             R GQ+ 
Sbjct  835  FRTGQIG  841



>gb|KDO69889.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
 gb|KDO69890.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=907

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  393  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  450

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  451  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  510

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  511  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  570

Query  548  AGQVS  562
            AGQ+ 
Sbjct  571  AGQIG  575



>emb|CDY24591.1| BnaC05g32750D [Brassica napus]
Length=1159

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  638  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPRAFASSMLIQSEK--PVVGPLYKAGGADS  695

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  696  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  755

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  756  RISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  815

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  816  RTGQIG  821



>gb|KHG12024.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=575

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF +KNRD L S+++QLLSSC ++LP+LFA  + +Q  +S    +  L    QSV 
Sbjct  320  YDTNGFLDKNRDPLSSEVVQLLSSCDSQLPQLFAKKMFNQPLQS----VTSLDTTMQSVA  375

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             +FK QLF+LM QL++T PHFICCIKPN+KQLPG +E++LVLQQLR  G+FE +RISRSG
Sbjct  376  LQFKGQLFKLMHQLESTRPHFICCIKPNSKQLPGTYEEDLVLQQLRCCGIFEVIRISRSG  435

Query  386  YPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+++YGFLL   +  +D LS  VA+LKQFNVLP++YQ+GYTKL+LR GQ+S
Sbjct  436  YPTRMTHQAFSERYGFLLSEPIVSQDSLSISVALLKQFNVLPQMYQIGYTKLFLRTGQIS  495



>gb|KHG10661.1| Myosin-I heavy chain [Gossypium arboreum]
Length=416

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 142/187 (76%), Gaps = 5/187 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD N F +KN+D L+ ++I+LLSSC+ +LP+LFA  +L+Q+ + +      L    QSV 
Sbjct  234  YDTNDFLKKNQDSLNPELIELLSSCNGQLPQLFAIKMLNQTLEPAT----SLDSPNQSVS  289

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK +LF+LMQQL+ T PHFICCIKPN KQLPG++E++LV QQLR SGV EAVR+SRSG
Sbjct  290  AKFKGKLFKLMQQLEKTKPHFICCIKPNRKQLPGMYEEDLVSQQLRCSGVLEAVRMSRSG  349

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ FAD+YGF LL+ N   DPLS  VAVLKQFN+LP +YQ+GYTKLYLR G   
Sbjct  350  YPTRMTHQEFADRYGFLLLETNESPDPLSISVAVLKQFNILPGMYQIGYTKLYLRIGLTG  409

Query  563  NELWSMF  583
            + + S F
Sbjct  410  HPVISHF  416



>gb|KDO74224.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1048

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  520  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  576

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  577  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  636

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  637  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  696

Query  551  GQVS  562
            GQ++
Sbjct  697  GQLA  700



>ref|XP_006393159.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
 gb|ESQ30445.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
Length=1148

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS+ LP+ FA+S+L  S+K  PI+       G   
Sbjct  634  TYETTGFLEKNRDLLHSDSIQLLSSCSSHLPQAFASSMLIHSEK--PIVGPLYKAGGADS  691

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  692  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  751

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  752  RISRSGFPTRMSHQKFAQRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  811

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  812  RTGQIG  817



>ref|XP_010905572.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1243

 Score =   234 bits (596),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 143/185 (77%), Gaps = 9/185 (5%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS-----PILLDGLYPQ  190
            YD +GF EKNRD LHSD IQLL SCS +LP+LFA+++  QSQK S     P  +D    Q
Sbjct  687  YDTSGFLEKNRDPLHSDSIQLLLSCSCQLPQLFASNIRRQSQKESSSFRQPSRVDS---Q  743

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSV TKFK QLF+LMQ L+NTTPHFI CIKPN+KQLPG+++  LVL+QLR  GV E VR
Sbjct  744  KQSVGTKFKGQLFKLMQWLENTTPHFIRCIKPNSKQLPGMYQHGLVLEQLRCCGVLEVVR  803

Query  371  ISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSGYPT+MTHQ FA++YGF LL+N   +D LS  VAVL QFNV PE+YQVGYTKL+ R
Sbjct  804  ISRSGYPTRMTHQQFAERYGFLLLENLASQDSLSVSVAVLHQFNVPPEMYQVGYTKLFFR  863

Query  548  AGQVS  562
             GQV+
Sbjct  864  TGQVA  868



>gb|KDO74223.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1095

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>ref|XP_010103613.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB96390.1| Myosin-2 heavy chain [Morus notabilis]
Length=1149

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQL+SSCS  LP+ FA ++L QS+K  P++       G   
Sbjct  635  TYDTSGFLEKNRDLLHMDSIQLMSSCSCHLPQKFAANMLAQSEK--PVVGPLYKSGGADS  692

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q  G++E+ELVLQQLR  GV E V
Sbjct  693  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQSAGLYEQELVLQQLRCCGVLEVV  752

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  753  RISRSGFPTRMSHQKFARRYGFLLSESVTSQDPLSVSVAILHQFNILPEMYQVGYTKLFF  812

Query  545  RAGQV  559
            R GQ+
Sbjct  813  RTGQI  817



>gb|EYU35564.1| hypothetical protein MIMGU_mgv1a000458mg [Erythranthe guttata]
Length=1138

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP+ FA+++L QS+K  P++       G   
Sbjct  626  TYDTTGFLEKNRDLLHLDSIQLLSSCTCPLPQAFASTMLTQSEK--PVVGALYKSGGANS  683

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLM++L+NTTPHFI CIKPNN Q PG + +ELVLQQLR  GV E V
Sbjct  684  QKLSVTTKFKGQLFQLMKRLENTTPHFIRCIKPNNTQSPGSYSQELVLQQLRCCGVLEVV  743

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+MTHQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  744  RISRSGFPTRMTHQKFAKRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  803

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  804  RTGQIG  809



>ref|XP_006451994.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451995.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65234.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65235.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1193

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>gb|KDO74222.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1193

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>ref|XP_010249396.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1280

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSSC+ RLP++FA+++L QS+K  P++       G   
Sbjct  752  TYDTSGFLEKNRDLLHLDSIQLLSSCTCRLPQIFASNMLIQSEK--PVVGPLYKSGGADS  809

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLM++L+NTTPHFI CIKPNN Q PG++++ LVLQQLR  GV E V
Sbjct  810  QKLSVATKFKGQLFQLMKRLENTTPHFIRCIKPNNLQRPGIYDQGLVLQQLRCCGVLEVV  869

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  870  RISRSGYPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  929

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  930  RTGQIG  935



>emb|CDX82270.1| BnaA03g35510D [Brassica napus]
Length=1196

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  686  TYETTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIQSEK--PVVGPLHKAGGADS  743

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  744  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  803

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  804  RISRSGFPTRMSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  863

Query  545  RAGQV  559
            R GQ+
Sbjct  864  RTGQI  868



>gb|KJB13459.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=781

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  278  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  333

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  334  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  393

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  394  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  453



>gb|KJB13460.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=797

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  278  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  333

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  334  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  393

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  394  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  453



>gb|KJB13461.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=790

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  278  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  333

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  334  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  393

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  394  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  453



>ref|XP_009145706.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
 ref|XP_009145708.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
Length=1180

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  659  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIQSEK--PVVGPLYKAGGADS  716

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  717  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  776

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  777  RISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  836

Query  545  RAGQV  559
            R GQ+
Sbjct  837  RTGQI  841



>gb|KEH40947.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1169

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 140/185 (76%), Gaps = 7/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS+K  P++       G   
Sbjct  654  TYDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASHMLTQSEK--PVVGPSHKSGGPDS  711

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  712  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPETYEQGLVLQQLRCCGVLEVV  771

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            RISRSG+PT+M+HQ FA +YGFLLDN   +DPLS  V++L QFN+LPE+YQVGYTKL+ R
Sbjct  772  RISRSGFPTRMSHQKFARRYGFLLDNAASQDPLSVSVSILHQFNILPEMYQVGYTKLFFR  831

Query  548  AGQVS  562
             GQ+ 
Sbjct  832  TGQIG  836



>ref|XP_008797209.1| PREDICTED: LOW QUALITY PROTEIN: myosin-1-like [Phoenix dactylifera]
Length=1193

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD +GF EKNRD+LH D IQLL+SC +RLP  FA+ +L QS     +P        QK S
Sbjct  672  YDTSGFLEKNRDLLHMDSIQLLASCKSRLPPTFASKMLSQSDNVAGNPYRCSAGDSQKLS  731

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP  +E+  VLQQLR  GV E VRISR
Sbjct  732  VATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPTTYEQGFVLQQLRCCGVLEVVRISR  791

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R GQ
Sbjct  792  SGYPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTGQ  851

Query  557  V  559
            +
Sbjct  852  I  852



>emb|CDP18554.1| unnamed protein product [Coffea canephora]
Length=1129

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS+K  P++       G+  
Sbjct  614  TYDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASIMLTQSEK--PVVGPLHKSGGVES  671

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLM +L+NTTPHFI CIKPNN Q PGV++++LVLQQLR  GV E V
Sbjct  672  QKFSVATKFKGQLFQLMHRLENTTPHFIRCIKPNNLQSPGVYDQKLVLQQLRCCGVLEVV  731

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  732  RISRSGFPTRMSHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  791

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  792  RTGQIG  797



>ref|XP_006451996.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451997.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65236.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65237.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1221

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>ref|XP_009145709.1| PREDICTED: myosin-1 isoform X2 [Brassica rapa]
Length=1146

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  625  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIQSEK--PVVGPLYKAGGADS  682

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  683  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  742

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  743  RISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  802

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  803  RTGQIG  808



>gb|KDO74218.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74219.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74220.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74221.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1221

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L +DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQTDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>ref|XP_007149632.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21626.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=772

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF + + +Q+QK S  L  G L  QKQSV
Sbjct  250  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-SKMFNQTQKQSNSLHGGALDSQKQSV  308

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+NTTPHFI CIKPN KQLPG+++++LVLQQL+  GV E VRISR+
Sbjct  309  GTKFKGQLFKLMHQLENTTPHFIRCIKPNTKQLPGIYDQDLVLQQLKCCGVLEVVRISRA  368

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +DPLS  VAVL+QFN+ PE+YQVG+TKLY+R GQ+
Sbjct  369  GYPTRMTHQEFSRRYGFLLFEANTSQDPLSISVAVLQQFNIPPEMYQVGFTKLYIRTGQI  428

Query  560  S  562
             
Sbjct  429  G  429



>ref|XP_002883217.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59476.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
Length=1166

 Score =   232 bits (592),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  647  TYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASSMLIQSEK--PVVGPLYKAGGADS  704

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PGV+E+ LVLQQLR  GV E V
Sbjct  705  QRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSPGVYEQGLVLQQLRCCGVLEVV  764

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ F+ +YGFLL  N+  +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  765  RISRSGFPTRMSHQKFSRRYGFLLVENIADKDTLSVSVAILHQFNILPEMYQVGYTKLFF  824

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  825  RTGQIG  830



>gb|KJB79825.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=974

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  661  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>ref|XP_010279450.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1327

 Score =   233 bits (594),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 115/183 (63%), Positives = 141/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPILLDG-LYPQK  193
            +YD + F EKNRD+LH D IQLLSSC+ RLP++FA+ +L QS+K    P+   G    QK
Sbjct  799  TYDTSCFLEKNRDLLHLDSIQLLSSCTCRLPQIFASKMLTQSEKPVVGPLYKSGGADSQK  858

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV  KFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG++E+ L+LQQLR  GV E VRI
Sbjct  859  LSVAMKFKGQLFQLMQRLENTTPHFIRCIKPNNLQRPGIYEQGLILQQLRCCGVLEVVRI  918

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  919  SRSGYPTRMSHQKFASRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  978

Query  551  GQV  559
            GQ+
Sbjct  979  GQI  981



>ref|XP_004297721.1| PREDICTED: myosin-1-like [Fragaria vesca subsp. vesca]
Length=1168

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 140/186 (75%), Gaps = 6/186 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D I+LLSSCS  LP++FA+S+L   +   P++     L G   
Sbjct  651  TYDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASSMLRSDRSEKPVVGPLHKLGGADS  710

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  711  QKLSVATKFKGQLFLLMKRLENTTPHFIRCIKPNNSQSPGIYEQGLVLQQLRCCGVLEVV  770

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  ++PLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  771  RISRSGFPTRMSHQKFARRYGFLLLENVASQEPLSVSVAILHQFNILPEMYQVGYTKLFF  830

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  831  RTGQIG  836



>ref|XP_002307152.1| myosin-related family protein [Populus trichocarpa]
 gb|EEE94148.1| myosin-related family protein [Populus trichocarpa]
Length=1173

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 142/187 (76%), Gaps = 9/187 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L QS+K  P++       G   
Sbjct  657  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASNMLTQSEK--PVVGPLYKAGGADS  714

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  715  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNSQSPGSYEQGLVLQQLRCCGVLEVV  774

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF--RDPLSTVVAVLKQFNVLPELYQVGYTKLY  541
            RISRSG+PT+M+HQ FA +YGFLL  +V   +DPLS  VA+L QF++LPE+YQVGYTKL+
Sbjct  775  RISRSGFPTRMSHQKFARRYGFLLLESVAYSQDPLSISVAILHQFDILPEMYQVGYTKLF  834

Query  542  LRAGQVS  562
             R GQ+ 
Sbjct  835  FRTGQIG  841



>ref|XP_008812673.1| PREDICTED: myosin-1-like isoform X4 [Phoenix dactylifera]
Length=1064

 Score =   231 bits (589),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+SC + LP +FA+ +L QS    S P         + 
Sbjct  543  AYDTSGFLEKNRDLLHVDSIQLLASCKSHLPPIFASKMLAQSANVASKPYRSSAADSLRL  602

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP ++E+ LVLQQLR  GV E VRIS
Sbjct  603  SVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPAIYEQGLVLQQLRCCGVLEVVRIS  662

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+M+HQ FA +YGFLL  N+  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R G
Sbjct  663  RSGYPTRMSHQKFARRYGFLLLENIASQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTG  722

Query  554  QV  559
            Q+
Sbjct  723  QI  724



>gb|KJB79823.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1151

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  637  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  694

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  695  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  754

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  755  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  814

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  815  RTGQIG  820



>emb|CDY25361.1| BnaA05g19230D [Brassica napus]
Length=1549

 Score =   233 bits (594),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  625  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIQSEK--PVVGPLYKAGGADS  682

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  683  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  742

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  743  RISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  802

Query  545  RAGQV  559
            R GQ+
Sbjct  803  RTGQI  807


 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  221   QLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSGYPTKM  400
             QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRISRSG+PT++
Sbjct  1097  QLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRV  1156

Query  401   THQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
             +HQ FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R GQ+
Sbjct  1157  SHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQI  1210



>ref|XP_002891568.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67827.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
Length=1153

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P+        G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIQLLSSCSCHLPQAFASSMLIHSEK--PVFGPLHKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  697  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMSHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>ref|XP_008812672.1| PREDICTED: myosin-1-like isoform X3 [Phoenix dactylifera]
Length=1191

 Score =   232 bits (591),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+SC + LP +FA+ +L QS    S P         + 
Sbjct  676  AYDTSGFLEKNRDLLHVDSIQLLASCKSHLPPIFASKMLAQSANVASKPYRSSAADSLRL  735

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP ++E+ LVLQQLR  GV E VRIS
Sbjct  736  SVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPAIYEQGLVLQQLRCCGVLEVVRIS  795

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+M+HQ FA +YGFLL  N+  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R G
Sbjct  796  RSGYPTRMSHQKFARRYGFLLLENIASQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTG  855

Query  554  QV  559
            Q+
Sbjct  856  QI  857



>ref|XP_008812671.1| PREDICTED: myosin-1-like isoform X2 [Phoenix dactylifera]
Length=1196

 Score =   232 bits (591),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+SC + LP +FA+ +L QS    S P         + 
Sbjct  675  AYDTSGFLEKNRDLLHVDSIQLLASCKSHLPPIFASKMLAQSANVASKPYRSSAADSLRL  734

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP ++E+ LVLQQLR  GV E VRIS
Sbjct  735  SVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPAIYEQGLVLQQLRCCGVLEVVRIS  794

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+M+HQ FA +YGFLL  N+  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R G
Sbjct  795  RSGYPTRMSHQKFARRYGFLLLENIASQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTG  854

Query  554  QV  559
            Q+
Sbjct  855  QI  856



>ref|XP_006464677.1| PREDICTED: myosin-2-like isoform X6 [Citrus sinensis]
Length=1193

 Score =   231 bits (590),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L  DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQIDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>ref|XP_010479488.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1153

 Score =   231 bits (589),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  640  TYETTGFLEKNRDLLHSDSIQLLSSCSCYLPQAFASSMLIHSEK--PVVGPLHKAGGADS  697

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  698  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  757

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  758  RISRSGFPTRMSHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  817

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  818  RTGQIG  823



>gb|KHF99826.1| Unconventional myosin-Va [Gossypium arboreum]
Length=1179

 Score =   231 bits (590),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSSC   LP++FA+++L+QS+K  P++       G   
Sbjct  663  TYDTSGFLEKNRDLLHLDSIQLLSSCLCHLPRIFASNMLNQSEK--PVVGPLHKSGGADS  720

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  721  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  780

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  781  RISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  840

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  841  RTGQIG  846



>ref|XP_008812670.1| PREDICTED: myosin-1-like isoform X1 [Phoenix dactylifera]
Length=1197

 Score =   231 bits (590),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+SC + LP +FA+ +L QS    S P         + 
Sbjct  676  AYDTSGFLEKNRDLLHVDSIQLLASCKSHLPPIFASKMLAQSANVASKPYRSSAADSLRL  735

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP ++E+ LVLQQLR  GV E VRIS
Sbjct  736  SVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPAIYEQGLVLQQLRCCGVLEVVRIS  795

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+M+HQ FA +YGFLL  N+  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R G
Sbjct  796  RSGYPTRMSHQKFARRYGFLLLENIASQDPLSVSVAILQQFNILPEMYQVGYTKLFFRTG  855

Query  554  QV  559
            Q+
Sbjct  856  QI  857



>gb|EMS56234.1| Myosin-2 heavy chain [Triticum urartu]
Length=1124

 Score =   231 bits (589),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 149/201 (74%), Gaps = 11/201 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI----LLDGLYPQ  190
            SYD  GF EKNRD LH++ IQLLSSC + LPK FA+ ++  SQ  S +    L+D    Q
Sbjct  622  SYDTTGFLEKNRDPLHTESIQLLSSCKSDLPKDFASVMIADSQNKSSLSRHLLVD---TQ  678

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSVV KFK QLF+LMQQL+NT+PHFI CI+PNNKQ P  FE +LVL QL+  GVFE VR
Sbjct  679  KQSVVNKFKAQLFKLMQQLENTSPHFIRCIQPNNKQRPRQFEHDLVLHQLKCCGVFEVVR  738

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISR+GYPT+MTHQ FA++YGFLL ++V  ++PLS  VAVL+QF++ PE+YQVGYTKL+LR
Sbjct  739  ISRAGYPTRMTHQQFAERYGFLLSHSVASQNPLSISVAVLQQFSIPPEMYQVGYTKLFLR  798

Query  548  AGQVS---NELWSMFHSWIHF  601
             GQV+   N    MFH  +  
Sbjct  799  TGQVASLENAKNRMFHGALRI  819



>gb|KJB79819.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1175

 Score =   231 bits (590),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  660  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  717

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  718  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  777

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  778  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  837

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  838  RTGQIG  843



>gb|KJB79818.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
 gb|KJB79820.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1176

 Score =   231 bits (590),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  661  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>ref|XP_006484499.1| PREDICTED: myosin-1-like [Citrus sinensis]
Length=1167

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  653  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  710

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  711  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  770

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  771  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  830

Query  548  AGQVS  562
            AGQ+ 
Sbjct  831  AGQIG  835



>gb|KJB79821.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1199

 Score =   231 bits (590),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  661  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>ref|XP_006437635.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
 gb|ESR50875.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
Length=1168

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D I+LLSSCS  LP++FA+++L QS K  P++       G   Q
Sbjct  654  YDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNK--PVVGPLYKAGGADSQ  711

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  712  KLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVR  771

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  772  ISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  831

Query  548  AGQVS  562
            AGQ+ 
Sbjct  832  AGQIG  836



>gb|KJB79822.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1198

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LPK FA+++L+QS+K  P++       G   
Sbjct  660  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPKAFASNMLNQSEK--PVVGPLHKAGGADS  717

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  718  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGSYEQGLVLQQLRCCGVLEVV  777

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSGYPT+M HQ FA +YGF LL+N   +D LS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  778  RISRSGYPTRMPHQKFAKRYGFLLLENAASQDSLSVSVAILHQFNILPEMYQVGYTKLFF  837

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  838  RTGQIG  843



>gb|KJB31872.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1147

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPI-LLDGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSC   LP++FA+++L+QS+K    P+    G   QK
Sbjct  629  TYDTTGFLEKNRDLLHLDSIQLLSSCLCHLPRIFASNMLNQSEKLVVGPLHKAGGADSQK  688

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VRI
Sbjct  689  LSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVVRI  748

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  749  SRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  808

Query  551  GQVS  562
            GQ+ 
Sbjct  809  GQIG  812



>gb|KJB31871.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
 gb|KJB31873.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1145

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPI-LLDGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSC   LP++FA+++L+QS+K    P+    G   QK
Sbjct  629  TYDTTGFLEKNRDLLHLDSIQLLSSCLCHLPRIFASNMLNQSEKLVVGPLHKAGGADSQK  688

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VRI
Sbjct  689  LSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVVRI  748

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  749  SRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  808

Query  551  GQVS  562
            GQ+ 
Sbjct  809  GQIG  812



>gb|KJB13455.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=979

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  676  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  731

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  732  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  791

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  792  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  851



>gb|KJB13456.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1064

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  676  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  731

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  732  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  791

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  792  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  851



>ref|XP_009351748.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351749.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
Length=1175

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPI--LLDGLYPQ  190
            SYD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L++ +K    P+  +  G+  Q
Sbjct  658  SYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLNRPEKPLVGPLYKVSGGVDSQ  717

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  718  KLSVATKFKSQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVR  777

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  778  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  837

Query  548  AGQVS  562
             GQ+ 
Sbjct  838  TGQIG  842



>ref|XP_006464672.1| PREDICTED: myosin-2-like isoform X1 [Citrus sinensis]
 ref|XP_006464673.1| PREDICTED: myosin-2-like isoform X2 [Citrus sinensis]
 ref|XP_006464674.1| PREDICTED: myosin-2-like isoform X3 [Citrus sinensis]
 ref|XP_006464675.1| PREDICTED: myosin-2-like isoform X4 [Citrus sinensis]
 ref|XP_006464676.1| PREDICTED: myosin-2-like isoform X5 [Citrus sinensis]
Length=1221

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 142/184 (77%), Gaps = 8/184 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK----SSPILLDGLYPQK  193
            YD NGF EKNRD L  DIIQLLSSC+ ++ +LFA+ +L  S K    S P  LD    QK
Sbjct  693  YDTNGFLEKNRDPLQIDIIQLLSSCTCQVLQLFASKMLKPSPKPAASSQPGALD---TQK  749

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
            QSV TKFK QLF+LM QL+NT PHFI CIKPN+KQLPG++E++LVLQQ R  GV E VRI
Sbjct  750  QSVGTKFKGQLFKLMHQLENTRPHFIRCIKPNSKQLPGIYEEDLVLQQFRCCGVLEIVRI  809

Query  374  SRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSGYPT+M HQ FA +YG LL +  + +DPLS  VAVL+QFNVLPE+YQVGYTKLYLR+
Sbjct  810  SRSGYPTRMRHQEFAGRYGVLLSEKQLSQDPLSISVAVLQQFNVLPEMYQVGYTKLYLRS  869

Query  551  GQVS  562
            GQ++
Sbjct  870  GQLA  873



>gb|KJB13457.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1188

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  676  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  731

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  732  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  791

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  792  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  851



>gb|KJB13453.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1195

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  676  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  731

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  732  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  791

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  792  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  851



>ref|XP_010463346.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1075

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  641  TYETTGFLEKNRDLLHSDSIQLLSSCSCYLPQAFASSMLIHSEK--PVVGPLHKAGGADS  698

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  699  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  758

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+H  F+ +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  759  RISRSGFPTRMSHHKFSRRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  818

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  819  RTGQIG  824



>ref|XP_009127101.1| PREDICTED: myosin-2 [Brassica rapa]
Length=1206

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LL+SC  +L KLF+T + ++SQK  P+LL       Q+V 
Sbjct  692  YDTNGFLEKNRDPLPADLIHLLASCDCQLLKLFSTKMRNKSQK--PLLLSD--STNQTVG  747

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NTTPHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  748  TKFKGQLFKLMNTLENTTPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  807

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLRAGQ+ 
Sbjct  808  YPTRLTHQEFAGRYGFLLSDKKVSQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRAGQIG  867



>ref|XP_008389065.1| PREDICTED: myosin-1-like [Malus domestica]
Length=1175

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPI--LLDGLYPQ  190
            SYD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L++ +K    P+     G+  Q
Sbjct  658  SYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLNRPEKPLVGPLYKTGGGVDSQ  717

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  718  KLSVATKFKSQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVR  777

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  778  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  837

Query  548  AGQVS  562
             GQ+ 
Sbjct  838  TGQIG  842



>gb|KJB13454.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1179

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L+S+++QLLSSC+++LP+LFA   ++QS K +   +    P KQSV 
Sbjct  676  YDTNGFLEKNRDSLNSELVQLLSSCNSQLPRLFARKRINQSLKPT---ISSDTP-KQSVG  731

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T FK QLF+LM QL+NT PHFI CIKPN KQLP ++E+ELVLQQLRY G+ E V+ISR+G
Sbjct  732  TNFKGQLFKLMHQLENTKPHFIRCIKPNCKQLPDMYEEELVLQQLRYCGILEVVKISRAG  791

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTH  FA++YGF LL+ N  +DPLS  VAVLKQFNVLP++Y+VG+TKLYLR GQ+ 
Sbjct  792  YPTRMTHLEFAERYGFLLLETNASQDPLSISVAVLKQFNVLPDMYRVGFTKLYLRTGQIG  851



>gb|AAD31926.1|AF147738_1 myosin VIII ZMM3 [Zea mays]
Length=1099

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS--PILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C T LPK+FA+ +L QS  S   P        QK 
Sbjct  580  AYDTSGFLEKNRDLLHMDSIQLLAKCKTSLPKMFASKMLVQSDNSMSVPYRSSAADSQKL  639

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  640  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  699

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA + GFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  700  RSGYPTRMTHQKFARRSGFLLVEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  759

Query  554  QVSN  565
            Q+ N
Sbjct  760  QIGN  763



>ref|XP_009147843.1| PREDICTED: myosin-3 [Brassica rapa]
Length=1152

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIKLLSSCSCHLPQAFASSMLIHSEK--PVVGPLYKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  697  QRLSVATKFKDQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMSHQKFARRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>emb|CDY22791.1| BnaA06g02860D [Brassica napus]
Length=1157

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  644  TYETTGFLEKNRDLLHSDSIKLLSSCSCHLPQAFASSMLIHSEK--PVVGPLYKAGGADS  701

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  702  QRLSVATKFKDQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  761

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  762  RISRSGFPTRMSHQKFARRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  821

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  822  RTGQIG  827



>ref|XP_002467046.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
 gb|EER94044.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
Length=1196

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 137/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS--PILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C T LPK+FA+ +L QS  S   P        QK 
Sbjct  678  AYDTSGFLEKNRDLLHMDSIQLLAKCKTSLPKMFASKMLVQSDNSMSVPYRSSAADSQKL  737

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  738  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  797

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  798  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  857

Query  554  QV  559
            Q+
Sbjct  858  QI  859



>ref|XP_006401589.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
 gb|ESQ43042.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
Length=1217

 Score =   230 bits (587),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T + D+SQK  P++L       Q+V 
Sbjct  696  YDTNGFLEKNRDPLPADLIHLLSSCDCQLLKLFSTKMRDKSQK--PLMLSD--STNQTVG  751

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  752  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  811

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL   NV +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  812  YPTRLTHQEFAGRYGFLLSGKNVCQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  871



>ref|XP_009135657.1| PREDICTED: myosin-1-like [Brassica rapa]
Length=1136

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K  P++       G   
Sbjct  626  TYETTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIQSEK--PVVGPLYKAGGADS  683

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  684  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  743

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +Y FLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  744  RISRSGFPTRMSHQKFARRYCFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFF  803

Query  545  RAGQV  559
            R GQ+
Sbjct  804  RTGQI  808



>ref|XP_006279905.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
 gb|EOA12803.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
Length=1215

 Score =   230 bits (586),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  691  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLS--ESTNQTVG  746

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  747  TKFKCQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  806

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D NV  DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  807  YPTRLTHQEFAGRYGFLLSDKNVSEDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  866



>ref|XP_004231522.1| PREDICTED: myosin-1 [Solanum lycopersicum]
Length=1157

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LHS+ IQLLSSC   LP+ FA+++L QS+K  P++       G   
Sbjct  642  TYDTTGFLEKNRDLLHSNSIQLLSSCKFHLPQTFASNMLSQSEK--PVVGPLYKSGGADS  699

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ELVLQQLR  GV E V
Sbjct  700  QKLSVSTKFKGQLFQLMQRLENTTPHFIRCIKPNNFQSPGKYEQELVLQQLRCCGVLEVV  759

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LP++YQVG+TKL+ 
Sbjct  760  RISRSGFPTRMSHQKFARRYGFLLLDHVSSQDPLSVSVAILHQFNILPDMYQVGFTKLFF  819

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  820  RTGQIG  825



>ref|XP_010466165.1| PREDICTED: myosin-1 [Camelina sativa]
Length=1166

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +Y+  GF EKNRD+LH D I LLSSCS  LP+ FA+S+L QS+K  + P+    G   Q+
Sbjct  647  TYETTGFLEKNRDLLHLDSIHLLSSCSCLLPQAFASSMLIQSEKPVAGPLYKAGGADSQR  706

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRI
Sbjct  707  LSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRI  766

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ F+ +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  767  SRSGFPTRMSHQKFSRRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  826

Query  551  GQVS  562
            GQ+ 
Sbjct  827  GQIG  830



>ref|XP_007149634.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21628.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=1187

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF + + +Q+QK S  L  G L  QKQSV
Sbjct  664  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-SKMFNQTQKQSNSLHGGALDSQKQSV  722

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+NTTPHFI CIKPN KQLPG+++++LVLQQL+  GV E VRISR+
Sbjct  723  GTKFKGQLFKLMHQLENTTPHFIRCIKPNTKQLPGIYDQDLVLQQLKCCGVLEVVRISRA  782

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +DPLS  VAVL+QFN+ PE+YQVG+TKLY+R GQ+
Sbjct  783  GYPTRMTHQEFSRRYGFLLFEANTSQDPLSISVAVLQQFNIPPEMYQVGFTKLYIRTGQI  842



>ref|XP_007149633.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21627.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=1186

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF + + +Q+QK S  L  G L  QKQSV
Sbjct  664  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-SKMFNQTQKQSNSLHGGALDSQKQSV  722

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+NTTPHFI CIKPN KQLPG+++++LVLQQL+  GV E VRISR+
Sbjct  723  GTKFKGQLFKLMHQLENTTPHFIRCIKPNTKQLPGIYDQDLVLQQLKCCGVLEVVRISRA  782

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +DPLS  VAVL+QFN+ PE+YQVG+TKLY+R GQ+
Sbjct  783  GYPTRMTHQEFSRRYGFLLFEANTSQDPLSISVAVLQQFNIPPEMYQVGFTKLYIRTGQI  842



>dbj|BAJ99526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1257

 Score =   230 bits (586),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 149/201 (74%), Gaps = 11/201 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI----LLDGLYPQ  190
            +YD  GF EKNRD LH++ IQLLSSC + LPK FA+ ++  SQ  S +    L+D    Q
Sbjct  718  TYDTTGFLEKNRDPLHAESIQLLSSCKSDLPKDFASVMIADSQNKSSLSRHLLVDS---Q  774

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSVV KFK QLF+LMQQL+NT+PHFI CI+PNNKQ P  FE +LVL QL+  GVFE VR
Sbjct  775  KQSVVNKFKAQLFKLMQQLENTSPHFIRCIQPNNKQRPRQFEHDLVLHQLKCCGVFEVVR  834

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISR+GYPT+MTHQ FA++YGFLL ++V  ++PLS  VAVL+QF++ PE+YQVGYTKL+LR
Sbjct  835  ISRAGYPTRMTHQQFAERYGFLLSHSVASQNPLSISVAVLQQFSIPPEMYQVGYTKLFLR  894

Query  548  AGQVS---NELWSMFHSWIHF  601
             GQV+   N    MFH  +  
Sbjct  895  TGQVAVLENGKNRMFHGALRI  915



>ref|XP_010688651.1| PREDICTED: myosin-1-like [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPILLDG-LYPQKQ  196
            YD  GF EKNRD++H   +QLLSSC T LP+ FA+S+L QS+K    P+   G    QK 
Sbjct  661  YDTTGFLEKNRDLMHLGSVQLLSSCETFLPQKFASSMLVQSEKPVVGPLFKSGGADSQKL  720

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRIS
Sbjct  721  SVATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQSPGIYEQGLVLQQLRCCGVLEVVRIS  780

Query  377  RSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSG+PT+MTHQ FA +YGF LLD+   +DPLS  VA+L QFN+LP++YQVGYTKL+ R G
Sbjct  781  RSGFPTRMTHQKFARRYGFLLLDSVATQDPLSVSVAILHQFNILPDMYQVGYTKLFFRTG  840

Query  554  QVS  562
            Q+ 
Sbjct  841  QIG  843



>gb|KHN23106.1| Unconventional myosin-Va [Glycine soja]
Length=947

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  432  TYDTSGFLEKNRDLLHLDSIQLLSSSKCHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  489

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  490  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  549

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  550  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  609

Query  545  RAGQV  559
            R GQ+
Sbjct  610  RTGQI  614



>ref|XP_002310637.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
 gb|EEE91087.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
Length=1174

 Score =   229 bits (584),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L Q++K  PI+       G   
Sbjct  659  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASNMLTQTEK--PIVGHLYKAGGADS  716

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN   PG +E+ LVLQQLR  GV E V
Sbjct  717  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNSPSPGSYEQGLVLQQLRCCGVLEVV  776

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISR G+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QF+++PE+YQVGYTKL+ 
Sbjct  777  RISRCGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFDIMPEMYQVGYTKLFF  836

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  837  RTGQIG  842



>gb|KHG19058.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1038

 Score =   228 bits (581),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF +KNRD L S+++QLLSSC ++LP+LFA  + +Q  +S    +  L    QSV 
Sbjct  520  YDTNGFLDKNRDPLSSEVVQLLSSCDSQLPQLFAKKMFNQPLQS----VTSLDTTMQSVA  575

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             +FK QLF+LM QL++T PHFICCIKPN+KQLPG +E++LVLQQLR  G+FE +RISRSG
Sbjct  576  LQFKGQLFKLMHQLESTRPHFICCIKPNSKQLPGTYEEDLVLQQLRCCGIFEVIRISRSG  635

Query  386  YPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+++YGFLL   +  +D LS  VA+LKQFNVLP++YQ+GYTKL+LR GQ+S
Sbjct  636  YPTRMTHQAFSERYGFLLSEPIVSQDSLSISVALLKQFNVLPQMYQIGYTKLFLRTGQIS  695



>ref|XP_010918414.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1195

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ--KSSPILLDGLYPQKQS  199
            YD +GF EKNRD+LH D IQLL+SC ++LP +FA+ +L QS    S+P        Q+ S
Sbjct  675  YDTSGFLEKNRDLLHMDSIQLLASCKSQLPPIFASKMLAQSADVASNPYRPSAADSQRLS  734

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLFQLMQ+L+NTTPHFI CIKPNN QLP  + + LVLQQLR  GV E VRISR
Sbjct  735  VATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLPATYVQGLVLQQLRCCGVLEVVRISR  794

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  +DPLS  VA+L+QFN++PE+YQVGYTKL+ R GQ
Sbjct  795  SGYPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILQQFNIVPEMYQVGYTKLFFRPGQ  854

Query  557  V  559
            +
Sbjct  855  I  855



>gb|KHM99077.1| Myosin-J heavy chain [Glycine soja]
Length=1150

 Score =   229 bits (583),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 7/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS K  P++       G   
Sbjct  636  TYDTTGFLEKNRDLLHVDSIQLLSSCTCPLPQIFASHMLTQSDK--PVVGPLHKSGGADS  693

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  694  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVV  753

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            RISRSG+PT+M+HQ FA +YGFLLDN   +DPLS  VA+L QFN+L E+YQVGYTKL+ R
Sbjct  754  RISRSGFPTRMSHQKFARRYGFLLDNVASQDPLSVSVAILHQFNILSEMYQVGYTKLFFR  813

Query  548  AGQVS  562
             GQ+ 
Sbjct  814  TGQIG  818



>ref|XP_006605841.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1059

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  544  TYDTSGFLEKNRDLLHLDSIQLLSSSKCHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  601

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  602  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  661

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  662  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  721

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  722  RTGQIG  727



>ref|XP_011012310.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011012311.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1198

 Score =   229 bits (584),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L Q++K  PI+       G   
Sbjct  672  TYDTTGFLEKNRDLLHMDSIQLLSSCSCHLPQIFASNMLIQTEK--PIVGHLYKAGGADS  729

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN   PG +E+ LVLQQLR  GV E V
Sbjct  730  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNTPSPGSYEQGLVLQQLRCCGVLEVV  789

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISR G+PT+M HQ FA +YGFLL  NV  +DPLS  VA+L QFN++PE+YQVGYTKL+ 
Sbjct  790  RISRCGFPTRMLHQKFARRYGFLLLENVASQDPLSVSVAILHQFNIMPEMYQVGYTKLFF  849

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  850  RTGQIG  855



>ref|XP_011012313.1| PREDICTED: myosin-1-like isoform X3 [Populus euphratica]
Length=1185

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L Q++K  PI+       G   
Sbjct  659  TYDTTGFLEKNRDLLHMDSIQLLSSCSCHLPQIFASNMLIQTEK--PIVGHLYKAGGADS  716

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN   PG +E+ LVLQQLR  GV E V
Sbjct  717  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNTPSPGSYEQGLVLQQLRCCGVLEVV  776

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISR G+PT+M HQ FA +YGFLL  NV  +DPLS  VA+L QFN++PE+YQVGYTKL+ 
Sbjct  777  RISRCGFPTRMLHQKFARRYGFLLLENVASQDPLSVSVAILHQFNIMPEMYQVGYTKLFF  836

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  837  RTGQIG  842



>ref|XP_004487659.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1077

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILLDGLYPQKQSV  202
            YD NGF EKNRD + SD IQLLSSCS  L + F T  L+QSQK S+   L  L  QKQSV
Sbjct  552  YDTNGFLEKNRDPMPSDSIQLLSSCSCELLRSF-TKTLNQSQKQSNSPHLGALDSQKQSV  610

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL++TTPHFI CIKPN KQLPG++++ELVLQQL+  GV E VRISR+
Sbjct  611  GTKFKGQLFKLMNQLESTTPHFIRCIKPNAKQLPGIYDEELVLQQLKCCGVLEVVRISRA  670

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ FA +Y FLL + N  +DPLS  VAVL+QFN+ PE+YQVG+TKLYLR GQV
Sbjct  671  GYPTRMTHQEFARRYEFLLYEANTSQDPLSVSVAVLQQFNIPPEMYQVGFTKLYLRTGQV  730

Query  560  S  562
             
Sbjct  731  G  731



>ref|XP_009351750.1| PREDICTED: myosin-1-like isoform X2 [Pyrus x bretschneideri]
Length=1163

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 137/181 (76%), Gaps = 9/181 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSV  202
            SYD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L  S         G+  QK SV
Sbjct  658  SYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLKVS--------GGVDSQKLSV  709

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRISRS
Sbjct  710  ATKFKSQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVRISRS  769

Query  383  GYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            G+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R GQ+
Sbjct  770  GFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQI  829

Query  560  S  562
             
Sbjct  830  G  830



>ref|XP_010508266.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508273.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508281.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508289.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +Y+  GF EKNRD+LH D I LLSSCS  LP+ FA+S+L QS+K  + P+    G   Q+
Sbjct  649  TYETTGFLEKNRDLLHLDSIHLLSSCSCLLPQAFASSMLIQSEKPVAGPLYKAGGADSQR  708

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRI
Sbjct  709  LSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRI  768

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ F+ +YGFLL  N+   DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  769  SRSGFPTRMSHQKFSRRYGFLLVENIADEDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  828

Query  551  GQVS  562
            GQ+ 
Sbjct  829  GQIG  832



>gb|KHG13556.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1072

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF +KNRD L S+++QLLSSC ++LP+LFA  + +Q  +S    +  L    QSV 
Sbjct  550  YDTNGFLDKNRDPLSSEVVQLLSSCDSQLPQLFAKKMFNQPLQS----VTSLDTTMQSVA  605

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             +FK QLF+LM QL++T PHFICCIKPN+KQLPG +E++LVLQQLR  G+FE +RISRSG
Sbjct  606  LQFKGQLFKLMHQLESTRPHFICCIKPNSKQLPGTYEEDLVLQQLRCCGIFEVIRISRSG  665

Query  386  YPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+++YGFLL   +  +D LS  VA+LKQFNVLP++YQ+GYTKL+LR GQ+S
Sbjct  666  YPTRMTHQAFSERYGFLLSEPIVSQDSLSISVALLKQFNVLPQMYQIGYTKLFLRTGQIS  725



>ref|XP_011012312.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1187

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L Q++K  PI+       G   
Sbjct  672  TYDTTGFLEKNRDLLHMDSIQLLSSCSCHLPQIFASNMLIQTEK--PIVGHLYKAGGADS  729

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN   PG +E+ LVLQQLR  GV E V
Sbjct  730  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNNTPSPGSYEQGLVLQQLRCCGVLEVV  789

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISR G+PT+M HQ FA +YGFLL  NV  +DPLS  VA+L QFN++PE+YQVGYTKL+ 
Sbjct  790  RISRCGFPTRMLHQKFARRYGFLLLENVASQDPLSVSVAILHQFNIMPEMYQVGYTKLFF  849

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  850  RTGQIG  855



>ref|XP_010067014.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 ref|XP_010067015.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 gb|KCW65077.1| hypothetical protein EUGRSUZ_G02585 [Eucalyptus grandis]
Length=1175

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +YD  GF EKNRD+LH D I+LLSSCS +LP++FA+++L QS+K  + P+    G   QK
Sbjct  661  TYDTTGFLEKNRDLLHLDSIELLSSCSCQLPQIFASNMLTQSEKNVTGPLFKAGGAESQK  720

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLM++L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VRI
Sbjct  721  LSVATKFKSQLFQLMKRLESTTPHFIRCIKPNNFQSPGKYEQGLVLQQLRCCGVLEVVRI  780

Query  374  SRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ FA +YGF LLD+   +D LS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  781  SRSGFPTRMSHQKFARRYGFLLLDDVASQDSLSVSVAILHQFNILPEMYQVGYTKLFFRT  840

Query  551  GQVS  562
            GQV 
Sbjct  841  GQVG  844



>gb|AAB71526.1| unconventional myosin [Helianthus annuus]
Length=1120

 Score =   228 bits (582),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL---DGLYPQK  193
            +YD +GF EKNRD+LH D IQLLSSC+  LP+ FA+++L  S+K  P  L    G   QK
Sbjct  604  TYDTSGFLEKNRDLLHLDSIQLLSSCTCELPQAFASNMLSLSEKPVPGPLHKSGGADSQK  663

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SVVTKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG++ + LVLQQLR  GV E VRI
Sbjct  664  LSVVTKFKGQLFQLMQRLESTTPHFIRCIKPNNSQSPGIYHQGLVLQQLRCCGVLEVVRI  723

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ FA +YGFLL  +V  +DPLS  VA+L QF++LPE+YQ+GYTKL+ R 
Sbjct  724  SRSGFPTRMSHQKFARRYGFLLLEHVASQDPLSVSVAILHQFDILPEMYQIGYTKLFFRT  783

Query  551  GQVS  562
            GQ+ 
Sbjct  784  GQIG  787



>ref|XP_003589748.1| Myosin-like protein [Medicago truncatula]
Length=1865

 Score =   230 bits (587),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 140/185 (76%), Gaps = 7/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS+K  P++       G   
Sbjct  666  TYDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASHMLTQSEK--PVVGPSHKSGGPDS  723

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  724  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPETYEQGLVLQQLRCCGVLEVV  783

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            RISRSG+PT+M+HQ FA +YGFLLDN   +DPLS  V++L QFN+LPE+YQVGYTKL+ R
Sbjct  784  RISRSGFPTRMSHQKFARRYGFLLDNAASQDPLSVSVSILHQFNILPEMYQVGYTKLFFR  843

Query  548  AGQVS  562
             GQ+ 
Sbjct  844  TGQIG  848



>ref|XP_003556592.1| PREDICTED: myosin-1-like [Glycine max]
Length=1176

 Score =   229 bits (583),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 7/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS K  P++       G   
Sbjct  662  TYDTTGFLEKNRDLLHVDSIQLLSSCTCPLPQIFASHMLTQSDK--PVVGPLHKSGGADS  719

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  720  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVV  779

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            RISRSG+PT+M+HQ FA +YGFLLDN   +DPLS  VA+L QFN+L E+YQVGYTKL+ R
Sbjct  780  RISRSGFPTRMSHQKFARRYGFLLDNVASQDPLSVSVAILHQFNILSEMYQVGYTKLFFR  839

Query  548  AGQVS  562
             GQ+ 
Sbjct  840  TGQIG  844



>ref|XP_007142759.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14753.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=745

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  230  TYDTSGFLEKNRDLLHLDSIQLLSSSKCHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  287

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  288  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  347

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+P++++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE++QVGYTKL+ 
Sbjct  348  RISRSGFPSRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMFQVGYTKLFF  407

Query  545  RAGQV  559
            R GQ+
Sbjct  408  RTGQI  412



>ref|XP_006296853.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
 gb|EOA29751.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
Length=1182

 Score =   229 bits (583),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +Y+  GF EKNRD+LH D I LLSSCS  LP+ FA+S+L QS+K  + P+    G   Q+
Sbjct  663  TYETTGFLEKNRDLLHLDSIHLLSSCSCLLPQAFASSMLIQSEKPVAGPLYKAGGADSQR  722

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRI
Sbjct  723  LSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRI  782

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ F+ +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  783  SRSGFPTRMSHQKFSRRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  842

Query  551  GQVS  562
            GQ+ 
Sbjct  843  GQIG  846



>ref|XP_006306608.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
 gb|EOA39506.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
Length=1192

 Score =   229 bits (583),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  678  TYETTGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLIHSEK--PVVGPLHKAGGADS  735

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  736  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  795

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+H  FA +YGFLL  N+  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  796  RISRSGFPTRMSHHKFARRYGFLLLENIAEKDPLSVSVAILHQFNILPEMYQVGYTKLFF  855

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  856  RTGQIG  861



>emb|CDY42506.1| BnaC06g03520D [Brassica napus]
Length=1149

 Score =   228 bits (582),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  636  TYETTGFLEKNRDLLHSDSIKLLSSCSCHLPQAFASSMLIHSEK--PVVGPLYKAGGADS  693

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E V
Sbjct  694  QRLSVATKFKDQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVV  753

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ F+ +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  754  RISRSGFPTRMSHQKFSRRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  813

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  814  RTGQIG  819



>ref|XP_010487954.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +Y+  GF EKNRD+LH D I LLSSCS  LP+ FA+S+L QS+K  + P+    G   Q+
Sbjct  649  TYETTGFLEKNRDLLHLDSIHLLSSCSCLLPQAFASSMLIQSEKPVAGPLYKAGGADSQR  708

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRI
Sbjct  709  LSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRI  768

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M+HQ F+ +YGFLL  N+  +DPL   VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  769  SRSGFPTRMSHQKFSRRYGFLLVENIADKDPLGVSVAILHQFNILPEMYQVGYTKLFFRT  828

Query  551  GQVS  562
            GQ+ 
Sbjct  829  GQIG  832



>ref|NP_568806.3| myosin 2 [Arabidopsis thaliana]
 gb|AED96478.1| myosin 2 [Arabidopsis thaliana]
Length=1030

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  507  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  562

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  563  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  622

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  623  YPTRLTHQEFAGRYGFLLSDKKVAQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  682



>ref|XP_004487658.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1205

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK-SSPILLDGLYPQKQSV  202
            YD NGF EKNRD + SD IQLLSSCS  L + F T  L+QSQK S+   L  L  QKQSV
Sbjct  680  YDTNGFLEKNRDPMPSDSIQLLSSCSCELLRSF-TKTLNQSQKQSNSPHLGALDSQKQSV  738

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL++TTPHFI CIKPN KQLPG++++ELVLQQL+  GV E VRISR+
Sbjct  739  GTKFKGQLFKLMNQLESTTPHFIRCIKPNAKQLPGIYDEELVLQQLKCCGVLEVVRISRA  798

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ FA +Y FLL + N  +DPLS  VAVL+QFN+ PE+YQVG+TKLYLR GQV
Sbjct  799  GYPTRMTHQEFARRYEFLLYEANTSQDPLSVSVAVLQQFNIPPEMYQVGFTKLYLRTGQV  858



>ref|XP_010278387.1| PREDICTED: myosin-1 isoform X3 [Nelumbo nucifera]
Length=1053

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL--LDGLYPQKQS  199
            YD +GF EKNRD LHSD IQLL SCS +L +LFA+++L+QS+K    L  L     QK+S
Sbjct  511  YDTSGFLEKNRDPLHSDSIQLLLSCSCQLAQLFASNILNQSRKPEGSLRRLGSFDSQKRS  570

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQQL++TT HFI CIKPN K+LPGV+EK++VLQQLR  GV E VRISR
Sbjct  571  VGTKFKGQLFKLMQQLESTTSHFIRCIKPNRKKLPGVYEKDMVLQQLRCCGVLEVVRISR  630

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
             GYP +MTHQ FA +YGF LL+N V +DPLS  V++L+QFN+LP++YQVGYTKL+ R G 
Sbjct  631  FGYPIRMTHQQFATRYGFLLLENVVSQDPLSISVSILQQFNILPDMYQVGYTKLFFRTGH  690

Query  557  VS  562
              
Sbjct  691  TG  692



>ref|XP_010935561.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1166

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL--LDGLYPQKQS  199
            YD +GF EKNRD+LH D+IQLL+SC   LP++FA+ +L QS K+   L    G    K S
Sbjct  645  YDTSGFLEKNRDLLHIDLIQLLASCMCCLPQIFASKMLAQSVKTVGNLYRFSGGESHKLS  704

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLFQLMQ+L+ TTPHFI CIKPNN Q+P  +E+ LVLQQLR  GV E VRISR
Sbjct  705  VATKFKGQLFQLMQRLETTTPHFIRCIKPNNLQVPATYEQGLVLQQLRCCGVLEVVRISR  764

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  +DPLS  VA+L+QFN+LP++YQVGYTKL+ R GQ
Sbjct  765  SGYPTRMSHQKFAKRYGFLLLENVASQDPLSVSVAILQQFNILPDMYQVGYTKLFFRTGQ  824

Query  557  VS  562
            + 
Sbjct  825  IG  826



>emb|CDY14319.1| BnaA10g07360D [Brassica napus]
Length=1205

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  687  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  742

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NTTPHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  743  TKFKGQLFKLMNKLENTTPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  802

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  803  YPTRLTHQEFAGRYGFLLSDKKVSQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  862



>ref|XP_003541859.1| PREDICTED: myosin-2-like [Glycine max]
 gb|KHN36777.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF+ +L +QSQK S  L  G L  QKQSV
Sbjct  672  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLFSKTL-NQSQKQSNSLYGGALDSQKQSV  730

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL++TTPHFI CIKPN KQ PG+++++LVLQQL+  GV E VRISR+
Sbjct  731  GTKFKGQLFKLMHQLESTTPHFIRCIKPNTKQHPGIYDEDLVLQQLKCCGVLEVVRISRA  790

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +DPLS  VA+L+QFN+ PE+YQVG+TKLYLR GQ+
Sbjct  791  GYPTRMTHQEFSQRYGFLLSEANTSQDPLSISVAILQQFNIPPEMYQVGFTKLYLRTGQI  850



>ref|XP_010278386.1| PREDICTED: myosin-2 isoform X2 [Nelumbo nucifera]
Length=1084

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL--LDGLYPQKQS  199
            YD +GF EKNRD LHSD IQLL SCS +L +LFA+++L+QS+K    L  L     QK+S
Sbjct  542  YDTSGFLEKNRDPLHSDSIQLLLSCSCQLAQLFASNILNQSRKPEGSLRRLGSFDSQKRS  601

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQQL++TT HFI CIKPN K+LPGV+EK++VLQQLR  GV E VRISR
Sbjct  602  VGTKFKGQLFKLMQQLESTTSHFIRCIKPNRKKLPGVYEKDMVLQQLRCCGVLEVVRISR  661

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
             GYP +MTHQ FA +YGF LL+N V +DPLS  V++L+QFN+LP++YQVGYTKL+ R G 
Sbjct  662  FGYPIRMTHQQFATRYGFLLLENVVSQDPLSISVSILQQFNILPDMYQVGYTKLFFRTGH  721

Query  557  VS  562
              
Sbjct  722  TG  723



>ref|XP_008221075.1| PREDICTED: myosin-1 [Prunus mume]
 ref|XP_008221076.1| PREDICTED: myosin-1 [Prunus mume]
Length=1182

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPI--LLDGLYPQ  190
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L++ +K    P+  L  G+  Q
Sbjct  666  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLNRPEKPLVGPLYKLGGGVDSQ  725

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  726  KMSVATKFKGQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVR  785

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVG TKL+ R
Sbjct  786  ISRSGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGCTKLFFR  845

Query  548  AGQVS  562
             GQ+ 
Sbjct  846  TGQIG  850



>ref|XP_006589741.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1059

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  544  TYDTSGFLEKNRDLLHLDSIQLLSSSICHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  601

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  602  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  661

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  662  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  721

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  722  RTGQIG  727



>ref|XP_006345301.1| PREDICTED: myosin-1-like [Solanum tuberosum]
Length=1157

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LHS+ IQLLSSC   LP+ FA+++L QS+K  P++       G   
Sbjct  642  TYDTTGFLEKNRDLLHSNSIQLLSSCKYHLPQTFASNMLSQSEK--PVVGPLYKSGGADS  699

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  700  QKLSVSTKFKGQLFQLMQRLENTTPHFIRCIKPNNFQSPGKYEQGLVLQQLRCCGVLEVV  759

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LP++YQVG+TKL+ 
Sbjct  760  RISRSGFPTRMSHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPDMYQVGFTKLFF  819

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  820  RTGQIG  825



>ref|XP_006605839.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006605840.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1170

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  655  TYDTSGFLEKNRDLLHLDSIQLLSSSKCHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  712

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  713  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  772

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  773  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  832

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  833  RTGQIG  838



>dbj|BAB10751.1| myosin heavy chain [Arabidopsis thaliana]
Length=1111

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  588  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  643

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  644  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  703

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  704  YPTRLTHQEFAGRYGFLLSDKKVAQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  763



>ref|XP_008340434.1| PREDICTED: myosin-1 isoform X2 [Malus domestica]
Length=1165

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 137/181 (76%), Gaps = 9/181 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSV  202
            SYD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L         +  G+  QK SV
Sbjct  660  SYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLK--------VGGGVDSQKLSV  711

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRISRS
Sbjct  712  ATKFKSQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVRISRS  771

Query  383  GYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            G+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R GQ+
Sbjct  772  GFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQI  831

Query  560  S  562
             
Sbjct  832  G  832



>emb|CAA84065.1| myosin [Arabidopsis thaliana]
Length=1101

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  578  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  633

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  634  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  693

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  694  YPTRLTHQEFAGRYGFLLSDKKVAQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  753



>ref|XP_008340433.1| PREDICTED: myosin-1 isoform X1 [Malus domestica]
Length=1166

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 137/181 (76%), Gaps = 9/181 (5%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSV  202
            SYD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L         +  G+  QK SV
Sbjct  661  SYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLK--------VGGGVDSQKLSV  712

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VRISRS
Sbjct  713  ATKFKSQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVRISRS  772

Query  383  GYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            G+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R GQ+
Sbjct  773  GFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQI  832

Query  560  S  562
             
Sbjct  833  G  833



>gb|KJB49958.1| hypothetical protein B456_008G147000 [Gossypium raimondii]
Length=1152

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPI-LLDGLYPQK  193
            +YD  GF EKNRD+LH D IQLLS C   LP++FA+++L+QS+K+   P+    G   QK
Sbjct  637  TYDTTGFLEKNRDLLHLDSIQLLSFCLCHLPQIFASNMLNQSEKTVVGPLHKAGGADSQK  696

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E VRI
Sbjct  697  LSVATKFKSQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVVRI  756

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+P++M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  757  SRSGFPSRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  816

Query  551  GQVS  562
            GQ+ 
Sbjct  817  GQIG  820



>ref|XP_006661886.1| PREDICTED: myosin-1-like [Oryza brachyantha]
Length=1195

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI--LLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C + LP++FA+ +L QS    PI         QK 
Sbjct  677  AYDTSGFLEKNRDLLHMDSIQLLAKCKSSLPQIFASKILSQSDNPIPIPYRSSAADSQKL  736

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  737  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  796

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  797  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  856

Query  554  QV  559
            Q+
Sbjct  857  QI  858



>ref|XP_010482837.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1215

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF T + D+SQK  P++L       Q+V 
Sbjct  690  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFFTKMRDKSQK--PLMLSD--STSQTVG  745

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  746  TKFKGQLFKLMSTLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  805

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D NV  DPLS  +AVLKQ++V P++YQVGYTKLYLR GQ+ 
Sbjct  806  YPTRLTHQEFAGRYGFLLSDKNVSEDPLSVSIAVLKQYDVHPKMYQVGYTKLYLRTGQIG  865



>ref|XP_004958024.1| PREDICTED: unconventional myosin-Va-like [Setaria italica]
Length=1205

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLY-PQKQS  199
            +YD  GF EKNRD LHS+ IQLLSSC+  LPK FA+ ++  SQ  S +    +   QKQS
Sbjct  699  AYDTAGFLEKNRDPLHSESIQLLSSCTCELPKHFASVMVADSQNKSSVSWHSVVDTQKQS  758

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFKVQLF+LMQQL++TTPHFI CI+PN KQ P +FE +LVL QL+  GV E VRISR
Sbjct  759  VATKFKVQLFKLMQQLESTTPHFIRCIQPNGKQRPKLFEHDLVLHQLKCCGVLEVVRISR  818

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            +GYPT+MTHQ FA++YGFLL  ++  +DPLS  VAVL+Q N+ PE+YQVGYTKL+ R GQ
Sbjct  819  TGYPTRMTHQQFAERYGFLLLRSIASQDPLSVSVAVLQQLNIPPEMYQVGYTKLFFRTGQ  878

Query  557  VS  562
            V+
Sbjct  879  VA  880



>emb|CDY52239.1| BnaC02g44600D [Brassica napus]
Length=1197

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LL+SC  +L KLF+T + ++SQK  P++L       Q+V 
Sbjct  684  YDTNGFLEKNRDPLPADLIHLLASCDCQLLKLFSTKMRNKSQK--PLMLSD--STNQTVG  739

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NTTPHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  740  TKFKGQLFKLMNTLENTTPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  799

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  800  YPTRLTHQEFAGRYGFLLADKKVSQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  859



>ref|NP_001064913.1| Os10g0488800 [Oryza sativa Japonica Group]
 dbj|BAF26827.1| Os10g0488800, partial [Oryza sativa Japonica Group]
Length=950

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI--LLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQ L+ C + LP++FA+ +L QS    P+         QK 
Sbjct  432  AYDTSGFLEKNRDLLHMDSIQFLAKCKSSLPQMFASKMLSQSDNPLPVPYRNSAADSQKL  491

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  492  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  551

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  552  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  611

Query  554  QV  559
            Q+
Sbjct  612  QI  613



>ref|XP_010500596.1| PREDICTED: myosin-3 [Camelina sativa]
Length=1154

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  640  TYETTGFLEKNRDLLHSDSIQLLSSCSCYLPQAFASSMLIHSEK--PVVGPLHKAGGADS  697

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q P ++E+ LVLQQLR  GV E V
Sbjct  698  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPRLYEQGLVLQQLRCCGVLEVV  757

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  758  RISRSGFPTRMSHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  817

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  818  RTGQIG  823



>ref|XP_003574095.1| PREDICTED: myosin-1-like [Brachypodium distachyon]
Length=1190

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ--KSSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C + +P++FA+ +L QS   +S P   +    QK 
Sbjct  671  AYDTSGFLEKNRDLLHMDSIQLLAKCKSSIPQIFASKMLTQSDNLESVPYRPNAADSQKL  730

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++ +ELVLQQL+  GV E VRIS
Sbjct  731  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPSIYGQELVLQQLKCCGVLEVVRIS  790

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  791  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  850

Query  554  QV  559
            Q+
Sbjct  851  QI  852



>gb|EYU39409.1| hypothetical protein MIMGU_mgv1a000419mg [Erythranthe guttata]
Length=1168

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            Y+  GF EKNRD+LH D IQLLSSC+  LP+ FA+SLL+QS K  P++       G   Q
Sbjct  647  YETTGFLEKNRDLLHVDTIQLLSSCTCHLPQAFASSLLNQSDK--PVVGALHKSGGADSQ  704

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLF LMQ+L+NTTPHFI CIKPNN Q PG + + LVLQQLR  GV E VR
Sbjct  705  KLSVTTKFKGQLFLLMQRLENTTPHFIRCIKPNNFQSPGTYNQGLVLQQLRCCGVLEVVR  764

Query  371  ISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  765  ISRSGFPTRMSHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  824

Query  548  AGQVS  562
             GQ+ 
Sbjct  825  TGQIG  829



>ref|XP_006592898.1| PREDICTED: myosin-2-like isoform X3 [Glycine max]
Length=1083

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF T  L+QSQK S  L  G L  QKQSV
Sbjct  558  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-TKTLNQSQKQSNSLYGGSLDSQKQSV  616

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+ TTPHFI CIKPN KQ PGV++++LVLQQL+  GV E VRISR+
Sbjct  617  GTKFKGQLFKLMHQLETTTPHFIRCIKPNTKQQPGVYDEDLVLQQLKCCGVLEVVRISRA  676

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +D LS  VAVL+QFN+ PE+YQVG+TKLYLR GQ+
Sbjct  677  GYPTRMTHQEFSRRYGFLLSEANTSQDSLSISVAVLQQFNIPPEMYQVGFTKLYLRTGQI  736



>dbj|BAF01329.1| myosin heavy chain [Arabidopsis thaliana]
Length=1220

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  697  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  752

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  753  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  812

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  813  YPTRLTHQEFAGRYGFLLSDKKVAQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  872



>ref|NP_001078755.1| myosin 2 [Arabidopsis thaliana]
 sp|F4K0A6.1|MYO2_ARATH RecName: Full=Myosin-2; AltName: Full=AtATM2; AltName: Full=AtMYOS1 
[Arabidopsis thaliana]
 gb|AED96479.1| myosin 2 [Arabidopsis thaliana]
Length=1220

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  697  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  752

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  753  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  812

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  813  YPTRLTHQEFAGRYGFLLSDKKVAQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  872



>ref|XP_010443003.1| PREDICTED: myosin-2 [Camelina sativa]
Length=1215

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T + D+SQK  P++L       Q+V 
Sbjct  690  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRDKSQK--PLMLSD--STNQTVG  745

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NT+PHFI CIKPN+KQ P V+E++LVLQQLR  GV E VRISRSG
Sbjct  746  TKFKGQLFKLMNTLENTSPHFIRCIKPNSKQRPRVYEEDLVLQQLRCCGVLEVVRISRSG  805

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D NV  DPLS  +AVLKQ++V P++YQVGYTKLYLR GQ+ 
Sbjct  806  YPTRLTHQEFAGRYGFLLSDKNVSEDPLSVSIAVLKQYDVHPKMYQVGYTKLYLRTGQIG  865



>ref|XP_004498109.1| PREDICTED: myosin-J heavy chain-like [Cicer arietinum]
Length=1174

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L  S+K  P++       G   
Sbjct  659  TYDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASHMLTLSEK--PVVGPLHKSGGADS  716

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  717  QKLSVATKFKSQLFQLMQRLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVV  776

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+MTHQ FA +YGF LLDN   +DPLS  V++L QFN+LPE+YQVGYTKL+ 
Sbjct  777  RISRSGFPTRMTHQKFARRYGFLLLDNAASQDPLSVSVSILHQFNILPEMYQVGYTKLFF  836

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  837  RTGQIG  842



>ref|XP_008445889.1| PREDICTED: myosin-1-like [Cucumis melo]
Length=1175

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL---DGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L QS+KS    L    G   QK
Sbjct  661  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASNMLTQSEKSIGGTLHKSGGAESQK  720

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV  KFK QLFQLM +L+NTTPHFI CIKPNN Q P ++E+ LVLQQLR  GV E VRI
Sbjct  721  LSVARKFKGQLFQLMLRLENTTPHFIRCIKPNNVQSPRLYEQGLVLQQLRCCGVLEVVRI  780

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SR+G+PT+M+HQ FA +YGFLL  ++  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  781  SRAGFPTRMSHQKFARRYGFLLQESIASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  840

Query  551  GQVS  562
            GQ+ 
Sbjct  841  GQIG  844



>ref|XP_011070461.1| PREDICTED: myosin-1 [Sesamum indicum]
Length=1163

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D I LLSSC+ +LP+ FA+S+L QS+K  P++       G   
Sbjct  647  TYDTTGFLEKNRDLLHLDSIHLLSSCTCQLPQAFASSMLTQSEK--PVVGALYKSGGADS  704

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLM++L+NTTPHFI CIKPNN Q PG + + LVLQQLR  GV E V
Sbjct  705  QKLSVTTKFKGQLFQLMKRLENTTPHFIRCIKPNNFQSPGSYNQGLVLQQLRCCGVLEVV  764

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  765  RISRSGFPTRMSHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  824

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  825  RTGQMG  830



>ref|XP_010446745.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1217

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T + D+SQK  P++L       Q+V 
Sbjct  692  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRDKSQK--PLMLSD--STNQTVG  747

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NT+PHFI CIKPN+KQ P V+E++LVLQQLR  GV E VRISRSG
Sbjct  748  TKFKGQLFKLMNTLENTSPHFIRCIKPNSKQRPRVYEEDLVLQQLRCCGVLEVVRISRSG  807

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D NV  DPLS  +AVLKQ+NV P++YQVGYTK YLR GQ+ 
Sbjct  808  YPTRLTHQEFAGRYGFLLSDKNVSEDPLSVSIAVLKQYNVHPKMYQVGYTKFYLRTGQIG  867



>gb|ABB47808.1| Myosin head family protein, expressed [Oryza sativa Japonica 
Group]
Length=995

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQ  196
            +YD +GF EKNRD+LH D IQ L+ C + LP++FA+ +L QS    P+         QK 
Sbjct  477  AYDTSGFLEKNRDLLHMDSIQFLAKCKSSLPQMFASKMLSQSDNPLPVPYRNSAADSQKL  536

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  537  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  596

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  597  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  656

Query  554  QV  559
            Q+
Sbjct  657  QI  658



>ref|XP_008802972.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1166

 Score =   227 bits (578),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQS  199
            YD +GF EKNRD+LH D+IQLL+ C+  LP +FA+ +L QS K+   +    G+  QK S
Sbjct  646  YDTSGFLEKNRDLLHIDLIQLLACCTCCLPPMFASKMLAQSAKTVGNIYRSSGVESQKLS  705

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLFQLMQ+L++TTPHFI CIKPNN Q+P  +E+ LVLQQLR  GV E VRISR
Sbjct  706  VATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQVPATYEQGLVLQQLRCCGVLEVVRISR  765

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  +DPLS  VA+L+QFN+LP++YQVGY KL+ R GQ
Sbjct  766  SGYPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILQQFNILPDMYQVGYNKLFFRTGQ  825

Query  557  VS  562
            + 
Sbjct  826  IG  827



>ref|XP_003562871.1| PREDICTED: myosin-3 [Brachypodium distachyon]
Length=1251

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI----LLDGLYPQ  190
            +YD  GF EKNRD LHS+ IQLLSSC + LPK FA+ ++  SQ  S +    ++D    Q
Sbjct  712  TYDTTGFLEKNRDPLHSESIQLLSSCKSDLPKDFASVMIADSQSKSSLSRHLVVDS---Q  768

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSVVTKFK QLF+LMQQL+NTTPHFI CI+PNNKQ P  FE +LVL QL+  GV E VR
Sbjct  769  KQSVVTKFKAQLFKLMQQLENTTPHFIRCIQPNNKQRPRQFEHDLVLHQLKCCGVLEVVR  828

Query  371  ISRSGYPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISR+GYPT+MTHQ FA++YGFL+ +    ++PLS  VAVL+QF++ PE+YQVGYTKL+LR
Sbjct  829  ISRAGYPTRMTHQQFAERYGFLVSHFGASQNPLSISVAVLQQFSIPPEMYQVGYTKLFLR  888

Query  548  AGQVS  562
             GQV+
Sbjct  889  TGQVA  893



>ref|XP_010278385.1| PREDICTED: myosin-2 isoform X1 [Nelumbo nucifera]
Length=1248

 Score =   227 bits (579),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL--LDGLYPQKQS  199
            YD +GF EKNRD LHSD IQLL SCS +L +LFA+++L+QS+K    L  L     QK+S
Sbjct  706  YDTSGFLEKNRDPLHSDSIQLLLSCSCQLAQLFASNILNQSRKPEGSLRRLGSFDSQKRS  765

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLF+LMQQL++TT HFI CIKPN K+LPGV+EK++VLQQLR  GV E VRISR
Sbjct  766  VGTKFKGQLFKLMQQLESTTSHFIRCIKPNRKKLPGVYEKDMVLQQLRCCGVLEVVRISR  825

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
             GYP +MTHQ FA +YGF LL+N V +DPLS  V++L+QFN+LP++YQVGYTKL+ R G 
Sbjct  826  FGYPIRMTHQQFATRYGFLLLENVVSQDPLSISVSILQQFNILPDMYQVGYTKLFFRTGH  885

Query  557  VS  562
              
Sbjct  886  TG  887



>gb|KHN28019.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   227 bits (578),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LFA +L +QSQK S  L  G L  QKQSV
Sbjct  672  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLFAKTL-NQSQKQSNSLYGGSLDSQKQSV  730

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+ TTPHFI CIKPN KQ PGV++++LVLQQL+  GV E VRISR+
Sbjct  731  GTKFKGQLFKLMHQLETTTPHFIRCIKPNTKQQPGVYDEDLVLQQLKCCGVLEVVRISRA  790

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +D LS  VAVL+QFN+ PE+YQVG+TKLYLR GQ+
Sbjct  791  GYPTRMTHQEFSRRYGFLLSEANTSQDSLSISVAVLQQFNIPPEMYQVGFTKLYLRTGQI  850



>gb|AFW68522.1| hypothetical protein ZEAMMB73_631881 [Zea mays]
Length=1194

 Score =   227 bits (578),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSS--PILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C T LPK+FA+ +L Q   S   P        QK 
Sbjct  676  AYDTSGFLEKNRDLLHMDSIQLLAKCKTFLPKMFASKMLVQPDDSMSVPYRSSAADSQKL  735

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  736  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  795

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  796  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  855

Query  554  QV  559
            Q+
Sbjct  856  QI  857



>ref|XP_011098363.1| PREDICTED: myosin-2-like [Sesamum indicum]
Length=1209

 Score =   227 bits (578),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ--KSSPILLDGLYPQKQS  199
            YD   F EKNRD LHS+ IQLLSSCS  LP+ FA++LL QSQ  +S+ + L  L  QK S
Sbjct  687  YDTGEFLEKNRDSLHSETIQLLSSCSGELPQYFASTLLKQSQSPESASVQLAMLSCQKPS  746

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V  K KVQLF+LMQ L++T PHFICCIKPN+KQ+ GVFEK LVLQQLR  G+ E VRISR
Sbjct  747  VAAKCKVQLFKLMQHLESTAPHFICCIKPNSKQISGVFEKHLVLQQLRCYGIIEVVRISR  806

Query  380  SGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            SGYP +MTHQ F  KY  LL +N   +DPLS  +A+L+QF+VLPE+YQVGYTK+Y RAG
Sbjct  807  SGYPIRMTHQEFTRKYRCLLPENMACQDPLSMSMAILQQFDVLPEMYQVGYTKIYFRAG  865



>ref|XP_004497241.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1159

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD   F EKNRD+LH D IQLLSS    LP++FA+ +L QS+K  P++     L G   
Sbjct  644  TYDTTAFLEKNRDLLHVDSIQLLSSSKCHLPQIFASYMLTQSEK--PVVGPLHKLGGADS  701

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  702  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  761

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  762  RISRSGFPTRMSHQKFAKRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  821

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  822  RTGQIG  827



>gb|KHN37364.1| Myosin-J heavy chain [Glycine soja]
Length=1176

 Score =   226 bits (577),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  661  TYDTSGFLEKNRDLLHLDSIQLLSSSICHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>gb|AAQ87013.1| myosin heavy chain class VIII A2 protein [Oryza sativa Japonica 
Group]
Length=1128

 Score =   226 bits (576),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ-KSSPILLDGLYPQKQS  199
            +YD  GF EKNRD L+S++IQLLSSC + LPK FA+ ++  SQ KS+      +  QKQS
Sbjct  717  TYDTTGFLEKNRDPLNSELIQLLSSCKSELPKYFASVMVADSQNKSTLSWHSAVDSQKQS  776

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF+LMQQL+NTTPHFI CI+PN+KQ P +FE +LV  QL+  GV E VRISR
Sbjct  777  VVTKFKAQLFKLMQQLENTTPHFIRCIQPNSKQRPMLFEHDLVSHQLKCCGVLEVVRISR  836

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            +GYPT+MTHQ FA++YG LL  ++  +DPLS  VAVL+QFN+ PE+YQVGYTKL+LR GQ
Sbjct  837  AGYPTRMTHQQFAERYGCLLLRSIASQDPLSISVAVLQQFNIPPEMYQVGYTKLFLRTGQ  896

Query  557  VS  562
            V+
Sbjct  897  VA  898



>ref|XP_003592738.1| Myosin-like protein [Medicago truncatula]
 gb|AES62989.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1159

 Score =   226 bits (576),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD   F EKNRD++H D IQLLSS    LP++FA+ +L QS+K  P++     L G   
Sbjct  644  TYDTTAFLEKNRDLMHVDSIQLLSSSKCHLPQIFASYMLSQSEK--PVVGPLHKLGGADS  701

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  702  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  761

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  762  RISRSGFPTRMSHQKFAKRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  821

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  822  RTGQIG  827



>ref|XP_003536741.2| PREDICTED: myosin-1-like isoform X1 [Glycine max]
Length=1176

 Score =   226 bits (577),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  661  TYDTSGFLEKNRDLLHLDSIQLLSSSICHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQSLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGFPTRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>ref|XP_003539582.1| PREDICTED: myosin-2-like isoform X1 [Glycine max]
Length=1196

 Score =   226 bits (577),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF T  L+QSQK S  L  G L  QKQSV
Sbjct  672  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-TKTLNQSQKQSNSLYGGSLDSQKQSV  730

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+ TTPHFI CIKPN KQ PGV++++LVLQQL+  GV E VRISR+
Sbjct  731  GTKFKGQLFKLMHQLETTTPHFIRCIKPNTKQQPGVYDEDLVLQQLKCCGVLEVVRISRA  790

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +D LS  VAVL+QFN+ PE+YQVG+TKLYLR GQ+
Sbjct  791  GYPTRMTHQEFSRRYGFLLSEANTSQDSLSISVAVLQQFNIPPEMYQVGFTKLYLRTGQI  850



>ref|XP_004497240.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1176

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD   F EKNRD+LH D IQLLSS    LP++FA+ +L QS+K  P++     L G   
Sbjct  661  TYDTTAFLEKNRDLLHVDSIQLLSSSKCHLPQIFASYMLTQSEK--PVVGPLHKLGGADS  718

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  719  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  778

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  779  RISRSGFPTRMSHQKFAKRYGFLLLENVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  838

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  839  RTGQIG  844



>ref|NP_001059992.1| Os07g0562800 [Oryza sativa Japonica Group]
 gb|AAQ87012.1| myosin heavy chain class VIII A1 protein [Oryza sativa Japonica 
Group]
 dbj|BAF21906.1| Os07g0562800 [Oryza sativa Japonica Group]
Length=1219

 Score =   226 bits (577),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ-KSSPILLDGLYPQKQS  199
            +YD  GF EKNRD L+S++IQLLSSC + LPK FA+ ++  SQ KS+      +  QKQS
Sbjct  717  TYDTTGFLEKNRDPLNSELIQLLSSCKSELPKYFASVMVADSQNKSTLSWHSAVDSQKQS  776

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF+LMQQL+NTTPHFI CI+PN+KQ P +FE +LV  QL+  GV E VRISR
Sbjct  777  VVTKFKAQLFKLMQQLENTTPHFIRCIQPNSKQRPMLFEHDLVSHQLKCCGVLEVVRISR  836

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            +GYPT+MTHQ FA++YG LL  ++  +DPLS  VAVL+QFN+ PE+YQVGYTKL+LR GQ
Sbjct  837  AGYPTRMTHQQFAERYGCLLLRSIASQDPLSISVAVLQQFNIPPEMYQVGYTKLFLRTGQ  896

Query  557  VS  562
            V+
Sbjct  897  VA  898



>emb|CBI35399.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 139/185 (75%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSC+  LP++FA+++L QS+K  P++       G   Q
Sbjct  621  YDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASNMLTQSEK--PVVGPLYKSGGADSQ  678

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L+ TTPHFI CIKPNN Q PG +++ LVLQQLR  GV E VR
Sbjct  679  KLSVATKFKGQLFQLMQRLETTTPHFIRCIKPNNFQSPGNYDQGLVLQQLRCCGVLEVVR  738

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL   V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  739  ISRSGFPTRMSHQKFARRYGFLLLEGVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  798

Query  548  AGQVS  562
             GQ+ 
Sbjct  799  TGQIG  803



>ref|XP_007225432.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
 gb|EMJ26631.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
Length=1185

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPI--LLDGLYPQ  190
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+S+L++ +K    P+  L  G+  Q
Sbjct  669  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASSMLNRPEKPLVGPLYKLGGGVDSQ  728

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLF LM++L+NTTPHFI CIKPNN Q PG++E+ LVLQQLR  GV E VR
Sbjct  729  KMSVATKFKGQLFLLMKRLENTTPHFIRCIKPNNLQSPGLYEQGLVLQQLRCCGVLEVVR  788

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL  NV  ++PLS  VA+L QFN+LPE+YQVG TKL+ R
Sbjct  789  ISRSGFPTRMSHQKFARRYGFLLLENVASQEPLSVSVAILHQFNILPEMYQVGCTKLFFR  848

Query  548  AGQVS  562
             GQ+ 
Sbjct  849  TGQIG  853



>ref|XP_006592897.1| PREDICTED: myosin-2-like isoform X2 [Glycine max]
Length=1197

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDG-LYPQKQSV  202
            YD +GF EKNRD L SD IQLLSSCS  L +LF T  L+QSQK S  L  G L  QKQSV
Sbjct  672  YDTSGFLEKNRDPLPSDSIQLLSSCSCELLQLF-TKTLNQSQKQSNSLYGGSLDSQKQSV  730

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QLF+LM QL+ TTPHFI CIKPN KQ PGV++++LVLQQL+  GV E VRISR+
Sbjct  731  GTKFKGQLFKLMHQLETTTPHFIRCIKPNTKQQPGVYDEDLVLQQLKCCGVLEVVRISRA  790

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+MTHQ F+ +YGFLL + N  +D LS  VAVL+QFN+ PE+YQVG+TKLYLR GQ+
Sbjct  791  GYPTRMTHQEFSRRYGFLLSEANTSQDSLSISVAVLQQFNIPPEMYQVGFTKLYLRTGQI  850



>ref|XP_002273898.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656029.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656030.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656031.1| PREDICTED: myosin-1 [Vitis vinifera]
Length=1197

 Score =   226 bits (576),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 139/185 (75%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSC+  LP++FA+++L QS+K  P++       G   Q
Sbjct  683  YDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASNMLTQSEK--PVVGPLYKSGGADSQ  740

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L+ TTPHFI CIKPNN Q PG +++ LVLQQLR  GV E VR
Sbjct  741  KLSVATKFKGQLFQLMQRLETTTPHFIRCIKPNNFQSPGNYDQGLVLQQLRCCGVLEVVR  800

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL   V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  801  ISRSGFPTRMSHQKFARRYGFLLLEGVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  860

Query  548  AGQVS  562
             GQ+ 
Sbjct  861  TGQIG  865



>gb|EEC82270.1| hypothetical protein OsI_26483 [Oryza sativa Indica Group]
Length=1245

 Score =   226 bits (577),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 112/182 (62%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLY-PQKQS  199
            +YD  GF EKNRD L+S++IQLLSSC + LPK FA+ ++  SQ  S +     +  QKQS
Sbjct  710  TYDTTGFLEKNRDPLNSELIQLLSSCKSELPKYFASVMVADSQNKSTLSWHSAFDSQKQS  769

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF+LMQQL+NTTPHFI CI+PN+KQ P +FE +LV  QL+  GV E VRISR
Sbjct  770  VVTKFKAQLFKLMQQLENTTPHFIRCIQPNSKQRPMLFEHDLVSHQLKCCGVLEVVRISR  829

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            +GYPT+MTHQ FA++YG LL  ++  +DPLS  VAVL+QFN+ PE+YQVGYTKL+LR GQ
Sbjct  830  AGYPTRMTHQQFAERYGCLLLRSIASQDPLSISVAVLQQFNIPPEMYQVGYTKLFLRTGQ  889

Query  557  VS  562
            V+
Sbjct  890  VA  891



>emb|CDY29324.1| BnaA05g15910D [Brassica napus]
Length=1148

 Score =   226 bits (575),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIKLLSSCSRHLPQAFASSMLVHSEK--PVVGSLHKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLF+LMQ+L  TTPHFI CIKPN+ Q PG++E+ELVLQQLR  GV E V
Sbjct  697  QRLSVATKFKGQLFELMQRLGKTTPHFIRCIKPNSVQSPGLYEQELVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMSHQKFALRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>ref|NP_175453.2| myosin VIIIA [Arabidopsis thaliana]
 sp|F4I507.1|MYO3_ARATH RecName: Full=Myosin-3; AltName: Full=Myosin VIII A; Short=AtVIIIA 
[Arabidopsis thaliana]
 gb|AEE32540.1| myosin VIIIA [Arabidopsis thaliana]
Length=1153

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIQLLSSCSCHLPQAFASSMLIYSEK--PLVGPLHKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q  G++E+ LVLQQLR  GV E V
Sbjct  697  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSAGLYEQGLVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMFHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>emb|CAN82090.1| hypothetical protein VITISV_032704 [Vitis vinifera]
Length=1161

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 139/185 (75%), Gaps = 8/185 (4%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYPQ  190
            YD  GF EKNRD+LH D IQLLSSC+  LP++FA+++L QS+K  P++       G   Q
Sbjct  647  YDTTGFLEKNRDLLHLDSIQLLSSCTCHLPQIFASNMLTQSEK--PVVGPLYKSGGADSQ  704

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            K SV TKFK QLFQLMQ+L+ TTPHFI CIKPNN Q PG +++ LVLQQLR  GV E VR
Sbjct  705  KLSVATKFKGQLFQLMQRLETTTPHFIRCIKPNNFQSPGNYDQGLVLQQLRCCGVLEVVR  764

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISRSG+PT+M+HQ FA +YGFLL   V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R
Sbjct  765  ISRSGFPTRMSHQKFARRYGFLLLEGVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFR  824

Query  548  AGQVS  562
             GQ+ 
Sbjct  825  TGQIG  829



>dbj|BAD93813.1| myosin [Arabidopsis thaliana]
 dbj|BAD94158.1| myosin [Arabidopsis thaliana]
 dbj|BAD94177.1| myosin [Arabidopsis thaliana]
Length=1153

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIQLLSSCSCHLPQAFASSMLIYSEK--PLVGPLHKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q  G++E+ LVLQQLR  GV E V
Sbjct  697  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSAGLYEQGLVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMFHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>gb|AAD50052.1|AC007980_17 Highly similar to myosin [Arabidopsis thaliana]
Length=1155

 Score =   226 bits (575),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD IQLLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  641  TYETTGFLEKNRDLLHSDSIQLLSSCSCHLPQAFASSMLIYSEK--PLVGPLHKAGGADS  698

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLFQLMQ+L NTTPHFI CIKPNN Q  G++E+ LVLQQLR  GV E V
Sbjct  699  QRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSAGLYEQGLVLQQLRCCGVLEVV  758

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M H  FA +YGF LL+N   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  759  RISRSGFPTRMFHHKFARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  818

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  819  RTGQIG  824



>gb|KJB81875.1| hypothetical protein B456_013G166000 [Gossypium raimondii]
Length=844

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD N F +KN+D L+ ++I+LLSSC+ +LP+LFA  +L+Q+ + +      L    QSV 
Sbjct  407  YDTNDFLKKNQDSLNPELIELLSSCNGQLPQLFAIKMLNQTLEPAT----SLDSPNQSVS  462

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK +LF+LMQ+L+ T PHFICCIKPN KQLPG++E++LV QQLR SGV EAVR+SRSG
Sbjct  463  AKFKGKLFKLMQRLEKTKPHFICCIKPNRKQLPGMYEEDLVSQQLRCSGVLEAVRMSRSG  522

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            YPT+MTHQ FAD+YGF LL+ N  +DPLS  VAVLKQFN+LP +YQ+GYTKLYLR G
Sbjct  523  YPTRMTHQEFADRYGFLLLETNESQDPLSISVAVLKQFNMLPGMYQIGYTKLYLRIG  579



>ref|XP_009124542.1| PREDICTED: myosin-3-like [Brassica rapa]
 ref|XP_009124543.1| PREDICTED: myosin-3-like [Brassica rapa]
Length=1148

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  639  TYETTGFLEKNRDLLHSDSIKLLSSCSRDLPQAFASSMLVHSEK--PVVGSLHKAGGADS  696

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLF+LMQ+L  TTPHFI CIKPN+ Q PG++E+ELVLQQLR  GV E V
Sbjct  697  QRLSVATKFKGQLFELMQRLGKTTPHFIRCIKPNSVQSPGLYEQELVLQQLRCCGVLEVV  756

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  757  RISRSGFPTRMSHQKFALRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  816

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  817  RTGQIG  822



>gb|EMT14738.1| Myosin-2 heavy chain [Aegilops tauschii]
Length=1237

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 143/185 (77%), Gaps = 8/185 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI----LLDGLYPQ  190
            SYD  GF EKNRD LH++ IQLL SC + LPK FA+ ++  SQ  S +    L+D    Q
Sbjct  735  SYDTTGFLEKNRDPLHTESIQLLFSCKSDLPKDFASVMIAYSQNKSSLSCHLLVDS---Q  791

Query  191  KQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVR  370
            KQSVV KFK QLF+LMQQL+NT+PHFI CI+PNNKQ P  FE +LVL QL+  GVFE VR
Sbjct  792  KQSVVNKFKAQLFKLMQQLENTSPHFIRCIQPNNKQRPRQFEHDLVLHQLKCCGVFEVVR  851

Query  371  ISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLR  547
            ISR+GYPT+MTHQ FA++YGFLL ++V  ++PLS  VAVL+QF++ PE+YQVGYTKL+LR
Sbjct  852  ISRAGYPTRMTHQQFAERYGFLLSHSVASQNPLSISVAVLQQFSIPPEMYQVGYTKLFLR  911

Query  548  AGQVS  562
             GQV+
Sbjct  912  TGQVA  916



>gb|KJB81873.1| hypothetical protein B456_013G166000 [Gossypium raimondii]
Length=852

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD N F +KN+D L+ ++I+LLSSC+ +LP+LFA  +L+Q+ + +      L    QSV 
Sbjct  407  YDTNDFLKKNQDSLNPELIELLSSCNGQLPQLFAIKMLNQTLEPAT----SLDSPNQSVS  462

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK +LF+LMQ+L+ T PHFICCIKPN KQLPG++E++LV QQLR SGV EAVR+SRSG
Sbjct  463  AKFKGKLFKLMQRLEKTKPHFICCIKPNRKQLPGMYEEDLVSQQLRCSGVLEAVRMSRSG  522

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            YPT+MTHQ FAD+YGF LL+ N  +DPLS  VAVLKQFN+LP +YQ+GYTKLYLR G
Sbjct  523  YPTRMTHQEFADRYGFLLLETNESQDPLSISVAVLKQFNMLPGMYQIGYTKLYLRIG  579



>gb|EEC67214.1| hypothetical protein OsI_34110 [Oryza sativa Indica Group]
Length=1184

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQ  196
            +YD +GF EKNRD+LH D IQ L+ C + LP++FA+ +L QS    P+         QK 
Sbjct  666  AYDTSGFLEKNRDLLHMDSIQFLAKCKSSLPQMFASKMLSQSDNPLPVPYRNSAADSQKL  725

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  726  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  785

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  786  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  845

Query  554  QV  559
            Q+
Sbjct  846  QI  847



>ref|XP_009119961.1| PREDICTED: myosin-2-like [Brassica rapa]
Length=1205

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  + QK  P++L       Q+V 
Sbjct  687  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKYQK--PLMLSD--STNQTVG  742

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NTTPHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  743  TKFKGQLFKLMNKLENTTPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  802

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+ 
Sbjct  803  YPTRLTHQEFAGRYGFLLSDKKVSQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQIG  862



>ref|XP_004982778.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Setaria italica]
Length=1194

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C + LP+ FA+ +L QS  S   P        QK 
Sbjct  676  AYDTSGFLEKNRDLLHMDSIQLLAKCKSSLPQFFASKMLAQSDNSISVPYRSSAADSQKL  735

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  736  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  795

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  ++PLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  796  RSGYPTRMTHQKFARRYGFLLLEDVASQEPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  855

Query  554  QV  559
            Q+
Sbjct  856  QI  857



>ref|XP_009589782.1| PREDICTED: myosin-2-like isoform X3 [Nicotiana tomentosiformis]
Length=1014

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  686  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  735

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPNNKQ+PG++  +LV +QLR SG+ +  RISRSG
Sbjct  736  TKFKDLLFKLMQQLESTAPHFVCCIKPNNKQVPGMYNNDLVFEQLRCSGLLDIARISRSG  795

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  796  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  855



>ref|XP_009589783.1| PREDICTED: myosin-2-like isoform X4 [Nicotiana tomentosiformis]
Length=1013

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  686  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  735

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPNNKQ+PG++  +LV +QLR SG+ +  RISRSG
Sbjct  736  TKFKDLLFKLMQQLESTAPHFVCCIKPNNKQVPGMYNNDLVFEQLRCSGLLDIARISRSG  795

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  796  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  855



>gb|AAL31066.1|AC090120_12 putative myosin [Oryza sativa Japonica Group]
 gb|EEE51178.1| hypothetical protein OsJ_31968 [Oryza sativa Japonica Group]
Length=1200

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL--DGLYPQKQ  196
            +YD +GF EKNRD+LH D IQ L+ C + LP++FA+ +L QS    P+         QK 
Sbjct  682  AYDTSGFLEKNRDLLHMDSIQFLAKCKSSLPQMFASKMLSQSDNPLPVPYRNSAADSQKL  741

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  742  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  801

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  802  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  861

Query  554  QV  559
            Q+
Sbjct  862  QI  863



>gb|EEE67412.1| hypothetical protein OsJ_24744 [Oryza sativa Japonica Group]
Length=1256

 Score =   226 bits (575),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 113/182 (62%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ-KSSPILLDGLYPQKQS  199
            +YD  GF EKNRD L+S++IQLLSSC + LPK FA+ ++  SQ KS+      +  QKQS
Sbjct  710  TYDTTGFLEKNRDPLNSELIQLLSSCKSELPKYFASVMVADSQNKSTLSWHSAVDSQKQS  769

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF+LMQQL+NTTPHFI CI+PN+KQ P +FE +LV  QL+  GV E VRISR
Sbjct  770  VVTKFKAQLFKLMQQLENTTPHFIRCIQPNSKQRPMLFEHDLVSHQLKCCGVLEVVRISR  829

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            +GYPT+MTHQ FA++YG LL  ++  +DPLS  VAVL+QFN+ PE+YQVGYTKL+LR GQ
Sbjct  830  AGYPTRMTHQQFAERYGCLLLRSIASQDPLSISVAVLQQFNIPPEMYQVGYTKLFLRTGQ  889

Query  557  VS  562
            V+
Sbjct  890  VA  891



>ref|XP_004982777.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Setaria italica]
Length=1233

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKS--SPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQLL+ C + LP+ FA+ +L QS  S   P        QK 
Sbjct  676  AYDTSGFLEKNRDLLHMDSIQLLAKCKSSLPQFFASKMLAQSDNSISVPYRSSAADSQKL  735

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++E+ LVLQQL+  GV E VRIS
Sbjct  736  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQLKCCGVLEVVRIS  795

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  ++PLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  796  RSGYPTRMTHQKFARRYGFLLLEDVASQEPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  855

Query  554  QV  559
            Q+
Sbjct  856  QI  857



>ref|XP_009589778.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009589780.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1195

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  686  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  735

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPNNKQ+PG++  +LV +QLR SG+ +  RISRSG
Sbjct  736  TKFKDLLFKLMQQLESTAPHFVCCIKPNNKQVPGMYNNDLVFEQLRCSGLLDIARISRSG  795

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  796  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  855



>ref|XP_009589781.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1194

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  686  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  735

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPNNKQ+PG++  +LV +QLR SG+ +  RISRSG
Sbjct  736  TKFKDLLFKLMQQLESTAPHFVCCIKPNNKQVPGMYNNDLVFEQLRCSGLLDIARISRSG  795

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  796  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  855



>emb|CDY18321.1| BnaC09g30710D [Brassica napus]
Length=1207

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD L +D+I LLSSC  +L KLF+T +  +SQK  P++L       Q+V 
Sbjct  686  YDTNGFLEKNRDPLPADLINLLSSCDCQLLKLFSTKMRGKSQK--PLMLSD--STNQTVG  741

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  742  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  801

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ FA +YGFLL D  V +DPLS  +AVLKQ+ + PE+YQVGYTKLYLR GQ+ 
Sbjct  802  YPTRLTHQEFAGRYGFLLSDKKVSQDPLSVSIAVLKQYELHPEMYQVGYTKLYLRTGQIG  861



>gb|EPS70501.1| hypothetical protein M569_04240, partial [Genlisea aurea]
Length=1152

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ--KSSPILLDGLYPQKQS  199
            YD   F EKNRD L+S+IIQLLSSCS +L +LFA S+L QSQ   SS   L     QKQS
Sbjct  682  YDTGEFLEKNRDRLYSEIIQLLSSCSCKLSRLFA-SMLRQSQISASSCFKLGMSGGQKQS  740

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF LMQQL++T PHFI CIKPN K +P VF+K+LVL+QLR  GV E VRISR
Sbjct  741  VVTKFKGQLFNLMQQLESTRPHFIRCIKPNKKMIPDVFDKDLVLEQLRCCGVLEVVRISR  800

Query  380  SGYPTKMTHQYFADKYGFLLDNNV-FRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SG+PT+MTHQ FA +YGFLL  +   +DPLST V +L+ F++LPE+YQVGYTKLY RAGQ
Sbjct  801  SGFPTRMTHQEFARRYGFLLTESAGSQDPLSTSVIILQMFDILPEMYQVGYTKLYFRAGQ  860

Query  557  V  559
            +
Sbjct  861  I  861



>emb|CDY53932.1| BnaCnng25790D [Brassica napus]
Length=1181

 Score =   224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +Y+  GF EKNRD+LHSD I+LLSSCS  LP+ FA+S+L  S+K  P++       G   
Sbjct  672  TYETTGFLEKNRDLLHSDSIKLLSSCSRHLPQAFASSMLVHSEK--PVVGPLHKAGGPDS  729

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            Q+ SV TKFK QLF+LMQ+L  TTPHFI CIKPN+ Q PG++E+ELVLQQLR  GV E V
Sbjct  730  QRLSVATKFKGQLFELMQRLGKTTPHFIRCIKPNSVQSPGLYEQELVLQQLRCCGVLEVV  789

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  790  RISRSGFPTRMSHQKFALRYGFLLLESIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFF  849

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  850  RTGQIG  855



>ref|XP_009792550.1| PREDICTED: myosin-2-like isoform X3 [Nicotiana sylvestris]
Length=1016

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  688  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  737

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPN+KQ+PG++  +LV +QLR SG+ + VRISRSG
Sbjct  738  TKFKDLLFKLMQQLESTAPHFVCCIKPNSKQVPGMYNNDLVFEQLRCSGLLDIVRISRSG  797

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  798  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  857



>ref|XP_009792551.1| PREDICTED: myosin-2-like isoform X4 [Nicotiana sylvestris]
Length=1015

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  688  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  737

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPN+KQ+PG++  +LV +QLR SG+ + VRISRSG
Sbjct  738  TKFKDLLFKLMQQLESTAPHFVCCIKPNSKQVPGMYNNDLVFEQLRCSGLLDIVRISRSG  797

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  798  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  857



>ref|XP_010933291.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1211

 Score =   224 bits (572),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 114/181 (63%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD  GF EKNRD+LH D IQLL+SC + LP  FA+ +L QS     +P        QK S
Sbjct  691  YDTLGFLEKNRDLLHMDSIQLLASCKSCLPPTFASKMLSQSDNVACNPYRSSAGDSQKLS  750

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            V TKFK QLFQLMQ+L+NTTPHFI CIKPNN QL   +E+ LVLQQLR  GV E VRISR
Sbjct  751  VATKFKGQLFQLMQRLENTTPHFIRCIKPNNLQLAETYEQGLVLQQLRCCGVLEVVRISR  810

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+M+HQ FA +YGFLL  NV  +DPLS  VA+L+QFN+LPE+YQVGYTKL+ R GQ
Sbjct  811  SGYPTRMSHQKFARRYGFLLLENVASQDPLSISVAILQQFNILPEMYQVGYTKLFFRTGQ  870

Query  557  V  559
            +
Sbjct  871  I  871



>gb|KJB81876.1| hypothetical protein B456_013G166000 [Gossypium raimondii]
Length=1054

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD N F +KN+D L+ ++I+LLSSC+ +LP+LFA  +L+Q+ + +      L    QSV 
Sbjct  617  YDTNDFLKKNQDSLNPELIELLSSCNGQLPQLFAIKMLNQTLEPAT----SLDSPNQSVS  672

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK +LF+LMQ+L+ T PHFICCIKPN KQLPG++E++LV QQLR SGV EAVR+SRSG
Sbjct  673  AKFKGKLFKLMQRLEKTKPHFICCIKPNRKQLPGMYEEDLVSQQLRCSGVLEAVRMSRSG  732

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            YPT+MTHQ FAD+YGF LL+ N  +DPLS  VAVLKQFN+LP +YQ+GYTKLYLR G
Sbjct  733  YPTRMTHQEFADRYGFLLLETNESQDPLSISVAVLKQFNMLPGMYQIGYTKLYLRIG  789



>gb|KHN46512.1| Myosin-J heavy chain, partial [Glycine soja]
Length=1049

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL---DGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS K +   L    G   QK
Sbjct  534  TYDTTGFLEKNRDLLHLDSIQLLSSCTCPLPQIFASHMLTQSDKPAVGPLHKSGGADSQK  593

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLF+LMQQL++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E VRI
Sbjct  594  LSVATKFKGQLFRLMQQLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVVRI  653

Query  374  SRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  654  SRSGFPTRMFHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  713

Query  551  GQVS  562
            GQ+ 
Sbjct  714  GQIG  717



>ref|XP_009622620.1| PREDICTED: myosin-1-like [Nicotiana tomentosiformis]
Length=1151

 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LHS+ IQLLSSC   LP+ FA+++L QS+K  P++       G   
Sbjct  636  TYDTTGFLEKNRDLLHSNSIQLLSSCKYHLPQTFASNMLAQSEK--PVVGPLYKSGGADS  693

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+ TTPHF+ CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  694  QKLSVSTKFKGQLFQLMQRLETTTPHFVRCIKPNNFQSPGKYEQGLVLQQLRCCGVLEVV  753

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVFR-DPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL ++V   DPLS  VA+L QFN+LP+LYQVG+TKL+ 
Sbjct  754  RISRSGFPTRMSHQKFARRYGFLLFDHVASLDPLSVSVAILHQFNILPDLYQVGFTKLFF  813

Query  545  RAGQVS  562
            R GQV 
Sbjct  814  RTGQVG  819



>ref|XP_009783184.1| PREDICTED: myosin-1-like [Nicotiana sylvestris]
Length=1151

 Score =   224 bits (570),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LHS+ IQLLSSC   LP+ FA+ +L QS+K  P++       G   
Sbjct  636  TYDTTGFLEKNRDLLHSNSIQLLSSCKYHLPQTFASYMLAQSEK--PVVGPLYKSGGADS  693

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+ TTPHF+ CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  694  QKLSVSTKFKGQLFQLMQRLETTTPHFVRCIKPNNFQSPGKYEQGLVLQQLRCCGVLEVV  753

Query  368  RISRSGYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGFLL D+   +DPLS  VA+L QFN+LP+LYQVG+TKL+ 
Sbjct  754  RISRSGFPTRMSHQKFARRYGFLLFDHVASQDPLSVSVAILHQFNILPDLYQVGFTKLFF  813

Query  545  RAGQVS  562
            R GQV 
Sbjct  814  RTGQVG  819



>gb|KJB81874.1| hypothetical protein B456_013G166000 [Gossypium raimondii]
Length=1062

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD N F +KN+D L+ ++I+LLSSC+ +LP+LFA  +L+Q+ + +      L    QSV 
Sbjct  617  YDTNDFLKKNQDSLNPELIELLSSCNGQLPQLFAIKMLNQTLEPAT----SLDSPNQSVS  672

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
             KFK +LF+LMQ+L+ T PHFICCIKPN KQLPG++E++LV QQLR SGV EAVR+SRSG
Sbjct  673  AKFKGKLFKLMQRLEKTKPHFICCIKPNRKQLPGMYEEDLVSQQLRCSGVLEAVRMSRSG  732

Query  386  YPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            YPT+MTHQ FAD+YGF LL+ N  +DPLS  VAVLKQFN+LP +YQ+GYTKLYLR G
Sbjct  733  YPTRMTHQEFADRYGFLLLETNESQDPLSISVAVLKQFNMLPGMYQIGYTKLYLRIG  789



>ref|XP_004147135.1| PREDICTED: myosin-1-like [Cucumis sativus]
 ref|XP_011655495.1| PREDICTED: myosin-1-like [Cucumis sativus]
 gb|KGN51557.1| hypothetical protein Csa_5G577960 [Cucumis sativus]
Length=1175

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL---DGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSCS  LP++FA+++L QS+KS    L    G   QK
Sbjct  661  TYDTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASNMLTQSEKSIGGTLHKSGGAESQK  720

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV  KFK QLFQLM +L+NTTPHFI CIKPNN Q P ++E+ LVLQQLR  GV E VRI
Sbjct  721  LSVARKFKGQLFQLMLRLENTTPHFIRCIKPNNVQSPRLYEQGLVLQQLRCCGVLEVVRI  780

Query  374  SRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SR+G+PT+M+HQ FA +YGFLL  ++  +DPL   VA+L  FN+LPE+YQVGYTKL+ R 
Sbjct  781  SRAGFPTRMSHQKFARRYGFLLQESIASQDPLGVSVAILHHFNILPEMYQVGYTKLFFRT  840

Query  551  GQVS  562
            GQ+ 
Sbjct  841  GQIG  844



>ref|XP_007212835.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
 gb|EMJ14034.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
Length=1127

 Score =   224 bits (570),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD +GF EKNRD L S  IQLLSSCS +L +LFA+ ++ Q QK  ++   ++ L P K S
Sbjct  652  YDTSGFLEKNRDPLPSVSIQLLSSCSCQLLQLFASKVVKQFQKPENTSCQINSLDPPKPS  711

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
               KFK QLF+LM  L+ + PHFICCIKPN+KQLPGV+E +LVLQQLR  G+ E VRI+R
Sbjct  712  TGIKFKGQLFKLMHHLEGSRPHFICCIKPNSKQLPGVYEVDLVLQQLRCCGILEVVRITR  771

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTHQ FA +YGF LL   + +DPLS  +AVLKQFNVLPE+YQ+GYTK+YLR GQ
Sbjct  772  SGYPTRMTHQEFAGRYGFLLLGAGIPQDPLSLSIAVLKQFNVLPEMYQIGYTKVYLRTGQ  831

Query  557  VS  562
            ++
Sbjct  832  IA  833



>emb|CDY28777.1| BnaA02g09690D [Brassica napus]
Length=1199

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF E NRD L +D+I LLSSC  +L KLF+T + ++SQK  P+LL       Q+V 
Sbjct  685  YDTNGFLENNRDPLPADLIHLLSSCDCQLLKLFSTKMRNKSQK--PLLLSD--STNQTVG  740

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM  L+NT+PHFI CIKPN KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  741  TKFKGQLFKLMNTLENTSPHFIRCIKPNTKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  800

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++ HQ FA +YGFLL D  V +DPLS  +AVLKQ++V PELYQVGYTKLYLR GQ+ 
Sbjct  801  YPTRLKHQEFAGRYGFLLSDKKVSQDPLSVSIAVLKQYDVHPELYQVGYTKLYLRTGQIG  860



>ref|XP_009792549.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1196

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  688  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  737

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPN+KQ+PG++  +LV +QLR SG+ + VRISRSG
Sbjct  738  TKFKDLLFKLMQQLESTAPHFVCCIKPNSKQVPGMYNNDLVFEQLRCSGLLDIVRISRSG  797

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  798  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  857



>ref|XP_009792547.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009792548.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1197

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD +GF EKNRD +HSDIIQLLSS S  LPK FA+S  +QS             QKQ+V 
Sbjct  688  YDTSGFLEKNRDTVHSDIIQLLSSSSEHLPKSFASSFANQSADF----------QKQTVA  737

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK  LF+LMQQL++T PHF+CCIKPN+KQ+PG++  +LV +QLR SG+ + VRISRSG
Sbjct  738  TKFKDLLFKLMQQLESTAPHFVCCIKPNSKQVPGMYNNDLVFEQLRCSGLLDIVRISRSG  797

Query  386  YPTKMTHQYFADKYGFLLDN-NVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ F+ +YG LL   +  +DPLS  VA+L+QF++LPE+YQVGYTKLY RAGQ++
Sbjct  798  YPTRMTHQEFSKRYGVLLPQVHESKDPLSMSVAILRQFDILPEMYQVGYTKLYFRAGQIA  857



>ref|XP_010694426.1| PREDICTED: myosin-2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1244

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI-LLDGLYPQKQSV  202
            YD +GF EKNRD LH+D + LL SCS+ L +LFA+S+LDQSQKS+ +     L  QK+SV
Sbjct  706  YDTSGFLEKNRDPLHTDSLHLLLSCSSPLLQLFASSMLDQSQKSNGLNSQSALDTQKRSV  765

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QL++LMQQL++TTPHFI CIKPN+KQ PGVFEK+LVLQQLR  GV EAVRI+R 
Sbjct  766  ATKFKSQLYKLMQQLEDTTPHFIRCIKPNSKQHPGVFEKDLVLQQLRCCGVLEAVRIARC  825

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYP ++THQ FA ++GFL+ D +V +DPLS  VA+L+QFN+LPELYQVGYTKLY R GQ+
Sbjct  826  GYPNRITHQEFAQRFGFLISDKSVSQDPLSISVAILQQFNILPELYQVGYTKLYFRTGQI  885

Query  560  S  562
             
Sbjct  886  G  886



>ref|XP_010694427.1| PREDICTED: myosin-2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1236

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPI-LLDGLYPQKQSV  202
            YD +GF EKNRD LH+D + LL SCS+ L +LFA+S+LDQSQKS+ +     L  QK+SV
Sbjct  706  YDTSGFLEKNRDPLHTDSLHLLLSCSSPLLQLFASSMLDQSQKSNGLNSQSALDTQKRSV  765

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             TKFK QL++LMQQL++TTPHFI CIKPN+KQ PGVFEK+LVLQQLR  GV EAVRI+R 
Sbjct  766  ATKFKSQLYKLMQQLEDTTPHFIRCIKPNSKQHPGVFEKDLVLQQLRCCGVLEAVRIARC  825

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYP ++THQ FA ++GFL+ D +V +DPLS  VA+L+QFN+LPELYQVGYTKLY R GQ+
Sbjct  826  GYPNRITHQEFAQRFGFLISDKSVSQDPLSISVAILQQFNILPELYQVGYTKLYFRTGQI  885

Query  560  S  562
             
Sbjct  886  G  886



>ref|XP_007142760.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14754.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=1177

 Score =   224 bits (570),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD +GF EKNRD+LH D IQLLSS    LPKLFA+ +L QS+K  P++       G   
Sbjct  662  TYDTSGFLEKNRDLLHLDSIQLLSSSKCHLPKLFASHMLTQSEK--PVVGPLHKSGGADS  719

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L++TTPHFI CIKPNN Q PG +E+ LVLQQLR  GV E V
Sbjct  720  QKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNLQSPGSYEQGLVLQQLRCCGVLEVV  779

Query  368  RISRSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+P++++HQ FA +YGFLL  NV  +DPLS  VA+L QFN+LPE++QVGYTKL+ 
Sbjct  780  RISRSGFPSRVSHQKFARRYGFLLLENVASQDPLSVSVAILHQFNILPEMFQVGYTKLFF  839

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  840  RTGQIG  845



>ref|XP_007153036.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 ref|XP_007153037.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25030.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25031.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
Length=1194

 Score =   224 bits (570),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS K  P++       G   
Sbjct  679  TYDTTGFLEKNRDLLHLDSIQLLSSCTCPLPQIFASHMLTQSDK--PVVGPLHKSGGADS  736

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLF LMQ+L++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E V
Sbjct  737  QKLSVATKFKGQLFLLMQRLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVV  796

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLDN   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  797  RISRSGFPTRMSHQKFARRYGFLLLDNVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  856

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  857  RTGQIG  862



>ref|XP_009105704.1| PREDICTED: LOW QUALITY PROTEIN: myosin-4-like [Brassica rapa]
Length=753

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD LH D+IQLLSSC+ +L  LF++ + D+S K  P L + +    QSV+
Sbjct  271  YDTNGFLEKNRDPLHVDLIQLLSSCNCQLLNLFSSKMRDKSLK--PSLSESM---NQSVI  325

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L++TTPHFI CIKPN+  LPGV+E+  VLQQLR  GV E VRISRSG
Sbjct  326  TKFKSQLFKLMNKLEDTTPHFIRCIKPNSNHLPGVYEENHVLQQLRCCGVLEIVRISRSG  385

Query  386  YPTKMTHQYFADKYGFLLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            Y T+MTHQ  A +YGFLLD  + +DPLST  +++KQFN+ PE+YQVGY K+YLR GQ+
Sbjct  386  YHTRMTHQDLAARYGFLLDTKLSQDPLSTSDSIMKQFNLPPEMYQVGYRKIYLRTGQI  443



>ref|XP_003533701.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006587966.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
 ref|XP_006587967.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1177

 Score =   223 bits (568),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILL---DGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSC+  LP++FA+ +L QS K +   L    G   QK
Sbjct  662  TYDTTGFLEKNRDLLHLDSIQLLSSCTCPLPQIFASHMLTQSDKPAVGPLHKSGGADSQK  721

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLF+LMQQL++TTPHFI CIKPNN Q P  +E+ LVLQQLR  GV E VRI
Sbjct  722  LSVATKFKGQLFRLMQQLESTTPHFIRCIKPNNLQSPESYEQGLVLQQLRCCGVLEVVRI  781

Query  374  SRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SRSG+PT+M HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  782  SRSGFPTRMFHQKFARRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  841

Query  551  GQVS  562
            GQ+ 
Sbjct  842  GQIG  845



>gb|EPS68761.1| hypothetical protein M569_06006, partial [Genlisea aurea]
Length=1053

 Score =   222 bits (565),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPIL-----LDGLYP  187
            +YD  GF EKNRD+LH D I+LLSSC+  LP+ FA S+L  S K  P++       G   
Sbjct  536  TYDTTGFLEKNRDLLHLDSIELLSSCTCPLPQAFAISMLTLSGK--PVVGALHKSGGADL  593

Query  188  QKQSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAV  367
            QK SV TKFK QLFQLMQ+L+NTTPHFI CIKPN+ Q PG +++ LVLQQLR  GV E V
Sbjct  594  QKLSVATKFKGQLFQLMQRLENTTPHFIRCIKPNDFQSPGSYDQSLVLQQLRCCGVLEVV  653

Query  368  RISRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYL  544
            RISRSG+PT+M+HQ FA +YGF LLD+   +DPLS  VA+L QFN+LPE+YQVGYTKL+ 
Sbjct  654  RISRSGFPTRMSHQKFARRYGFLLLDDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFF  713

Query  545  RAGQVS  562
            R GQ+ 
Sbjct  714  RTGQIG  719



>ref|XP_010520892.1| PREDICTED: myosin-2-like [Tarenaya hassleriana]
Length=1207

 Score =   223 bits (568),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD LH+D+I+LLSS + +L   F+T   ++SQK  P+         QSV 
Sbjct  694  YDTNGFLEKNRDPLHTDLIRLLSSSNCQLLDSFSTRNPNKSQK--PLTFSD--STNQSVG  749

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NTTPHFI CIKPN+KQ PGV+E++LVLQQLR  GV E VRISRSG
Sbjct  750  TKFKGQLFKLMNKLENTTPHFIRCIKPNSKQRPGVYEEDLVLQQLRCCGVLEVVRISRSG  809

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT++THQ F+ +YGFLL D  V RDPLS  +AVLKQFN+ PE++QVGYTKLYLR GQ+ 
Sbjct  810  YPTRLTHQEFSGRYGFLLSDKKVSRDPLSISIAVLKQFNIPPEMFQVGYTKLYLRTGQIG  869



>ref|XP_002866036.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1219

 Score =   223 bits (567),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF +KNRD L +D+I LLSSC  +L KLF+T + D+S K  P++L       Q+V 
Sbjct  696  YDTNGFLDKNRDPLPADLINLLSSCDCQLLKLFSTKMRDKSHK--PLMLSD--STNQTVG  751

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM +L+NT+PHFI CIKPN+KQLP V+E++LVLQQLR  GV E VRISRSG
Sbjct  752  TKFKGQLFKLMNKLENTSPHFIRCIKPNSKQLPRVYEEDLVLQQLRCCGVLEVVRISRSG  811

Query  386  YPTKMTHQYFADKYGFL-LDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            YPT++THQ FA +YGFL  D  V +DPLS  +AVLKQ++V PE+YQVGYTKLYLR GQ+
Sbjct  812  YPTRLTHQEFAGRYGFLSSDKKVSQDPLSVSIAVLKQYDVHPEMYQVGYTKLYLRTGQI  870



>gb|KDP38945.1| hypothetical protein JCGZ_00702 [Jatropha curcas]
Length=771

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 133/181 (73%), Gaps = 8/181 (4%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSV  202
            +YD NGF EKNRD LHSD  QLLSSC  +L +LFA+ L       S           QSV
Sbjct  249  AYDTNGFLEKNRDPLHSDFYQLLSSCDCQLLQLFASKLPSSQSGGSESST-------QSV  301

Query  203  VTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRS  382
             +KFK QLF+LM QL+NTTPHFI CIKPN KQLP V E +LVL+QLR  GV E VRISRS
Sbjct  302  GSKFKGQLFKLMHQLENTTPHFIRCIKPNAKQLPQVCEDDLVLRQLRCCGVLEVVRISRS  361

Query  383  GYPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQV  559
            GYPT+M+HQ FA +YGFLL + NV RDPLS  VAVL+ FN+LPE+YQVGYTK++LR GQ+
Sbjct  362  GYPTRMSHQDFAQRYGFLLSEKNVSRDPLSISVAVLQHFNILPEMYQVGYTKVFLRTGQI  421

Query  560  S  562
            +
Sbjct  422  A  422



>ref|XP_010523208.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1176

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPIL-LDGLYPQK  193
            +YD  GF EKNRD+LH D IQLLSSCS  LP+ FA+S+L QS+K    P+    G   Q+
Sbjct  659  TYDTIGFLEKNRDLLHLDSIQLLSSCSCHLPQAFASSMLVQSEKFVVGPLYKAGGADSQR  718

Query  194  QSVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRI  373
             SV TKFK QLFQLMQ+L++TTPHFI CIKPN  Q PG++E+ LVLQQLR  GV E VRI
Sbjct  719  LSVATKFKGQLFQLMQRLESTTPHFIRCIKPNKVQSPGLYEQGLVLQQLRCCGVLEVVRI  778

Query  374  SRSGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRA  550
            SR G+PT+M HQ FA +YGF LL++   +DPLS  VA+L QFN+LPE+YQVGYTKL+ R 
Sbjct  779  SRFGFPTRMFHQKFARRYGFLLLEDIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFFRT  838

Query  551  GQVS  562
            GQ+ 
Sbjct  839  GQIG  842



>ref|XP_006370337.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
 gb|ERP66906.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
Length=1192

 Score =   221 bits (563),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 131/180 (73%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD +HSD IQLLSSC  +L KL + S    SQ        G     QSV 
Sbjct  680  YDTNGFLEKNRDPMHSDFIQLLSSCGCQLLKLASPS----SQ------FGGSESSMQSVG  729

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            TKFK QLF+LM QL+ TTPHFI CIKPN KQLPG +E +LV +QLR  GV E VRISRSG
Sbjct  730  TKFKSQLFKLMHQLEKTTPHFIRCIKPNAKQLPGQYEDDLVSKQLRCCGVLEVVRISRSG  789

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ FA +YGFLL + NV +DPLS  VAVLK FNVLPE+YQVGYTK+YLR GQ+ 
Sbjct  790  YPTRMTHQEFAGRYGFLLPETNVSQDPLSLSVAVLKNFNVLPEMYQVGYTKVYLRMGQIG  849



>ref|XP_011044539.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044540.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044541.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044543.1| PREDICTED: myosin-2 [Populus euphratica]
Length=1197

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 132/180 (73%), Gaps = 11/180 (6%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLYPQKQSVV  205
            YD NGF EKNRD +HSD IQLLSSC  +L KL + S    SQ        G  P  QSV 
Sbjct  685  YDTNGFLEKNRDPMHSDFIQLLSSCGCQLLKLASPS----SQ------FGGSEPSMQSVG  734

Query  206  TKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISRSG  385
            T+FK QLF+LM QL+ TTPHFI CIKPN KQLPG +E +LV +QLR  GV E VRISRSG
Sbjct  735  TEFKSQLFKLMHQLEKTTPHFIRCIKPNAKQLPGQYEDDLVSKQLRCCGVLEVVRISRSG  794

Query  386  YPTKMTHQYFADKYGFLL-DNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQVS  562
            YPT+MTHQ FA +YGFLL + N+ +DPLS  VAVLK FNVLPE+YQVGYTK+YLR GQ+ 
Sbjct  795  YPTRMTHQDFAGRYGFLLPETNLSQDPLSLSVAVLKNFNVLPEMYQVGYTKVYLRMGQIG  854



>ref|XP_002463024.1| hypothetical protein SORBIDRAFT_02g036390 [Sorghum bicolor]
 gb|EER99545.1| hypothetical protein SORBIDRAFT_02g036390 [Sorghum bicolor]
Length=1103

 Score =   221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQKSSPILLDGLY-PQKQS  199
            +YD  GF EKNRD LHS+ IQLLSSC   LPK FA+ ++  SQ  S +    +   QKQS
Sbjct  713  TYDTAGFLEKNRDPLHSESIQLLSSCKCELPKHFASVMVADSQNKSSLSWHSVMDTQKQS  772

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
            VVTKFK QLF+LMQQL++TTPHFI CI+PN+KQ P +FE +LVL QL+  GV E VRISR
Sbjct  773  VVTKFKAQLFKLMQQLESTTPHFIRCIQPNSKQHPRLFEHDLVLHQLKCCGVLEVVRISR  832

Query  380  SGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            + YPT++THQ FA++YGFLL  +V  +DPLS  +AVL+Q N+ PE+YQVGYTKL+ R GQ
Sbjct  833  TCYPTRITHQQFAERYGFLLLRSVASQDPLSVSIAVLQQLNIPPEMYQVGYTKLFFRTGQ  892

Query  557  VS  562
            V+
Sbjct  893  VA  894



>ref|XP_009334587.1| PREDICTED: myosin-2 isoform X4 [Pyrus x bretschneideri]
Length=993

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 140/183 (77%), Gaps = 3/183 (2%)
 Frame = +2

Query  26   YDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQK--SSPILLDGLYPQKQS  199
            YD +GF EKNRD L S  +QLLSSCS RL +LF +  L Q QK  +    +D L P K S
Sbjct  672  YDTSGFLEKNRDKLPSIFVQLLSSCSCRLLQLFTSKELKQFQKPENDSCQIDALDPSKSS  731

Query  200  VVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRISR  379
               +FK QLF+LM QL+++ PHFI CIKPN+KQLPG++E  LVLQQLR  GV E VRISR
Sbjct  732  ACIEFKGQLFKLMHQLESSKPHFISCIKPNSKQLPGMYEVNLVLQQLRCCGVLEVVRISR  791

Query  380  SGYPTKMTHQYFADKYGF-LLDNNVFRDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAGQ  556
            SGYPT+MTHQ FA +YGF LL++++ +DPLS  +A+LK+F+VLPE+YQ+GYTK++LR GQ
Sbjct  792  SGYPTRMTHQEFAGRYGFLLLEDDLPQDPLSLSIAILKRFSVLPEMYQIGYTKVFLRTGQ  851

Query  557  VSN  565
            +++
Sbjct  852  IAS  854



>gb|EMT12170.1| Myosin-J heavy chain [Aegilops tauschii]
Length=1293

 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 6/192 (3%)
 Frame = +2

Query  23   SYDNNGFSEKNRDVLHSDIIQLLSSCSTRLPKLFATSLLDQSQ--KSSPILLDGLYPQKQ  196
            +YD +GF EKNRD+LH D IQ L+ C   +P+ FA+ +L QS   +S P        QK 
Sbjct  739  AYDTSGFLEKNRDLLHMDSIQFLAKCKLSIPQTFASKMLAQSDNLESVPYRPSVADSQKL  798

Query  197  SVVTKFKVQLFQLMQQLDNTTPHFICCIKPNNKQLPGVFEKELVLQQLRYSGVFEAVRIS  376
            SV  KFK QLFQLMQ+L++TTPHFI CIKPNN QLP ++ +ELVLQQL+  GV E VRIS
Sbjct  799  SVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYGQELVLQQLKCCGVLEVVRIS  858

Query  377  RSGYPTKMTHQYFADKYGFLLDNNVF-RDPLSTVVAVLKQFNVLPELYQVGYTKLYLRAG  553
            RSGYPT+MTHQ FA +YGFLL  +V  +DPLS  VA+L QFN+LPE+YQVGYTKL+ R G
Sbjct  859  RSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG  918

Query  554  QVSNELWSMFHS  589
            Q     W   HS
Sbjct  919  QFE---WLSIHS  927



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616