BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4381

Length=1263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...    621   0.0      Nicotiana sylvestris
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...    620   0.0      Nicotiana tomentosiformis
ref|XP_011095354.1|  PREDICTED: eukaryotic translation initiation...    620   0.0      Sesamum indicum [beniseed]
ref|XP_003517705.1|  PREDICTED: eukaryotic translation initiation...    619   0.0      Glycine max [soybeans]
ref|XP_012072406.1|  PREDICTED: eukaryotic translation initiation...    619   0.0      Jatropha curcas
ref|XP_002521889.1|  eukaryotic translation initiation factor 3 s...    617   0.0      Ricinus communis
ref|XP_008220972.1|  PREDICTED: eukaryotic translation initiation...    615   0.0      Prunus mume [ume]
ref|XP_008443373.1|  PREDICTED: eukaryotic translation initiation...    615   0.0      Cucumis melo [Oriental melon]
ref|XP_004136687.1|  PREDICTED: eukaryotic translation initiation...    615   0.0      Cucumis sativus [cucumbers]
ref|XP_007157442.1|  hypothetical protein PHAVU_002G070400g             614   0.0      Phaseolus vulgaris [French bean]
ref|XP_007222666.1|  hypothetical protein PRUPE_ppa008567mg             613   0.0      Prunus persica
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...    613   0.0      Nicotiana sylvestris
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...    612   0.0      Cicer arietinum [garbanzo]
ref|XP_010062244.1|  PREDICTED: eukaryotic translation initiation...    611   0.0      Eucalyptus grandis [rose gum]
ref|XP_008340535.1|  PREDICTED: eukaryotic translation initiation...    611   0.0      Malus domestica [apple tree]
gb|AES67165.2|  eukaryotic translation initiation factor 3 subunit I    610   0.0      Medicago truncatula
ref|XP_009351622.1|  PREDICTED: eukaryotic translation initiation...    610   0.0      Pyrus x bretschneideri [bai li]
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...    609   0.0      Solanum tuberosum [potatoes]
ref|XP_008389128.1|  PREDICTED: eukaryotic translation initiation...    608   0.0      
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...    608   0.0      Cicer arietinum [garbanzo]
gb|EYU22708.1|  hypothetical protein MIMGU_mgv1a009949mg                607   0.0      Erythranthe guttata [common monkey flower]
ref|XP_007016708.1|  Transducin/WD40 repeat-like superfamily prot...    606   0.0      
ref|XP_010557463.1|  PREDICTED: eukaryotic translation initiation...    605   0.0      Tarenaya hassleriana [spider flower]
ref|XP_006591952.1|  PREDICTED: eukaryotic translation initiation...    605   0.0      Glycine max [soybeans]
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...    604   0.0      Solanum lycopersicum
gb|EYU22777.1|  hypothetical protein MIMGU_mgv1a009964mg                603   0.0      Erythranthe guttata [common monkey flower]
ref|XP_006448047.1|  hypothetical protein CICLE_v10015917mg             603   0.0      Citrus clementina [clementine]
ref|XP_002285281.1|  PREDICTED: eukaryotic translation initiation...    602   0.0      Vitis vinifera
ref|XP_008350825.1|  PREDICTED: eukaryotic translation initiation...    602   0.0      
ref|XP_003534423.1|  PREDICTED: eukaryotic translation initiation...    600   0.0      Glycine max [soybeans]
gb|KHG16392.1|  Eukaryotic translation initiation factor 3 subuni...    599   0.0      Gossypium arboreum [tree cotton]
ref|XP_003596914.1|  Eukaryotic translation initiation factor 3 s...    598   0.0      
gb|ABK94219.1|  unknown                                                 598   0.0      Populus trichocarpa [western balsam poplar]
gb|KJB56100.1|  hypothetical protein B456_009G106100                    597   0.0      Gossypium raimondii
gb|EPS73291.1|  hypothetical protein M569_01462                         597   0.0      Genlisea aurea
ref|XP_010521568.1|  PREDICTED: eukaryotic translation initiation...    596   0.0      Tarenaya hassleriana [spider flower]
gb|KJB26172.1|  hypothetical protein B456_004G228300                    596   0.0      Gossypium raimondii
ref|XP_010937470.1|  PREDICTED: eukaryotic translation initiation...    595   0.0      Elaeis guineensis
ref|XP_002311556.2|  TGF-beta receptor-interacting protein 1            594   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010926275.1|  PREDICTED: eukaryotic translation initiation...    594   0.0      Elaeis guineensis
emb|CDP20306.1|  unnamed protein product                                593   0.0      Coffea canephora [robusta coffee]
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...    597   0.0      
gb|EPS65969.1|  hypothetical protein M569_08807                         592   0.0      Genlisea aurea
ref|XP_010249002.1|  PREDICTED: eukaryotic translation initiation...    592   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_011021700.1|  PREDICTED: eukaryotic translation initiation...    592   0.0      Populus euphratica
ref|XP_010275011.1|  PREDICTED: eukaryotic translation initiation...    591   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...    590   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011024978.1|  PREDICTED: eukaryotic translation initiation...    590   0.0      Populus euphratica
ref|XP_008808069.1|  PREDICTED: eukaryotic translation initiation...    587   0.0      Phoenix dactylifera
ref|XP_008782131.1|  PREDICTED: eukaryotic translation initiation...    585   0.0      Phoenix dactylifera
ref|XP_011627263.1|  PREDICTED: eukaryotic translation initiation...    585   0.0      
ref|XP_009151956.1|  PREDICTED: eukaryotic translation initiation...    580   0.0      Brassica rapa
gb|KFK37423.1|  hypothetical protein AALP_AA4G255300                    578   0.0      Arabis alpina [alpine rockcress]
ref|XP_009129412.1|  PREDICTED: eukaryotic translation initiation...    577   0.0      Brassica rapa
ref|XP_010425732.1|  PREDICTED: eukaryotic translation initiation...    576   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_004297796.1|  PREDICTED: eukaryotic translation initiation...    574   0.0      Fragaria vesca subsp. vesca
ref|XP_010514644.1|  PREDICTED: eukaryotic translation initiation...    573   0.0      Camelina sativa [gold-of-pleasure]
gb|ABR18068.1|  unknown                                                 573   0.0      Picea sitchensis
gb|ABK26793.1|  unknown                                                 573   0.0      Picea sitchensis
ref|XP_010502959.1|  PREDICTED: eukaryotic translation initiation...    573   0.0      Camelina sativa [gold-of-pleasure]
emb|CDY34145.1|  BnaA02g28950D                                          572   0.0      Brassica napus [oilseed rape]
ref|XP_002315834.2|  TGF-beta receptor-interacting protein 1            572   0.0      
emb|CDY13713.1|  BnaA06g32100D                                          568   0.0      Brassica napus [oilseed rape]
ref|XP_006395439.1|  hypothetical protein EUTSA_v10004580mg             567   0.0      Eutrema salsugineum [saltwater cress]
ref|NP_182152.2|  transducin/WD40 repeat-like superfamily protein       568   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY03970.1|  BnaC02g36850D                                          580   0.0      
dbj|BAC43524.1|  putative eukaryotic translation initiation facto...    565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294579.1|  hypothetical protein CARUB_v10023615mg             564   0.0      Capsella rubella
gb|AAC62877.1|  eukaryotic translation initiation factor 3 delta ...    564   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY71621.1|  BnaAnng38210D                                          565   0.0      Brassica napus [oilseed rape]
gb|AIZ68198.1|  eukaryotic translation initiation factor 3 subuni...    560   0.0      Ornithogalum longebracteatum [sea-onion]
gb|KDO58631.1|  hypothetical protein CISIN_1g020461mg                   559   0.0      Citrus sinensis [apfelsine]
ref|XP_006448046.1|  hypothetical protein CICLE_v10015917mg             558   0.0      
ref|XP_002882056.1|  TGF-beta receptor interacting protein 1            559   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_010678072.1|  PREDICTED: eukaryotic translation initiation...    553   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002862549.1|  eukaryotic translation initiation factor 3 d...    553   0.0      
ref|XP_010506629.1|  PREDICTED: eukaryotic translation initiation...    554   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010508042.1|  PREDICTED: eukaryotic translation initiation...    553   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_182151.1|  TGF-beta receptor interacting protein 1               551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882057.1|  hypothetical protein ARALYDRAFT_322284             551   0.0      
gb|AAK43862.1|AF370485_1  eukaryotic translation initiation facto...    548   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001061508.1|  Os08g0308100                                       547   0.0      
ref|XP_001757566.1|  predicted protein                                  546   0.0      
ref|NP_001055036.1|  Os05g0256000                                       546   0.0      
dbj|BAH19940.1|  AT2G46280                                              545   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147501.1|  eukaryotic translation initiation factor 3 s...    543   0.0      Zea mays [maize]
gb|AAG53616.1|AF285835_1  eukaryotic initiation factor 3I1 subunit      543   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577379.1|  PREDICTED: eukaryotic translation initiation...    543   0.0      Brachypodium distachyon [annual false brome]
ref|XP_008670966.1|  PREDICTED: eukaryotic translation initiation...    542   0.0      Zea mays [maize]
dbj|BAJ85385.1|  predicted protein                                      541   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFM95335.1|  eukaryotic translation initiation factor 3 subunit i    541   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_004955547.1|  PREDICTED: eukaryotic translation initiation...    541   0.0      Setaria italica
ref|XP_002461510.1|  hypothetical protein SORBIDRAFT_02g003760          538   0.0      Sorghum bicolor [broomcorn]
ref|XP_001763986.1|  predicted protein                                  537   0.0      
ref|XP_001758941.1|  predicted protein                                  536   0.0      
gb|AAC49079.1|  TGF-beta receptor interacting protein 1 homolog         535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383             522   0.0      Selaginella moellendorffii
gb|EAZ42270.1|  hypothetical protein OsJ_26838                          518   2e-179   Oryza sativa Japonica Group [Japonica rice]
gb|KCW69348.1|  hypothetical protein EUGRSUZ_F02830                     513   3e-179   Eucalyptus grandis [rose gum]
ref|XP_006663589.1|  PREDICTED: eukaryotic translation initiation...    503   8e-175   
gb|KJB56102.1|  hypothetical protein B456_009G106100                    499   5e-173   Gossypium raimondii
ref|XP_007215753.1|  hypothetical protein PRUPE_ppa009367mg             486   2e-168   
gb|KDO58633.1|  hypothetical protein CISIN_1g020461mg                   471   1e-162   Citrus sinensis [apfelsine]
gb|KJB56101.1|  hypothetical protein B456_009G106100                    471   2e-162   Gossypium raimondii
ref|XP_006395438.1|  hypothetical protein EUTSA_v10004580mg             468   4e-161   
gb|EMS51995.1|  Eukaryotic translation initiation factor 3 subunit I    459   4e-157   Triticum urartu
gb|KDO58632.1|  hypothetical protein CISIN_1g020461mg                   452   7e-155   Citrus sinensis [apfelsine]
gb|KJB56103.1|  hypothetical protein B456_009G106100                    451   8e-155   Gossypium raimondii
ref|XP_010275012.1|  PREDICTED: eukaryotic translation initiation...    447   1e-153   Nelumbo nucifera [Indian lotus]
gb|KJB56104.1|  hypothetical protein B456_009G106100                    443   8e-152   Gossypium raimondii
gb|KJB26173.1|  hypothetical protein B456_004G228300                    441   4e-151   Gossypium raimondii
ref|XP_001418365.1|  predicted protein                                  443   5e-151   Ostreococcus lucimarinus CCE9901
ref|XP_003079673.1|  TGF-beta receptor-interacting protein 1 (ISS)      441   6e-150   Ostreococcus tauri
ref|XP_002500789.1|  predicted protein                                  437   1e-148   Micromonas commoda
ref|XP_003059370.1|  predicted protein                                  436   6e-148   Micromonas pusilla CCMP1545
ref|XP_007512918.1|  predicted protein                                  418   6e-141   Bathycoccus prasinos
gb|EEC83341.1|  hypothetical protein OsI_28738                          405   3e-137   Oryza sativa Indica Group [Indian rice]
gb|KCW69349.1|  hypothetical protein EUGRSUZ_F02830                     397   5e-134   Eucalyptus grandis [rose gum]
ref|NP_973697.1|  TGF-beta receptor interacting protein 1               396   2e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005647023.1|  TGF-beta receptor-interacting protein 1            393   2e-131   Coccomyxa subellipsoidea C-169
gb|KHN14569.1|  Eukaryotic translation initiation factor 3 subunit I    389   3e-131   Glycine soja [wild soybean]
gb|ETO77218.1|  hypothetical protein F444_07544                         386   1e-128   Phytophthora parasitica P1976
ref|XP_008904158.1|  hypothetical protein PPTG_10533                    386   2e-128   Phytophthora parasitica INRA-310
ref|XP_009538303.1|  hypothetical protein PHYSODRAFT_551045             384   1e-127   Phytophthora sojae
gb|KHN32457.1|  Eukaryotic translation initiation factor 3 subunit I    379   2e-127   Glycine soja [wild soybean]
ref|XP_002899797.1|  eukaryotic translation initiation factor 3 s...    382   5e-127   Phytophthora infestans T30-4
ref|XP_011401093.1|  Eukaryotic translation initiation factor 3 s...    381   2e-126   Auxenochlorella protothecoides
emb|CDP11515.1|  unnamed protein product                                369   1e-123   Coffea canephora [robusta coffee]
ref|XP_001693266.1|  eukaryotic initiation factor                       372   6e-123   Chlamydomonas reinhardtii
gb|KIZ03352.1|  Eukaryotic translation initiation factor 3 subunit I    371   1e-122   Monoraphidium neglectum
ref|XP_008808070.1|  PREDICTED: eukaryotic translation initiation...    362   5e-120   Phoenix dactylifera
ref|XP_002957235.1|  eukaryotic translation initiation factor 3i        363   1e-119   Volvox carteri f. nagariensis
emb|CCA18540.1|  eukaryotic translation initiation factor 3 subun...    357   6e-117   Albugo laibachii Nc14
ref|XP_008613397.1|  translation initiation factor 3 subunit I          352   2e-115   Saprolegnia diclina VS20
ref|XP_009821601.1|  hypothetical protein H257_00561                    352   2e-115   Aphanomyces astaci
ref|XP_008862518.1|  hypothetical protein H310_01239                    350   3e-114   Aphanomyces invadans
ref|XP_005535289.1|  eukaryotic translation initiation factor eIF...    348   2e-113   Cyanidioschyzon merolae strain 10D
ref|XP_005707349.1|  translation initiation factor eIF-3 subunit 2      347   3e-113   Galdieria sulphuraria
gb|ERN16446.1|  hypothetical protein AMTR_s00052p00194740               337   2e-110   Amborella trichopoda
gb|ACF82853.1|  unknown                                                 334   6e-110   Zea mays [maize]
gb|ACD65081.1|  eukaryotic translation initiation factor                333   1e-107   Forcipomyia taiwana
gb|ELU14583.1|  hypothetical protein CAPTEDRAFT_180537                  332   3e-107   Capitella teleta
ref|XP_002021487.1|  GL26537                                            332   4e-107   Drosophila persimilis
ref|XP_006471278.1|  PREDICTED: eukaryotic translation initiation...    326   4e-107   Citrus sinensis [apfelsine]
ref|XP_005761487.1|  hypothetical protein EMIHUDRAFT_438175             332   7e-107   Emiliania huxleyi CCMP1516
ref|XP_001968738.1|  GG24335                                            330   1e-106   Drosophila erecta
ref|NP_523478.1|  Trip1                                                 330   1e-106   Drosophila melanogaster
ref|XP_008549768.1|  PREDICTED: eukaryotic translation initiation...    330   1e-106   Microplitis demolitor
ref|XP_002078185.1|  GD22675                                            330   2e-106   Drosophila simulans
ref|XP_004364074.2|  Trip1-PA                                           330   2e-106   Capsaspora owczarzaki ATCC 30864
ref|XP_001965147.1|  GF23646                                            329   3e-106   
ref|XP_011337589.1|  PREDICTED: eukaryotic translation initiation...    328   4e-106   Ooceraea biroi
ref|XP_004341724.1|  eTGF-beta receptor-interacting protein, puta...    329   5e-106   Acanthamoeba castellanii str. Neff
emb|CCI46504.1|  unnamed protein product                                328   5e-106   Albugo candida
ref|XP_011254946.1|  PREDICTED: eukaryotic translation initiation...    328   5e-106   Camponotus floridanus
ref|XP_001656392.1|  AAEL013144-PA                                      328   9e-106   Aedes aegypti
ref|XP_011055583.1|  PREDICTED: eukaryotic translation initiation...    327   1e-105   Acromyrmex echinatior
ref|XP_011160448.1|  PREDICTED: eukaryotic translation initiation...    327   1e-105   Solenopsis invicta [imported red fire ant]
ref|XP_011638812.1|  PREDICTED: eukaryotic translation initiation...    327   2e-105   Pogonomyrmex barbatus
ref|XP_002088703.1|  Trip1                                              327   2e-105   
gb|KJE92223.1|  Trip1-PA                                                327   3e-105   Capsaspora owczarzaki ATCC 30864
ref|NP_001040433.1|  eukaryotic translation initiation factor 3 s...    326   4e-105   Bombyx mori [silk moth]
ref|XP_011314062.1|  PREDICTED: eukaryotic translation initiation...    326   5e-105   Fopius arisanus
ref|XP_011685676.1|  PREDICTED: eukaryotic translation initiation...    326   7e-105   Wasmannia auropunctata
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I      326   7e-105   Chondrus crispus [carageen]
ref|XP_001989068.1|  GH10244                                            325   1e-104   Drosophila grimshawi
ref|XP_011861038.1|  PREDICTED: eukaryotic translation initiation...    325   1e-104   Vollenhovia emeryi
gb|EFZ22632.1|  hypothetical protein SINV_00160                         325   1e-104   
ref|XP_001868509.1|  eukaryotic translation initiation factor 3 s...    325   1e-104   Culex quinquefasciatus
ref|NP_001279068.1|  eukaryotic translation initiation factor 3, ...    325   1e-104   Callorhinchus milii [Australian ghost shark]
ref|XP_006806095.1|  PREDICTED: eukaryotic translation initiation...    325   2e-104   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003443814.1|  PREDICTED: eukaryotic translation initiation...    325   2e-104   Oreochromis niloticus
ref|XP_011445956.1|  PREDICTED: eukaryotic translation initiation...    325   2e-104   Crassostrea gigas
ref|XP_011180318.1|  PREDICTED: eukaryotic translation initiation...    325   2e-104   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011198986.1|  PREDICTED: eukaryotic translation initiation...    324   2e-104   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005181692.1|  PREDICTED: eukaryotic translation initiation...    324   3e-104   Musca domestica
ref|XP_002051937.1|  GJ17275                                            323   4e-104   
ref|XP_005102454.1|  PREDICTED: eukaryotic translation initiation...    323   4e-104   Aplysia californica
ref|XP_002167671.1|  PREDICTED: eukaryotic translation initiation...    323   6e-104   Hydra vulgaris
ref|XP_011568982.1|  PREDICTED: eukaryotic translation initiation...    323   8e-104   Plutella xylostella [cabbage moth]
gb|EPY53170.1|  translation initiation factor eIF3i                     323   1e-103   Schizosaccharomyces cryophilus OY26
sp|B3MVL6.2|EIF3I_DROAN  RecName: Full=Eukaryotic translation ini...    322   1e-103   Drosophila ananassae
gb|ACQ58286.1|  Eukaryotic translation initiation factor 3 subunit I    322   1e-103   Anoplopoma fimbria
ref|XP_010902262.1|  PREDICTED: eukaryotic translation initiation...    322   1e-103   Esox lucius
gb|EKC38588.1|  Eukaryotic translation initiation factor 3 subunit I    322   1e-103   Crassostrea gigas
ref|XP_008553489.1|  PREDICTED: eukaryotic translation initiation...    322   2e-103   Microplitis demolitor
gb|ETN60290.1|  eukaryotic translation initiation factor 3 subunit      322   3e-103   Anopheles darlingi [American malaria mosquito]
ref|XP_002115720.1|  expressed hypothetical protein                     321   4e-103   Trichoplax adhaerens
ref|NP_001133273.1|  Eukaryotic translation initiation factor 3 s...    321   4e-103   Salmo salar
ref|XP_392780.2|  PREDICTED: eukaryotic translation initiation fa...    321   4e-103   Apis mellifera [bee]
ref|XP_004531427.1|  PREDICTED: eukaryotic translation initiation...    321   4e-103   Ceratitis capitata [medfly]
ref|XP_003228758.1|  PREDICTED: eukaryotic translation initiation...    321   4e-103   Anolis carolinensis [Carolina anole]
ref|XP_003707661.1|  PREDICTED: eukaryotic translation initiation...    321   5e-103   Megachile rotundata
ref|XP_316636.4|  AGAP006607-PA                                         321   5e-103   Anopheles gambiae str. PEST
ref|XP_005102453.1|  PREDICTED: eukaryotic translation initiation...    321   5e-103   
sp|B4NW98.2|EIF3I_DROYA  RecName: Full=Eukaryotic translation ini...    320   6e-103   Drosophila yakuba
ref|XP_012062135.1|  PREDICTED: eukaryotic translation initiation...    320   6e-103   Atta cephalotes
ref|XP_011145247.1|  PREDICTED: eukaryotic translation initiation...    321   6e-103   Harpegnathos saltator
gb|EGI64611.1|  Eukaryotic translation initiation factor 3 subunit I    320   6e-103   Acromyrmex echinatior
ref|XP_008294825.1|  PREDICTED: eukaryotic translation initiation...    320   6e-103   Stegastes partitus
ref|XP_002001737.1|  GI15375                                            320   7e-103   
ref|NP_001187527.1|  eukaryotic translation initiation factor 3 s...    320   7e-103   Ictalurus punctatus
ref|XP_007249463.1|  PREDICTED: eukaryotic translation initiation...    320   8e-103   Astyanax mexicanus [blind cave fish]
dbj|BAM18089.1|  eukaryotic translation initiation factor 3 subun...    320   8e-103   Papilio xuthus [Chinese swallowtail]
ref|NP_998155.1|  eukaryotic translation initiation factor 3 subu...    320   9e-103   Danio rerio [leopard danio]
gb|EPX75306.1|  translation initiation factor eIF3i                     320   1e-102   Schizosaccharomyces octosporus yFS286
gb|KDR14214.1|  hypothetical protein L798_11754                         320   2e-102   Zootermopsis nevadensis
ref|XP_004074467.1|  PREDICTED: eukaryotic translation initiation...    319   3e-102   Oryzias latipes [Japanese rice fish]
ref|XP_007563815.1|  PREDICTED: eukaryotic translation initiation...    319   3e-102   Poecilia formosa
ref|XP_001603140.1|  PREDICTED: eukaryotic translation initiation...    319   3e-102   Nasonia vitripennis
ref|XP_006676014.1|  hypothetical protein BATDEDRAFT_84729              319   3e-102   Batrachochytrium dendrobatidis JAM81
ref|XP_006274867.1|  PREDICTED: eukaryotic translation initiation...    318   4e-102   Alligator mississippiensis
emb|CDQ91911.1|  unnamed protein product                                319   4e-102   Oncorhynchus mykiss
ref|NP_001157867.1|  eukaryotic translation initiation factor 3 s...    318   5e-102   Gallus gallus [bantam]
ref|XP_005812506.1|  PREDICTED: eukaryotic translation initiation...    318   5e-102   Xiphophorus maculatus
ref|XP_003969003.1|  PREDICTED: eukaryotic translation initiation...    318   6e-102   Takifugu rubripes [tiger puffer]
sp|B4LUA5.2|EIF3I_DROVI  RecName: Full=Eukaryotic translation ini...    318   7e-102   Drosophila virilis
ref|XP_005058303.1|  PREDICTED: eukaryotic translation initiation...    318   7e-102   Ficedula albicollis
ref|NP_001157823.1|  eukaryotic translation initiation factor 3 s...    318   8e-102   Taeniopygia guttata
gb|ADO28015.1|  eukaryotic translation initiation factor 3 subunit i    318   9e-102   Ictalurus furcatus
ref|NP_001156064.1|  eukaryotic translation initiation factor 3 s...    318   1e-101   Acyrthosiphon pisum
gb|KFP00122.1|  Eukaryotic translation initiation factor 3 subunit I    317   1e-101   Calypte anna
ref|XP_008491107.1|  PREDICTED: eukaryotic translation initiation...    318   1e-101   Calypte anna
emb|CAF99511.1|  unnamed protein product                                317   1e-101   Tetraodon nigroviridis
gb|ACO09379.1|  Eukaryotic translation initiation factor 3 subunit 2    317   1e-101   Osmerus mordax
gb|KIO29603.1|  hypothetical protein M407DRAFT_167483                   318   1e-101   Tulasnella calospora MUT 4182
gb|EFN69223.1|  Eukaryotic translation initiation factor 3 subunit I    317   1e-101   Camponotus floridanus
ref|XP_010574327.1|  PREDICTED: eukaryotic translation initiation...    317   1e-101   Haliaeetus leucocephalus
ref|XP_005302240.1|  PREDICTED: eukaryotic translation initiation...    317   2e-101   Chrysemys picta bellii
ref|XP_010168387.1|  PREDICTED: eukaryotic translation initiation...    317   2e-101   Antrostomus carolinensis
ref|XP_003387873.1|  PREDICTED: eukaryotic translation initiation...    317   2e-101   
ref|XP_009283047.1|  PREDICTED: eukaryotic translation initiation...    317   2e-101   Aptenodytes forsteri
ref|XP_007170666.1|  PREDICTED: eukaryotic translation initiation...    317   3e-101   Balaenoptera acutorostrata scammoni
ref|XP_011582243.1|  PREDICTED: eukaryotic translation initiation...    317   3e-101   Aquila chrysaetos canadensis
gb|EOB00694.1|  Eukaryotic translation initiation factor 3 subunit I    316   3e-101   Anas platyrhynchos [duck]
gb|KFV75063.1|  Eukaryotic translation initiation factor 3 subunit I    316   4e-101   Picoides pubescens
ref|XP_006019466.1|  PREDICTED: eukaryotic translation initiation...    316   4e-101   Alligator sinensis
ref|XP_005239876.1|  PREDICTED: eukaryotic translation initiation...    316   4e-101   
ref|XP_003500685.1|  PREDICTED: eukaryotic translation initiation...    316   4e-101   Cricetulus griseus [Chinese hamsters]
gb|KFP75614.1|  Eukaryotic translation initiation factor 3 subunit I    316   5e-101   Acanthisitta chloris
gb|EFN80704.1|  Eukaryotic translation initiation factor 3 subunit I    316   5e-101   Harpegnathos saltator
ref|NP_001015781.1|  eukaryotic translation initiation factor 3 s...    316   5e-101   Xenopus tropicalis [western clawed frog]
ref|XP_009068306.1|  PREDICTED: eukaryotic translation initiation...    315   5e-101   Acanthisitta chloris
ref|XP_010721802.1|  PREDICTED: eukaryotic translation initiation...    317   6e-101   Meleagris gallopavo [common turkey]
ref|XP_010574326.1|  PREDICTED: eukaryotic translation initiation...    316   6e-101   Haliaeetus leucocephalus
ref|XP_009906815.1|  PREDICTED: eukaryotic translation initiation...    316   6e-101   Picoides pubescens
dbj|BAD96203.1|  eukaryotic translation initiation factor 3, subu...    315   6e-101   Homo sapiens [man]
ref|XP_003487069.1|  PREDICTED: eukaryotic translation initiation...    315   7e-101   Bombus impatiens
gb|ERZ95383.1|  hypothetical protein GLOINDRAFT_341253                  315   8e-101   
ref|XP_008633416.1|  PREDICTED: eukaryotic translation initiation...    315   8e-101   Corvus brachyrhynchos
gb|KFO60217.1|  Eukaryotic translation initiation factor 3 subunit I    315   9e-101   Corvus brachyrhynchos
dbj|BAA13849.1|  unnamed protein product                                315   1e-100   Schizosaccharomyces pombe
ref|XP_008419625.1|  PREDICTED: eukaryotic translation initiation...    315   1e-100   Poecilia reticulata
ref|XP_005020506.1|  PREDICTED: eukaryotic translation initiation...    316   1e-100   
ref|XP_009047818.1|  hypothetical protein LOTGIDRAFT_200332             315   1e-100   Lottia gigantea
ref|XP_007432017.1|  PREDICTED: eukaryotic translation initiation...    315   1e-100   Python bivittatus
ref|XP_005142501.1|  PREDICTED: eukaryotic translation initiation...    315   1e-100   Melopsittacus undulatus
ref|XP_003801293.1|  PREDICTED: eukaryotic translation initiation...    315   1e-100   
ref|NP_001280295.1|  uncharacterized protein LOC100162604               314   2e-100   Acyrthosiphon pisum
ref|XP_002066637.1|  GK24461                                            314   2e-100   
ref|NP_001087664.1|  eukaryotic translation initiation factor 3 s...    314   2e-100   Xenopus laevis [clawed frog]
gb|KFZ50593.1|  Eukaryotic translation initiation factor 3 subunit I    314   2e-100   Antrostomus carolinensis
ref|XP_008155232.1|  PREDICTED: eukaryotic translation initiation...    314   2e-100   Eptesicus fuscus
ref|XP_009579506.1|  PREDICTED: eukaryotic translation initiation...    314   2e-100   Fulmarus glacialis
ref|XP_008064944.1|  PREDICTED: eukaryotic translation initiation...    315   2e-100   
gb|AEE62555.1|  unknown                                                 314   2e-100   Dendroctonus ponderosae
ref|XP_003276408.2|  PREDICTED: eukaryotic translation initiation...    314   3e-100   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_011501372.1|  PREDICTED: eukaryotic translation initiation...    314   3e-100   Ceratosolen solmsi marchali
gb|KDD75202.1|  hypothetical protein H632_c812p0                        313   3e-100   Helicosporidium sp. ATCC 50920
ref|XP_004591787.1|  PREDICTED: eukaryotic translation initiation...    314   3e-100   
ref|XP_006094311.1|  PREDICTED: eukaryotic translation initiation...    313   3e-100   Myotis lucifugus
gb|AAV38402.1|  eukaryotic translation initiation factor 3, subun...    313   3e-100   synthetic construct
ref|NP_003748.1|  eukaryotic translation initiation factor 3 subu...    313   3e-100   Homo sapiens [man]
ref|XP_009646824.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    313   4e-100   Egretta garzetta
ref|XP_002921914.2|  PREDICTED: eukaryotic translation initiation...    315   4e-100   Ailuropoda melanoleuca
ref|XP_008330273.1|  PREDICTED: eukaryotic translation initiation...    315   4e-100   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_594958.1|  translation initiation factor eIF3i                   313   5e-100   Schizosaccharomyces pombe
ref|XP_006862226.1|  PREDICTED: eukaryotic translation initiation...    313   5e-100   Chrysochloris asiatica
ref|NP_061269.1|  eukaryotic translation initiation factor 3 subu...    313   5e-100   Mus musculus [mouse]
ref|NP_001231553.1|  eukaryotic translation initiation factor 3, ...    313   5e-100   
gb|KFM11279.1|  Eukaryotic translation initiation factor 3 subunit I    313   5e-100   
gb|EHJ63876.1|  eukaryotic translation initiation factor 3 subunit I    313   5e-100   
ref|XP_008330275.1|  PREDICTED: eukaryotic translation initiation...    313   5e-100   
ref|XP_008330274.1|  PREDICTED: eukaryotic translation initiation...    313   5e-100   
ref|NP_001015628.1|  eukaryotic translation initiation factor 3 s...    313   6e-100   
ref|XP_005878403.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    314   6e-100   
gb|KFM68458.1|  Eukaryotic translation initiation factor 3 subunit I    313   6e-100   
gb|EPQ15220.1|  Eukaryotic translation initiation factor 3 subunit I    313   6e-100   
ref|XP_004406473.1|  PREDICTED: eukaryotic translation initiation...    313   7e-100   
ref|XP_006117620.1|  PREDICTED: eukaryotic translation initiation...    313   7e-100   
gb|KFQ08008.1|  Eukaryotic translation initiation factor 3 subunit I    313   8e-100   
ref|XP_005317802.1|  PREDICTED: eukaryotic translation initiation...    312   9e-100   
ref|NP_001108507.1|  eukaryotic translation initiation factor 3 s...    312   9e-100   
ref|XP_007125162.1|  PREDICTED: eukaryotic translation initiation...    312   9e-100   
ref|XP_006895022.1|  PREDICTED: eukaryotic translation initiation...    312   9e-100   
ref|XP_007948641.1|  PREDICTED: eukaryotic translation initiation...    312   1e-99    
gb|AAX36269.1|  eukaryotic translation initiation factor 3 subuni...    312   1e-99    
gb|ACH44280.1|  putative eukaryotic translation initiation factor...    312   1e-99    
ref|XP_007492943.1|  PREDICTED: eukaryotic translation initiation...    312   1e-99    
ref|XP_005395112.1|  PREDICTED: eukaryotic translation initiation...    313   1e-99    
ref|XP_010619869.1|  PREDICTED: eukaryotic translation initiation...    312   1e-99    
gb|KFB49333.1|  AGAP006607-PA-like protein                              313   1e-99    
ref|XP_004603791.1|  PREDICTED: eukaryotic translation initiation...    312   2e-99    
ref|XP_008210954.1|  PREDICTED: eukaryotic translation initiation...    311   2e-99    
ref|XP_004705070.1|  PREDICTED: eukaryotic translation initiation...    311   2e-99    
gb|AAI27353.1|  eif3s2 protein                                          311   3e-99    
gb|EHB12852.1|  Eukaryotic translation initiation factor 3 subunit I    312   3e-99    
gb|AAX41399.1|  eukaryotic translation initiation factor 3 subuni...    311   3e-99    
gb|EFB27372.1|  hypothetical protein PANDA_010855                       311   3e-99    
gb|EDL30181.1|  eukaryotic translation initiation factor 3, subun...    311   4e-99    
ref|XP_004266574.1|  PREDICTED: eukaryotic translation initiation...    311   4e-99    
ref|XP_967415.1|  PREDICTED: eukaryotic translation initiation fa...    311   4e-99    
gb|EFX80147.1|  hypothetical protein DAPPUDRAFT_304176                  311   4e-99    
gb|ELR48735.1|  Eukaryotic translation initiation factor 3 subunit I    311   4e-99    
ref|XP_007399384.1|  hypothetical protein PHACADRAFT_261788             311   5e-99    
ref|XP_005139430.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    312   5e-99    
ref|XP_009013860.1|  hypothetical protein HELRODRAFT_185422             310   6e-99    
ref|XP_004372060.1|  PREDICTED: eukaryotic translation initiation...    313   6e-99    
ref|XP_003765492.1|  PREDICTED: eukaryotic translation initiation...    312   6e-99    
gb|KFW07927.1|  Eukaryotic translation initiation factor 3 subunit I    310   6e-99    
gb|KFP10887.1|  Eukaryotic translation initiation factor 3 subunit I    310   7e-99    
ref|XP_007092475.1|  PREDICTED: eukaryotic translation initiation...    310   7e-99    
dbj|BAE42882.1|  unnamed protein product                                310   7e-99    
ref|NP_001126286.1|  eukaryotic translation initiation factor 3 s...    310   1e-98    
ref|XP_008079360.1|  WD40 repeat-like protein                           310   1e-98    
ref|XP_006054762.1|  PREDICTED: eukaryotic translation initiation...    312   1e-98    
ref|XP_004900249.1|  PREDICTED: eukaryotic translation initiation...    311   2e-98    
ref|XP_004485231.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    311   3e-98    
ref|XP_007363750.1|  WD40 repeat-like protein                           309   3e-98    
ref|XP_006994436.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    309   3e-98    
ref|XP_006777450.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    310   3e-98    
ref|XP_001639587.1|  predicted protein                                  308   3e-98    
gb|EFN80705.1|  Eukaryotic translation initiation factor 3 subunit I    308   3e-98    
gb|KHJ35878.1|  putative eukaryotic translation initiation factor 3     309   3e-98    
ref|XP_535328.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic tran...    310   3e-98    
ref|XP_001503867.4|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    309   3e-98    
emb|CEP61303.1|  LALA0S02e11386g1_1                                     309   3e-98    
gb|EHH14557.1|  hypothetical protein EGK_00504                          308   5e-98    
emb|CCG84178.1|  protein of unknown function                            308   6e-98    
ref|XP_004679476.1|  PREDICTED: eukaryotic translation initiation...    308   6e-98    
emb|CDS04160.1|  hypothetical protein LRAMOSA07115                      308   7e-98    
gb|KIM93051.1|  hypothetical protein OIDMADRAFT_107011                  308   7e-98    
ref|XP_005823889.1|  translation initiation factor 3, subunit I         307   8e-98    
ref|XP_002840508.1|  hypothetical protein                               307   1e-97    
gb|KFH67131.1|  translation initiation factor eIF-3 subunit 2           307   1e-97    
gb|ELK02020.1|  Eukaryotic translation initiation factor 3 subunit I    313   1e-97    
ref|XP_007468733.1|  PREDICTED: eukaryotic translation initiation...    311   2e-97    
emb|CDH49815.1|  eukaryotic translation initiation factor 3subunit      306   3e-97    
ref|XP_004850898.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    308   4e-97    
ref|XP_003844805.1|  similar to eukaryotic translation initiation...    306   6e-97    
gb|KIW74742.1|  eukaryotic translation initiation factor 3 subunit I    305   8e-97    
ref|XP_001903926.1|  hypothetical protein                               305   1e-96    
ref|XP_009708532.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    305   1e-96    
gb|KIM30962.1|  hypothetical protein M408DRAFT_327876                   304   2e-96    
ref|XP_008692694.1|  PREDICTED: eukaryotic translation initiation...    304   2e-96    
gb|ACO13175.1|  Eukaryotic translation initiation factor 3 subunit I    303   3e-96    
gb|ACO10455.1|  Eukaryotic translation initiation factor 3 subunit I    303   4e-96    
ref|XP_007873769.1|  hypothetical protein PNEG_01801                    303   4e-96    
ref|XP_006901315.1|  PREDICTED: eukaryotic translation initiation...    303   5e-96    
ref|XP_009882825.1|  PREDICTED: eukaryotic translation initiation...    303   6e-96    
ref|XP_007680736.1|  hypothetical protein BAUCODRAFT_286498             303   7e-96    
gb|KGL92853.1|  Eukaryotic translation initiation factor 3 subunit I    302   8e-96    
ref|XP_008723623.1|  eukaryotic translation initiation factor 3 s...    302   1e-95    
ref|XP_002122597.1|  PREDICTED: eukaryotic translation initiation...    301   1e-95    
gb|KIW69713.1|  eukaryotic translation initiation factor 3 subunit I    302   1e-95    
ref|XP_002431936.1|  eukaryotic translation initiation factor 3 s...    301   2e-95    
ref|NP_001075647.1|  eukaryotic translation initiation factor 3 s...    302   2e-95    
emb|CDR44437.1|  CYFA0S14e02718g1_1                                     302   2e-95    
gb|EMD39788.1|  hypothetical protein CERSUDRAFT_112055                  301   2e-95    
gb|EIF45267.1|  eukaryotic translation initiation factor 3 subunit      302   2e-95    
ref|XP_007755968.1|  eukaryotic translation initiation factor 3 s...    301   3e-95    
gb|ACO15193.1|  Eukaryotic translation initiation factor 3 subunit I    300   4e-95    
gb|KDQ15156.1|  hypothetical protein BOTBODRAFT_55005                   302   4e-95    
ref|XP_001557202.1|  eukaryotic translation initiation factor 3         301   5e-95    
ref|XP_002556539.1|  KLTH0H15752p                                       301   5e-95    
ref|XP_002173377.1|  translation initiation factor eIF3i                300   5e-95    
gb|KDQ25934.1|  hypothetical protein PLEOSDRAFT_1066937                 300   6e-95    
gb|EIE82800.1|  hypothetical protein RO3G_07505                         301   7e-95    
gb|EJU03377.1|  WD40 repeat-like protein                                300   7e-95    
ref|XP_006694969.1|  eukaryotic translation initiation factor 3-l...    301   8e-95    
gb|KFX89447.1|  hypothetical protein V490_07014                         300   1e-94    
ref|XP_007350612.1|  WD40 repeat-like protein                           300   1e-94    
ref|XP_003650868.1|  hypothetical protein THITE_2110768                 300   1e-94    
emb|CCA68444.1|  probable TIF34-translation initiation factor eIF...    299   1e-94    
emb|CEP16495.1|  hypothetical protein                                   299   2e-94    
gb|KFY09000.1|  hypothetical protein V492_05712                         299   2e-94    
gb|KIX06858.1|  eukaryotic translation initiation factor 3 subunit I    299   3e-94    
ref|XP_007775247.1|  WD40 repeat-like protein                           298   3e-94    
gb|KIP10178.1|  hypothetical protein PHLGIDRAFT_101502                  298   3e-94    
ref|XP_008024458.1|  hypothetical protein SETTUDRAFT_168745             298   4e-94    
ref|XP_011273467.1|  hypothetical protein BN7_4251                      298   4e-94    
gb|KFY64993.1|  hypothetical protein V496_02881                         298   4e-94    
gb|KIW28535.1|  eukaryotic translation initiation factor 3 subunit I    298   5e-94    
gb|KIY02597.1|  eukaryotic translation initiation factor 3 subunit I    298   5e-94    
ref|XP_003396808.1|  PREDICTED: eukaryotic translation initiation...    297   5e-94    
emb|CEJ88530.1|  Putative Eukaryotic translation initiation facto...    298   6e-94    
ref|XP_001595804.1|  eukaryotic translation initiation factor 3         298   6e-94    
gb|KKA29507.1|  hypothetical protein TD95_001585                        298   6e-94    
gb|KEF62513.1|  eukaryotic translation initiation factor 3 subunit I    297   9e-94    
gb|KFZ10578.1|  hypothetical protein V501_05126                         297   1e-93    
ref|XP_007725205.1|  eukaryotic translation initiation factor 3 s...    297   1e-93    
gb|EPB87416.1|  eukaryotic translation initiation factor 3 subunit I    297   1e-93    
gb|EHK41282.1|  hypothetical protein TRIATDRAFT_301894                  297   1e-93    
ref|XP_003739333.1|  PREDICTED: eukaryotic translation initiation...    297   1e-93    
ref|XP_006963216.1|  predicted protein                                  297   1e-93    
ref|XP_010280277.1|  PREDICTED: eukaryotic translation initiation...    296   2e-93    
ref|XP_007380240.1|  WD40 repeat-like protein                           296   2e-93    
ref|XP_008712178.1|  eukaryotic translation initiation factor 3 s...    296   3e-93    
gb|ELR06011.1|  eukaryotic translation initiation factor 3 subunit I    296   3e-93    
gb|KFY29465.1|  hypothetical protein V491_00021                         296   4e-93    
ref|XP_007734179.1|  eukaryotic translation initiation factor 3 s...    296   4e-93    
gb|KEQ92579.1|  hypothetical protein AUEXF2481DRAFT_423089              296   4e-93    
ref|XP_003664486.1|  hypothetical protein MYCTH_2307366                 296   4e-93    
ref|XP_003686526.1|  hypothetical protein TPHA_0G02570                  296   4e-93    
gb|ESZ97118.1|  eukaryotic translation initiation factor 3 subunit 2    296   4e-93    
gb|KIW54434.1|  eukaryotic translation initiation factor 3 subunit I    296   5e-93    
dbj|GAD97183.1|  conserved hypothetical protein                         298   5e-93    
ref|XP_003686473.1|  hypothetical protein TPHA_0G02030                  296   5e-93    
ref|XP_003034029.1|  hypothetical protein SCHCODRAFT_66951              295   5e-93    
ref|XP_012046834.1|  translation initiation factor 3 subunit I          296   6e-93    
gb|KDN63708.1|  putative WD domain-containing protein                   295   6e-93    
ref|XP_001208970.1|  eukaryotic translation initiation factor 3 s...    295   6e-93    
gb|KJZ78717.1|  Eukaryotic translation initiation factor 3 subunit I    295   7e-93    
gb|KEQ86784.1|  putative eukaryotic translation initiation factor...    295   7e-93    
ref|XP_007748455.1|  eukaryotic translation initiation factor 3 s...    295   8e-93    
gb|KIJ17571.1|  hypothetical protein PAXINDRAFT_167576                  295   8e-93    
ref|XP_567255.1|  hypothetical protein                                  295   9e-93    
gb|KDQ62747.1|  hypothetical protein JAAARDRAFT_30657                   295   9e-93    
ref|XP_003051107.1|  predicted protein                                  295   9e-93    
ref|XP_009155937.1|  eukaryotic translation initiation factor 3 s...    295   1e-92    
emb|CDK24887.1|  unnamed protein product                                295   2e-92    
ref|XP_010295903.1|  PREDICTED: eukaryotic translation initiation...    294   2e-92    
ref|XP_006957701.1|  WD40 repeat-like protein                           294   2e-92    
ref|XP_002489628.1|  Subunit of the core complex of translation i...    294   2e-92    
gb|EPZ33787.1|  hypothetical protein O9G_004435                         293   2e-92    
ref|XP_001818333.1|  eukaryotic translation initiation factor 3 s...    294   2e-92    
dbj|GAN06336.1|  eukaryotic translation initiation factor 3             293   2e-92    
gb|KIV96617.1|  eukaryotic translation initiation factor 3 subunit I    294   2e-92    
gb|EFQ28334.1|  WD domain-containing protein                            294   3e-92    
gb|EWG40623.1|  eukaryotic translation initiation factor 3 subunit I    294   3e-92    
gb|KJK62700.1|  WD40 repeat protein                                     293   3e-92    
ref|XP_007844868.1|  eukaryotic translation initiation factor 3 s...    293   3e-92    
gb|EHK16486.1|  hypothetical protein TRIVIDRAFT_82783                   293   3e-92    
emb|CEI97063.1|  Putative Eukaryotic translation initiation facto...    293   3e-92    
ref|XP_007324107.1|  hypothetical protein SERLADRAFT_479895             293   3e-92    
emb|CEG69327.1|  Putative Eukaryotic translation initiation facto...    293   3e-92    
ref|XP_010759779.1|  eukaryotic translation initiation factor 3 s...    293   4e-92    
ref|XP_007304716.1|  WD40 repeat-like protein                           293   4e-92    
ref|XP_011356138.1|  PREDICTED: eukaryotic translation initiation...    293   4e-92    
gb|KEQ62058.1|  putative eukaryotic translation initiation factor...    293   6e-92    
gb|KIK83562.1|  hypothetical protein PAXRUDRAFT_832048                  293   6e-92    
gb|EFX03738.1|  eukaryotic translation initiation factor 3 subunit      293   7e-92    
gb|EMT63386.1|  Eukaryotic translation initiation factor 3 subunit I    293   7e-92    
gb|EMP28420.1|  Alpha-taxilin                                           313   8e-92    
ref|XP_003006338.1|  eukaryotic translation initiation factor 3 3...    292   9e-92    
ref|XP_003345898.1|  hypothetical protein SMAC_06299                    293   1e-91    
gb|KIO05317.1|  hypothetical protein M404DRAFT_15355                    292   1e-91    
ref|XP_007275339.1|  eukaryotic translation initiation factor 3 s...    292   1e-91    
ref|XP_001933019.1|  eukaryotic translation initiation factor 3 s...    292   1e-91    
emb|CDR46246.1|  RHTO0S12e02014g1_1                                     292   1e-91    
emb|CDS27796.1|  eukaryotic translation initiation factor 3             292   1e-91    
ref|XP_002488027.1|  eukaryotic translation initiation factor 3 s...    292   2e-91    
ref|XP_006003298.1|  PREDICTED: eukaryotic translation initiation...    290   2e-91    
ref|XP_007692855.1|  hypothetical protein COCMIDRAFT_108319             291   2e-91    
gb|KIL96311.1|  hypothetical protein FAVG1_01055                        291   2e-91    
gb|ERE85417.1|  eukaryotic translation initiation factor 3 subuni...    293   2e-91    
ref|XP_002286220.1|  predicted protein                                  291   2e-91    
gb|ENH79852.1|  eukaryotic translation initiation factor 3 39 kda...    291   2e-91    
gb|KIR86604.1|  eukaryotic translation initiation factor 3 subunit I    291   2e-91    
ref|XP_009254997.1|  hypothetical protein FPSE_03603                    291   2e-91    
gb|KIL66728.1|  hypothetical protein M378DRAFT_346878                   291   3e-91    
ref|XP_009216201.1|  eukaryotic translation initiation factor 3 3...    291   3e-91    
emb|CCK70464.1|  hypothetical protein KNAG_0E02020                      291   3e-91    
gb|KFH40680.1|  Eukaryotic translation initiation factor 3 subuni...    291   3e-91    
gb|KIK23476.1|  hypothetical protein PISMIDRAFT_453749                  291   3e-91    
ref|XP_002789752.1|  eukaryotic translation initiation factor 3 3...    291   3e-91    
dbj|GAM40932.1|  translation initiation factor                          291   3e-91    
emb|CCF41099.1|  eukaryotic translation initiation factor 3 subun...    291   3e-91    
ref|XP_007797965.1|  putative eukaryotic translation initiation f...    291   3e-91    
gb|KFA62828.1|  hypothetical protein S40285_03799                       291   4e-91    
gb|KIK69691.1|  hypothetical protein GYMLUDRAFT_34094                   290   4e-91    
ref|XP_009546467.1|  hypothetical protein HETIRDRAFT_147751             290   5e-91    
gb|AAY32924.1|  TGF-beta receptor interacting protein 1                 290   5e-91    
ref|XP_003191596.1|  hypothetical protein CGB_A6310C                    290   5e-91    
gb|KFO34423.1|  Eukaryotic translation initiation factor 3 subunit I    309   6e-91    
ref|XP_001226603.1|  conserved hypothetical protein                     290   6e-91    
ref|XP_007816213.1|  WD40 repeat 2                                      290   6e-91    
ref|XP_007814077.1|  eukaryotic translation initiation factor 3 s...    290   6e-91    
ref|XP_956549.1|  eukaryotic translation initiation factor 3 subu...    290   6e-91    
gb|EJT48020.1|  hypothetical protein A1Q1_02936                         290   6e-91    
ref|XP_660601.1|  hypothetical protein AN2997.2                         290   7e-91    
ref|XP_002153410.1|  eukaryotic translation initiation factor 3 s...    290   7e-91    
emb|CCX32511.1|  Similar to Eukaryotic translation initiation fac...    290   7e-91    
gb|ACO14914.1|  Eukaryotic translation initiation factor 3 subunit I    290   8e-91    
gb|KHN96372.1|  eukaryotic translation initiation factor 3 subunit 2    290   8e-91    
gb|KEQ76375.1|  eukaryotic translation initiation factor 3 subunit I    290   8e-91    
gb|KIW11246.1|  eukaryotic translation initiation factor 3 subunit I    290   8e-91    
gb|KDN45029.1|  Eukaryotic translation initiation factor 3 subunit I    290   8e-91    
gb|KJK77058.1|  Eukaryotic translation initiation factor 3 subunit I    290   8e-91    
gb|EHA23450.1|  hypothetical protein ASPNIDRAFT_207376                  290   8e-91    



>ref|XP_009777666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nicotiana sylvestris]
Length=326

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/326 (89%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI+ DP DQ GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+
Sbjct  121   AIHVKRISKDPSDQVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTM
Sbjct  181   LKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDHDYFNIKI  326



>ref|XP_009629813.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Nicotiana tomentosiformis]
Length=326

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/326 (89%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI+ DP DQ GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+
Sbjct  121   AIHVKRISRDPSDQIGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTM
Sbjct  181   LKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDHDYFNIKI  326



>ref|XP_011095354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Sesamum indicum]
Length=326

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/326 (90%), Positives = 311/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDVKTGT L+TFNFDSP RSVDFAVGD+LAV+TTDPFMGLPS
Sbjct  61    SRDSTRLITGSADQTAKLWDVKTGTPLYTFNFDSPARSVDFAVGDRLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+KRIA DPEDQTGESVL +KG QGRINRAVWGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121   AIHIKRIARDPEDQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDSVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSL+KS DGSHF+TGSLDKSAKLWDIRTL L+KTYVTERPVNAV M
Sbjct  181   LKESDKEDGHKKPITSLSKSTDGSHFLTGSLDKSAKLWDIRTLKLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_003517705.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/326 (89%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM LPS
Sbjct  61    SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA+DP +QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIANDPAEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_012072406.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Jatropha curcas]
 gb|KDP38201.1| hypothetical protein JCGZ_04844 [Jatropha curcas]
Length=326

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/326 (90%), Positives = 311/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TGTQL++FNFDSP R+VDF+VGDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADQTAKLWNVQTGTQLYSFNFDSPARAVDFSVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQTGESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPADQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAVTM
Sbjct  181   LKESDKEVGHKKTITSLTKSSDGSHFVTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_002521889.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF40525.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=326

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/326 (89%), Positives = 311/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYN+EGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNKEGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLWDVKTGTQL++FNFDSP R+VD +VGDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADQTAKLWDVKTGTQLYSFNFDSPARAVDLSVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP++QTGESVL +KG QGRINRAVWGPLNKTI+S GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPDNQTGESVLVLKGPQGRINRAVWGPLNKTILSAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAVTM
Sbjct  181   LKESDREIGHKKTITSLTKSSDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEE+GGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEVGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_008220972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Prunus mume]
Length=326

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/326 (88%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGD+LAV+TTDPFM L S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDRLAVITTDPFMELSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA+DP DQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFNIKI  326



>ref|XP_008443373.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis melo]
Length=326

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/326 (89%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QLF+FNFDSP R+VDF+VGDKLAV+TTDPF+ LPS
Sbjct  61    SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFSVGDKLAVITTDPFVELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QTGESVL +KG QGRINRAVWGPLNKTIISGGED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSL K+ DGSHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAVTM
Sbjct  181   LKESDKETGHKKTITSLTKASDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_004136687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cucumis sativus]
 gb|KGN59537.1| hypothetical protein Csa_3G824820 [Cucumis sativus]
Length=326

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/326 (89%), Positives = 310/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QLF+FNFDSP R+VDF+VGDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFSVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QTGESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK +TSL KS DGSHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAVTM
Sbjct  181   LKESDKEIGHKKTVTSLTKSSDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_007157442.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
 gb|AAK49947.1|AF335551_1 TGF-beta receptor-interacting protein 1 [Phaseolus vulgaris]
 gb|ESW29436.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
Length=326

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/326 (88%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM LPS
Sbjct  61    SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA+DP +QTG+SV+ +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIANDPTEQTGDSVVLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +KESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPVNAV M
Sbjct  181   IKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_007222666.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
 gb|EMJ23865.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
Length=326

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/326 (88%), Positives = 311/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VD +VGD+LAV+TTDPFM L S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDLSVGDRLAVITTDPFMELSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA+DP DQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFNIKI  326



>ref|XP_009777665.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nicotiana sylvestris]
Length=331

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/331 (88%), Positives = 312/331 (94%), Gaps = 5/331 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPED-----QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
             AIHVKRI+ DP D     + GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD 
Sbjct  121   AIHVKRISKDPSDRILCTEVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDV  180

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
             ETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPV
Sbjct  181   ETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPV  240

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
             NAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALA
Sbjct  241   NAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALA  300

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             FNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   FNPDGKSFSSGGEDGYVRLHHFDHDYFNIKI  331



>ref|XP_004492932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/326 (88%), Positives = 310/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V++G QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSGRLITGSADQTVKLWNVQSGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121   AIHVKRIAKDPADQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK +TSL KS DGSHF+TGSLDKSAKLWD RTL+L+KTYVTERPVNAV M
Sbjct  181   LKESDKESGHKKTVTSLVKSADGSHFLTGSLDKSAKLWDARTLSLVKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010062244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Eucalyptus grandis]
 gb|KCW69347.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=326

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/326 (87%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+ESD+E+GHKK +TSL KS+DGSHF+TGS DKSAKLWDIRTLTL+KTYVTERPVNAVTM
Sbjct  181   LRESDKETGHKKAVTSLMKSVDGSHFVTGSQDKSAKLWDIRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVT TDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_008340535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/326 (88%), Positives = 309/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIASDPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D E GHKK ITSLAKS+DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDPEVGHKKTITSLAKSVDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFNIKI  326



>gb|AES67165.2| eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=326

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/326 (88%), Positives = 308/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSLAKS DGSHF TGSLDKSAK+WD RTL+L+KTYVTERPVNAVTM
Sbjct  181   LKESDKELGHKKTITSLAKSADGSHFCTGSLDKSAKIWDSRTLSLVKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_009351622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pyrus x bretschneideri]
Length=326

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/326 (87%), Positives = 309/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIASDPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D E GHKK ITSLAKS+DG+HF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDPEVGHKKTITSLAKSVDGTHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLCDHVVLGGGQDASMVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFNIKI  326



>ref|XP_006351166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum tuberosum]
Length=326

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/326 (88%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT  LWDV+TGTQL TF FDSP RSVDF+VGDKLAV+TTDPFMGL S
Sbjct  61    SRDSSRLITGSADQTAMLWDVQTGTQLHTFTFDSPARSVDFSVGDKLAVITTDPFMGLTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI+ DP +Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+
Sbjct  121   AIHVKRISEDPSEQISESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTM
Sbjct  181   LKESDKEIGHKKGITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDQDYFNIKI  326



>ref|XP_008389128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/326 (88%), Positives = 307/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D E GHKK ITSLAKS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDPEVGHKKTITSLAKSXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYFHIKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFHIKI  326



>ref|XP_004489218.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/326 (87%), Positives = 311/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLWDV++G QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSGRLITGSADQTAKLWDVQSGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP+DQTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121   AIHVKRIAKDPKDQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK ITSLAKS DGSHF+TGSLDKS+KLWD RTL+L+KTYVTERPVNAV M
Sbjct  181   LKESDKESGHKKTITSLAKSADGSHFLTGSLDKSSKLWDARTLSLVKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVR+HHFD +Y++IKI
Sbjct  301   RSFSSGGEDGYVRVHHFDQEYYNIKI  326



>gb|EYU22708.1| hypothetical protein MIMGU_mgv1a009949mg [Erythranthe guttata]
Length=326

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/326 (88%), Positives = 308/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPT+WFADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTLWFADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+ LITGSADQT K+WDVKTGT LFTFNFDSP RSVDFAVGDKL V+TTDPFMGL S
Sbjct  61    SRDSTTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFAVGDKLVVITTDPFMGLSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+K +A+DP+DQTGESVL +KG QGRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121   AIHIKHVAADPDDQTGESVLVLKGPQGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSL+K+ DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKESDKEDGHKKPITSLSKATDGSHFLTGSLDKSAKLWDSRTLTLMKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   RSFSSGGEDGYVRLHHFDQDYFNIKI  326



>ref|XP_007016708.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016709.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34327.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34328.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/326 (87%), Positives = 308/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TGTQLFTFNFDSP RSVDFA+GDKLAV+TTDPFM L S
Sbjct  61    SRDSTRLITGSADQTAKLWNVQTGTQLFTFNFDSPARSVDFAIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI  D  +QTGESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRITRDATEQTGESVLVIKGPQGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSLAKS DGSHF+TGSLDKSAKLWD+RTLTL+KTYVTERPVNAV +
Sbjct  181   LREADKESGHKKPITSLAKSADGSHFLTGSLDKSAKLWDVRTLTLIKTYVTERPVNAVAL  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010557463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/326 (87%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYN++GDLLFSCAKDH PTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQTVKLWDV+TG  L+TFNF SP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSARLITGSADQTVKLWDVQTGKPLYTFNFGSPARSVDFAVGDKLAVITTDPFMDLSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DPEDQ  ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPEDQVAESVLVLKGVQGRINRAVWGPLNRTIISAGEDAVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSL K+ D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAVTM
Sbjct  181   LKESDKEAGHKKTITSLCKAADSSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+L EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKLLLEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYFHIK+
Sbjct  301   KSFSSGGEDGYVRLHHFDQDYFHIKV  326



>ref|XP_006591952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
 gb|ACU23631.1| unknown [Glycine max]
Length=326

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/326 (87%), Positives = 309/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV++G QL+TFNFDSP RSVDF+VGDKLAV+TTDPFM LPS
Sbjct  61    SRDSARLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFSVGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA+DP  Q GESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIANDPSQQIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+ESD+ESGHKK +TSLAKS D SHF+TGSLDKSA+LWD R+LTL+KTYVTERPVNAVTM
Sbjct  181   LQESDKESGHKKTVTSLAKSADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_004250371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum lycopersicum]
Length=326

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/326 (87%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT  LWDV+TG QL TF FDSP RSVDF+VGDKLAV+TTDPFMGL S
Sbjct  61    SRDSSRLITGSADQTAMLWDVQTGAQLHTFTFDSPARSVDFSVGDKLAVITTDPFMGLTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+K I+ DP +Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+
Sbjct  121   AIHIKNISKDPSEQMSESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKKGITSL KS+DGSHFITGSLDKSAKLWDIR+LTL+K Y TERPVNAVTM
Sbjct  181   LKESDKEIGHKKGITSLQKSVDGSHFITGSLDKSAKLWDIRSLTLIKNYTTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSFASGGEDGYVRLHHFD DYF+I+I
Sbjct  301   KSFASGGEDGYVRLHHFDQDYFNIRI  326



>gb|EYU22777.1| hypothetical protein MIMGU_mgv1a009964mg [Erythranthe guttata]
Length=326

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/326 (87%), Positives = 307/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSS LITGSADQT K+WDVKTGT LFTFNFDSP RSVDFAVGDKL V+TTDPFMGL S
Sbjct  61    SRDSSTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFAVGDKLVVITTDPFMGLSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+K +A+DP+DQTGES+L +KG QGRINRAVWGPLNKTIIS GEDS++R+WD+ETGKL
Sbjct  121   AIHIKPVAADPDDQTGESILVLKGPQGRINRAVWGPLNKTIISAGEDSIIRVWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GHKK ITSL+K+ D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKESDKEDGHKKPITSLSKATDVSHFLTGSLDKSAKLWDSRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   RSFSSGGEDGYVRLHHFDQDYFNIKI  326



>ref|XP_006448047.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 ref|XP_006492275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
 gb|ESR61287.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|KDO58630.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=326

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/326 (87%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121   AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTM
Sbjct  181   LKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_002285281.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vitis vinifera]
 emb|CAN80198.1| hypothetical protein VITISV_030908 [Vitis vinifera]
 emb|CBI26753.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 307/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVETGAQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP  QT ES L +KG QGRINRA+WGPLN+TIIS GED+++RIWD+ETGKL
Sbjct  121   AIHVKRIARDPSQQTAESALVIKGPQGRINRAIWGPLNRTIISAGEDAIVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK +TSL+K++DGSHF+TGSLDKSAKLWD RTLTL+KTY+TERPVNAVTM
Sbjct  181   LKESDKETGHKKTVTSLSKAVDGSHFVTGSLDKSAKLWDSRTLTLIKTYLTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASHVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF++KI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNVKI  326



>ref|XP_008350825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=328

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/328 (87%), Positives = 306/328 (93%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61    SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D E GHKK ITSLAKS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LKENDPEVGHKKTITSLAKSXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+VLGGGQDAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLCDHVVLGGGQDASTVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KS--FASGGEDGYVRLHHFDADYFHIKI  187
             K   F+SGGEDGYVRLHHFD+DYFHIKI
Sbjct  301   KKVYFSSGGEDGYVRLHHFDSDYFHIKI  328



>ref|XP_003534423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 308/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLWDV++G QL+TFNFDSP RSVDF+VGD+LAV+TTDPFM L S
Sbjct  61    SRDSVRLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFSVGDRLAVITTDPFMELSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +Q+GES+L +KG  GRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIADDPTEQSGESLLLIKGPLGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LWD R+LTL+KTYVTERPVNAVTM
Sbjct  181   LKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>gb|KHG16392.1| Eukaryotic translation initiation factor 3 subunit I -like protein 
[Gossypium arboreum]
Length=326

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/326 (87%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61    SRDSTRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAGDPTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV M
Sbjct  181   LKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_003596914.1| Eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=321

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/321 (88%), Positives = 303/321 (94%), Gaps = 0/321 (0%)
 Frame = -1

Query  1149  MKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSS  970
             MKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+SRDS 
Sbjct  1     MKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDVSRDSG  60

Query  969   RLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVK  790
             RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L SAIHVK
Sbjct  61    RLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELSSAIHVK  120

Query  789   RIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESD  610
             RIA DP DQT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKLLKESD
Sbjct  121   RIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKLLKESD  180

Query  609   QESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLD  430
             +E GHKK ITSLAKS DGSHF TGSLDKSAK+WD RTL+L+KTYVTERPVNAVTMSPLLD
Sbjct  181   KELGHKKTITSLAKSADGSHFCTGSLDKSAKIWDSRTLSLVKTYVTERPVNAVTMSPLLD  240

Query  429   HIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFAS  250
             H+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+S
Sbjct  241   HVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSS  300

Query  249   GGEDGYVRLHHFDADYFHIKI  187
             GGEDGYVRLHHFD DYF+IKI
Sbjct  301   GGEDGYVRLHHFDPDYFNIKI  321



>gb|ABK94219.1| unknown [Populus trichocarpa]
Length=326

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/326 (87%), Positives = 303/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LIT SADQ+VKLW+V+TG QLFTFNF+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61    SRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI+VK IA DP  Q+GESVLT+ G  GRINRAVWG LNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121   AINVKSIAEDPSQQSGESVLTITGPTGRINRAVWGSLNKTIISAGEDSVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAVTM
Sbjct  181   LKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>gb|KJB56100.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=326

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/326 (87%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>gb|EPS73291.1| hypothetical protein M569_01462 [Genlisea aurea]
Length=326

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 303/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPT WFADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTAWFADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+VKTGT L+TFNFDSP RSVDFA+GD LAV+TTDPFM L S
Sbjct  61    SRDSGRLITGSADQTAKLWNVKTGTPLYTFNFDSPARSVDFAIGDNLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+KRI+ DP DQTGESVL +KG QGRINRAVWGPLN+TI+S GED+V+R WDAETGKL
Sbjct  121   AIHIKRISGDPADQTGESVLVLKGPQGRINRAVWGPLNRTIVSAGEDAVIRRWDAETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+E  HKK ITSL+KS DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAV M
Sbjct  181   LQETDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLWDTRTLKLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDSDYFNIKI  326



>ref|XP_010521568.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 302/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYN++GDLLFSCAKDH PTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSARLITGSADQTVKLWEVQTGKQLYTFNFGSPARSVDFSVGDKLAVITTDPFMDLSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVK IA DPEDQ  +SVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWDAETGKL
Sbjct  121   AIHVKHIARDPEDQVADSVLVLKGVQGRINRAVWGPLNRTIISAGEDAVIRIWDAETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L ESD+E GHKK ITSL K+ D SHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAVTM
Sbjct  181   LNESDKEVGHKKAITSLCKAADSSHFLTGSLDKSAKLWDTRTLTLIKTYGTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILLEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDQDYFSIKI  326



>gb|KJB26172.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=326

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/326 (87%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA D  +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV M
Sbjct  181   LKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010937470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/326 (85%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQTVKLWDV+TG QL++FNFDSP R+VDF+VGDK AV+TTDPFMGLPS
Sbjct  61    SRDSTRLITGSADQTVKLWDVQTGVQLYSFNFDSPARAVDFSVGDKFAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I VKRI  DP  QTGESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121   TIQVKRIVRDPSQQTGESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K +TSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNA  +
Sbjct  181   LKESDKETGHQKTVTSLLKSADGSHFLTGSLDKSAKLWDSRTLTLIKTYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFNIKM  326



>ref|XP_002311556.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEE88923.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=326

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/326 (86%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS +LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61    SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI+VKRIA DP  Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKL
Sbjct  121   AINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKES+ E GHKK I+SL KS DGSHF+TGSLDKSAKLWD RTLTL+K Y TERPVNAVTM
Sbjct  181   LKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLWDSRTLTLIKNYTTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010926275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
 ref|XP_010926276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/326 (85%), Positives = 306/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQ+VKLW V+TG QL++FNFDSP ++VDF++GDKLA++TTDPFMGLPS
Sbjct  61    SRDSGLLITGSADQSVKLWSVQTGAQLYSFNFDSPAKAVDFSIGDKLAIITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I VKRIA DP +QT ESVLT+KG QGRINRAVWGPLNKTIISGGED+V+RIWDAETG+L
Sbjct  121   TIQVKRIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDAETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K ITSL+KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNA  +
Sbjct  181   LKESDKETGHQKTITSLSKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SFASGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFASGGEDGYVRLHHFDPDYFNIKM  326



>emb|CDP20306.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/326 (89%), Positives = 310/326 (95%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PT WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTGWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSS L+TGSADQT KLW+VKTGTQL+TFNFDSP RSVDF VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSSLLLTGSADQTAKLWNVKTGTQLYTFNFDSPTRSVDFGVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI VKRIA DP DQ+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+ETGKL
Sbjct  121   AIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKKGITSL+KS D +HFI+GSLDKSAKLWD+RTLTLLKTY TERPVNAV M
Sbjct  181   LKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSFASGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFASGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010111947.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
 gb|EXC32128.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
Length=429

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/354 (82%), Positives = 317/354 (90%), Gaps = 8/354 (2%)
 Frame = -1

Query  1224  LSHRIKLFGNQKNLQSRNKK--------MRPILMKGHERPLTFLKYNREGDLLFSCAKDH  1069
             L H+ ++F N+  L+ + KK        MRPILMKGHERPLTFLKYNREGDLLFSCAKDH
Sbjct  76    LWHKERIFLNRPPLEKKKKKKKKKKRKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDH  135

Query  1068  NPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNF  889
              PTVWFADNGERLGTYRGHNGAVW CD+SRDS RLITGSADQ+ KLWDV+TG QL TFNF
Sbjct  136   TPTVWFADNGERLGTYRGHNGAVWSCDVSRDSIRLITGSADQSAKLWDVRTGHQLHTFNF  195

Query  888   DSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRA  709
             DSP RSVDF+VGDKLAV+TTDPFMG  SAIHVKRIA DP+DQT ESVL +KG QGRINRA
Sbjct  196   DSPARSVDFSVGDKLAVITTDPFMGHTSAIHVKRIADDPDDQTSESVLVIKGPQGRINRA  255

Query  708   VWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  529
             VWGPLN+TIISGGED+++RIWD+ETGKLL ESD+E  HKK ITSLAKS+DGSHF+TGS D
Sbjct  256   VWGPLNQTIISGGEDTIIRIWDSETGKLLNESDKEVSHKKNITSLAKSVDGSHFLTGSHD  315

Query  528   KSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKF  349
             KSAKLWD RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKF
Sbjct  316   KSAKLWDTRTLTLIKTYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKF  375

Query  348   YDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             +DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  376   FDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  429



>gb|EPS65969.1| hypothetical protein M569_08807 [Genlisea aurea]
Length=326

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/326 (86%), Positives = 301/326 (92%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLWDVKTG  L+TF FDSP RSVDFAVGDK  V+TTD FM L S
Sbjct  61    SRDSKRLITGSADQTAKLWDVKTGKPLYTFEFDSPARSVDFAVGDKFVVITTDTFMELSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+KRIASDP++QTGES+LT+KG QGRINRA+WGPLN+TI+S GED+V+RIWD ETGKL
Sbjct  121   AIHIKRIASDPDEQTGESLLTLKGPQGRINRAIWGPLNRTIVSAGEDAVIRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+SD+E  HKK ITSL+KS DGSHF+TGSLDKSAKLWD RT+ L+KTYVTERPVNAV +
Sbjct  181   LKQSDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLWDTRTIKLIKTYVTERPVNAVAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFSIKI  326



>ref|XP_010249002.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Nelumbo nucifera]
Length=326

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/326 (85%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TGTQL+TFNF SP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61    SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFGSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQTGESVLT+KG QGRINRA+WGPLN+TIIS GED+V R+WD ETGKL
Sbjct  121   AIHVKRIARDPSDQTGESVLTIKGPQGRINRAIWGPLNRTIISAGEDAVTRVWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             + ESD+ESGH+K +TSLAKS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   INESDKESGHQKTVTSLAKSADWSHFLTGSLDKSAKLWDTRTLTLVKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFNIKM  326



>ref|XP_011021700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/326 (85%), Positives = 302/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDK AV+TTDPFMG+ S
Sbjct  61    SRDSMLLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKFAVITTDPFMGVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI+VK IA DP  Q+GES+LT+ G  GRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121   AINVKNIADDPSQQSGESMLTITGPTGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLWD R LTL+KTY TERPVNAVTM
Sbjct  181   LKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLWDTRNLTLIKTYATERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   ESFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_010275011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nelumbo nucifera]
Length=326

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/326 (84%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TGTQL+TFNFDSP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61    SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFDSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ+GESVLT++G QGRINRA+WGPLN+TIIS GED+V+R+WD ETGKL
Sbjct  121   AIHVKRIARDPSDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRVWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             + ESD+ESGH+K +TSLAKS D S+F+TGSLDKSAKLWD RTLTL+K YVTERPVNAV M
Sbjct  181   INESDKESGHQKTVTSLAKSADWSNFLTGSLDKSAKLWDARTLTLIKAYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQ+AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFNIKM  326



>ref|XP_009389562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389563.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/326 (84%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQ+VKLW+V+TG QL++FNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSMRLITGSADQSVKLWNVQTGAQLYSFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I VKRIA DP +Q+ ESVLT+KG QGRINRA+WGPLNKTIIS GED+V+R+WD ETG+L
Sbjct  121   TIQVKRIARDPNEQSSESVLTIKGPQGRINRAIWGPLNKTIISAGEDAVVRVWDTETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K +TSL+KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNA  +
Sbjct  181   LKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+A  VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEAVHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFTIKM  326



>ref|XP_011024978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/326 (85%), Positives = 302/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS +LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDKLAV+TTDPFM + S
Sbjct  61    SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKLAVITTDPFMEVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI+VKRIA DP  Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKL
Sbjct  121   AINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKES+ E GHKK I+SL KS DGSHF+TGSLDKSAKLWD RTLTL+K Y TERPVNAV M
Sbjct  181   LKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLWDSRTLTLIKNYTTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   KSFSSGGEDGYVRLHHFDPDYFNIKI  326



>ref|XP_008808069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Phoenix dactylifera]
Length=326

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/326 (84%), Positives = 303/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTY+GHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYKGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQ+VKLW+V+TG QL++FNFDSP R+VDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SRDSTRLITGSADQSVKLWNVQTGVQLYSFNFDSPARAVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I VKRIA DP  QTGESVLT+KG  GRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121   TIQVKRIARDPSQQTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K ITSL+KS  GSHF++GSLDKSAKLWD RTLTL+K YVTERPVNA  +
Sbjct  181   LKESDKETGHQKPITSLSKSAKGSHFLSGSLDKSAKLWDARTLTLIKAYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF SGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFTSGGEDGYVRLHHFDPDYFNIKM  326



>ref|XP_008782131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Phoenix dactylifera]
Length=326

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/326 (83%), Positives = 304/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DS  LITGSADQ+VKLW+V+TG QL+TFNF SP R+VDF+VGDKLAV+TTDPFMGLPS
Sbjct  61    SHDSGLLITGSADQSVKLWNVQTGAQLYTFNFGSPARAVDFSVGDKLAVITTDPFMGLPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I VK+IA DP +QT ESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121   TIQVKQIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K +TSL+KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNA  +
Sbjct  181   LKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPEYFNIKM  326



>ref|XP_011627263.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Amborella trichopoda]
Length=326

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/326 (83%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTY+GHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYKGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQT KLW+V+TG QL++FNFDSP R+VDFA GDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADQTAKLWNVETGAQLYSFNFDSPARAVDFAEGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI+ DP  QTGESVL ++G QGRINRAVWGPLN+TIISGGED+V+R+WD+ETGKL
Sbjct  121   AIHVKRISRDPSQQTGESVLVIRGPQGRINRAVWGPLNRTIISGGEDAVIRMWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D+E GH+K ITSL+KS DGSHF+TGSLDKSAKLWD+RTLTL+KTYVTERPVNA  +
Sbjct  181   LKETDKEIGHQKTITSLSKSSDGSHFLTGSLDKSAKLWDVRTLTLIKTYVTERPVNACAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+V+GGGQ+AS VTTTD RAGKFEAKF+ +IL+EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLHDHVVIGGGQEASHVTTTDRRAGKFEAKFFHQILEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFDADYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDADYFNIKM  326



>ref|XP_009151956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151957.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
Length=328

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 303/328 (92%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVKTGTQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFSVGDKLAVITTDPFMARTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ GESVL ++  +GR  INRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121   AIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AKLWD+RTLTL+KTY +  PVNAV
Sbjct  181   KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKLWDMRTLTLIKTYTSGVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             +MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGRSFSSGGEDGYVRLHHFDSDYFNIKI  328



>gb|KFK37423.1| hypothetical protein AALP_AA4G255300 [Arabis alpina]
Length=328

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 303/328 (92%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCDI
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQTVKLWDVK+G   FTF F SP RSVDFAVGDKLAV+T+DPFM   S
Sbjct  61    SRDSSRLITGSADQTVKLWDVKSGKPYFTFKFGSPARSVDFAVGDKLAVITSDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEDQVADSVLVLQSPEGRMRINRAVWGPLNQTIVSGGEDAVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKES++E GHKK ITSL+KS D SHFITGSLDK+AKLWD+RTLTL+KTY +  PVNAV
Sbjct  181   KLLKESNEEDGHKKPITSLSKSADDSHFITGSLDKTAKLWDMRTLTLIKTYTSNVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLLDH+V+GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SISPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  301   DGRSFSSGGEDGYVRLHHFDSDYFNIRI  328



>ref|XP_009129412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brassica rapa]
Length=328

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/328 (84%), Positives = 299/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM   S
Sbjct  61    SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  ESVL ++   GR  INRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121   AIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKESD E GHK  ITSL KS D SHFITGSLDK+AKLWD+RTLTLLKTYV+  PVNAV
Sbjct  181   KLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKLWDMRTLTLLKTYVSGVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             +MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSDYFNIRI  328



>ref|XP_010425732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camelina sativa]
Length=356

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/331 (82%), Positives = 302/331 (91%), Gaps = 2/331 (1%)
 Frame = -1

Query  1173  NKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWC  994
             + KMRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWC
Sbjct  26    DTKMRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWC  85

Query  993   CDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMG  814
             CD+SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDFAVGD LAV+TTDPFM 
Sbjct  86    CDVSRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFAVGDHLAVITTDPFME  145

Query  813   LPSAIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDA  640
               SAIHVKRIA DP+DQ  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+
Sbjct  146   RTSAIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDS  205

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
             ETGKLLKESD E GHKK ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PV
Sbjct  206   ETGKLLKESDGEVGHKKPITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYSTVVPV  265

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
             NAVTMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA
Sbjct  266   NAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  325

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             FNPDG+SF+SGGEDGYVRLHH D+DYF+IKI
Sbjct  326   FNPDGRSFSSGGEDGYVRLHHLDSDYFNIKI  356



>ref|XP_004297796.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/329 (83%), Positives = 300/329 (91%), Gaps = 3/329 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH P VWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPNVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDV++G Q+FTFNFDSP RSV+F+VGD+LAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVQSGHQVFTFNFDSPTRSVEFSVGDRLAVITTDPFMEQTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMK-GHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAET  634
             AIHVKRIA+DP DQT ES+LT+K   QGR  INRAVWGPLN+TIIS GED+++RIWD+ET
Sbjct  121   AIHVKRIAADPADQTAESILTLKITPQGRMKINRAVWGPLNRTIISAGEDAIIRIWDSET  180

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             GKLL+E+ +E GH K ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TE PVNA
Sbjct  181   GKLLQENQKEDGHTKTITSLVKSPDGSHFLTGSLDKSAKLWDTRTLTLIKTYRTESPVNA  240

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
             V MSPLL+H+VLGGGQDA  VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN
Sbjct  241   VAMSPLLNHVVLGGGQDAINVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  300

Query  273   PDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             PDGKSF+SGGEDGY+RLHHFD DYF+IKI
Sbjct  301   PDGKSFSSGGEDGYIRLHHFDHDYFNIKI  329



>ref|XP_010514644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Camelina sativa]
 ref|XP_010514645.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Camelina sativa]
Length=328

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDF+VGD LAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFSVGDHLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+ETG
Sbjct  121   AIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKESD E GHKK ITSLAK+ D SHFITGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLWDMRTLTLLKTYSTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             TMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   TMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SF+SGGEDGYVRLHH D DYF+IKI
Sbjct  301   DGRSFSSGGEDGYVRLHHLDPDYFNIKI  328



>gb|ABR18068.1| unknown [Picea sitchensis]
Length=326

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/326 (82%), Positives = 301/326 (92%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLIT SADQTVKLW+V+TGTQLF+FNF+SP R+VD A GDKL V+TTDPFM LPS
Sbjct  61    SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAEGDKLVVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+KRI  D   Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKL
Sbjct  121   AIHIKRIEKDLSKQSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+ES++E+GH+K ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV +
Sbjct  181   LRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SFASGGEDGYVRLHHFD DYFHIK+
Sbjct  301   RSFASGGEDGYVRLHHFDNDYFHIKM  326



>gb|ABK26793.1| unknown [Picea sitchensis]
Length=326

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/326 (81%), Positives = 302/326 (93%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLIT SADQTVKLW+V+TGTQLF+FNF+SP R+VD A GDKL V+TTDPFM LPS
Sbjct  61    SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAEGDKLVVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+KRI  D   Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKL
Sbjct  121   AIHIKRIEKDLSKQSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+ES++E+GH+K ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV +
Sbjct  181   LRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VTTTD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SFASGGEDGYVRLHHFD++YFHIK+
Sbjct  301   RSFASGGEDGYVRLHHFDSEYFHIKM  326



>ref|XP_010502959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=328

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 300/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDF+VGD LAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFSVGDHLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+ETG
Sbjct  121   AIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKESD E GHKK ITSLAK+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAV
Sbjct  181   KLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLWDMRTLTLIKTYSTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             TMSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   TMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SF+SGGEDGYVRLHH D DYF+IKI
Sbjct  301   DGRSFSSGGEDGYVRLHHLDPDYFNIKI  328



>emb|CDY34145.1| BnaA02g28950D [Brassica napus]
Length=330

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/330 (83%), Positives = 299/330 (91%), Gaps = 4/330 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM   S
Sbjct  61    SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  ESVL ++   G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121   AIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYVTERPVN  457
             KLLKESD E GHK  ITSL KS D SHFITGSLDK+AK  LWD+RTLTLLKTYV+  PVN
Sbjct  181   KLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKACLWDMRTLTLLKTYVSGVPVN  240

Query  456   AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  277
             AV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF
Sbjct  241   AVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  300

Query  276   NPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             NPDGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  301   NPDGKSFSSGGEDGYVRLHHFDSDYFNIRI  330



>ref|XP_002315834.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEF02005.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=328

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/328 (84%), Positives = 297/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LIT SADQ+VKLW+V+TG QLFTFNF+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61    SRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AI+VK IA DP  Q+GESVLT+   G  GRINRAVWG LNKTIIS GEDS+    +  TG
Sbjct  121   AINVKSIAEDPSQQSGESVLTITITGPTGRINRAVWGSLNKTIISAGEDSMGFRGNWLTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLKESD E GHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAV
Sbjct  181   KLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             TMSPLLDH+VLGGGQDAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNP
Sbjct  241   TMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDPDYFNIKI  328



>emb|CDY13713.1| BnaA06g32100D [Brassica napus]
Length=344

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/344 (79%), Positives = 303/344 (88%), Gaps = 18/344 (5%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVKTGTQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ GESVL ++  +G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121   AIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK----------------LWDIRT  499
             KLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AK                LWD+RT
Sbjct  181   KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKACLPFLLYLLFHNPPVLWDMRT  240

Query  498   LTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  319
             LTL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQEEIG
Sbjct  241   LTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIG  300

Query  318   GVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             GVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   GVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  344



>ref|XP_006395439.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32725.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=328

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/328 (82%), Positives = 298/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGER GTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT K+W+VKTG QLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETG
Sbjct  121   AIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KL+KES++E GHKK ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAV
Sbjct  181   KLIKESNEEEGHKKTITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYTTGVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   AMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSDYFNIKI  328



>ref|NP_182152.2| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEC10672.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/334 (80%), Positives = 300/334 (90%), Gaps = 2/334 (1%)
 Frame = -1

Query  1182  QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  1003
             Q+   +MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GA
Sbjct  22    QTLETRMRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGA  81

Query  1002  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  823
             VWCCDISRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+VGD LAV+TTD 
Sbjct  82    VWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVGDHLAVITTDH  141

Query  822   FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRI  649
             F+G  SAIHVKRIA DPEDQ G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RI
Sbjct  142   FVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRI  201

Query  648   WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTE  469
             WDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T 
Sbjct  202   WDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTV  261

Query  468   RPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPIN  289
              PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPIN
Sbjct  262   VPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPIN  321

Query  288   ALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             ALAF+PDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  322   ALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  355



>emb|CDY03970.1| BnaC02g36850D [Brassica napus]
Length=680

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/332 (83%), Positives = 301/332 (91%), Gaps = 4/332 (1%)
 Frame = -1

Query  1170  KKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCC  991
             +KMRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCC
Sbjct  349   EKMRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCC  408

Query  990   DISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGL  811
             D+SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM  
Sbjct  409   DVSRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMER  468

Query  810   PSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAE  637
              SAIHVKRIA DPEDQ  ESVL ++   G  RINRAVWGPLN+TI+SGGED+VLRIWDAE
Sbjct  469   TSAIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAE  528

Query  636   TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYVTERP  463
             TGKLLKESD E GHK  ITSL KS D SHFITGSLDK+AK  LWD+RTLTLLKTYV+  P
Sbjct  529   TGKLLKESDAEVGHKNTITSLTKSADDSHFITGSLDKTAKACLWDMRTLTLLKTYVSGVP  588

Query  462   VNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINAL  283
             VNAV+MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINAL
Sbjct  589   VNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINAL  648

Query  282   AFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             AFNPDGKSF+SGGEDGYVRLHHFD+DYF+I+I
Sbjct  649   AFNPDGKSFSSGGEDGYVRLHHFDSDYFNIRI  680



>dbj|BAC43524.1| putative eukaryotic translation initiation factor 3 delta subunit 
[Arabidopsis thaliana]
Length=355

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/334 (80%), Positives = 299/334 (90%), Gaps = 2/334 (1%)
 Frame = -1

Query  1182  QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  1003
             Q+   +MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GA
Sbjct  22    QTLETRMRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGA  81

Query  1002  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  823
             VWCCDISRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+V D LAV+TTD 
Sbjct  82    VWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVDDHLAVITTDH  141

Query  822   FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRI  649
             F+G  SAIHVKRIA DPEDQ G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RI
Sbjct  142   FVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRI  201

Query  648   WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTE  469
             WDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T 
Sbjct  202   WDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTV  261

Query  468   RPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPIN  289
              PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPIN
Sbjct  262   VPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPIN  321

Query  288   ALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             ALAF+PDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  322   ALAFSPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  355



>ref|XP_006294579.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
 gb|EOA27477.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
Length=328

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/328 (85%), Positives = 301/328 (92%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDV++G QLFTF F SP RSVDFAVGD LAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVQSGQQLFTFKFGSPARSVDFAVGDHLAVITTDPFMERNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  ESVL +   +GR  INRAVWGPLN+TI+SGGED+V+RIWD ETG
Sbjct  121   AIHVKRIAEDPEDQVDESVLVLPSAEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +LLKESD+E GHKK ITSL+K+ D SHFITGSLDKSAKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   QLLKESDEEVGHKKAITSLSKAADDSHFITGSLDKSAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             TMSPLL+HIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   TMSPLLNHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGRSFSSGGEDGYVRLHHFDSDYFNIKI  328



>gb|AAC62877.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/328 (81%), Positives = 297/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GAVWCCDI
Sbjct  1     MRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGAVWCCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+VGD LAV+TTD F+G  S
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVGDHLAVITTDHFVGTSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RIWDAETG
Sbjct  121   AIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHK+ ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPINALAF+P
Sbjct  241   AMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPINALAFSP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSNYFNIKI  328



>emb|CDY71621.1| BnaAnng38210D [Brassica napus]
Length=344

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/344 (78%), Positives = 302/344 (88%), Gaps = 18/344 (5%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHIPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVKT TQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKLWDVKTETQLFSFKFSSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ G+SVL ++  +G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121   AIHVKRIAEDPQDQDGDSVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK----------------LWDIRT  499
             KLLKE+D+E GHK+ ITSL KS D SHF+TGSLDK+AK                LWD+RT
Sbjct  181   KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKACLPRLSSLSIACFKVLWDMRT  240

Query  498   LTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIG  319
             LTL+KTY +  PVNAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQEEIG
Sbjct  241   LTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIG  300

Query  318   GVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             GVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   GVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  344



>gb|AIZ68198.1| eukaryotic translation initiation factor 3 subunit I-like isoform 
X1 [Ornithogalum saundersiae]
Length=328

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/328 (80%), Positives = 293/328 (89%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDHNPTVWFADNGERLG Y+GHNGA+W CD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHNPTVWFADNGERLGVYKGHNGAIWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQTVKLW+V+TG QL++F+FDSP RSV F+VGDKLAV+TTDPFMG P 
Sbjct  61    SRDSTRLITGSADQTVKLWNVQTGAQLYSFDFDSPARSVQFSVGDKLAVITTDPFMGHPP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQ--GRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              I VKRI+ DP +QT +SVLT+KG Q  GRI  A+WGPLNKTIISGGED +LR WD ETG
Sbjct  121   TIQVKRISRDPSEQTSDSVLTIKGPQLQGRITGAMWGPLNKTIISGGEDGILRTWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
              LL ESD+E+GH+K ITSL+KS DGSHF+T SLDKSAKLWD RTLTLLKTYVT  PVNA 
Sbjct  181   SLLMESDKETGHQKRITSLSKSADGSHFLTSSLDKSAKLWDTRTLTLLKTYVTSAPVNAC  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SPLLDH+V+GGGQDA  VT TDHRAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNP
Sbjct  241   AISPLLDHVVMGGGQDAVNVTMTDHRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DG+SFASGGEDGYVRLHHFD DYF+IKI
Sbjct  301   DGRSFASGGEDGYVRLHHFDPDYFNIKI  328



>gb|KDO58631.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=313

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/303 (87%), Positives = 283/303 (93%), Gaps = 0/303 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121   AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTM
Sbjct  181   LKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSF  256
             K +
Sbjct  301   KRY  303


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 75/182 (41%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +            D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAV----------GDKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_006448046.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|ESR61286.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
Length=313

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/303 (87%), Positives = 283/303 (93%), Gaps = 0/303 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121   AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTM
Sbjct  181   LKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSF  256
             K +
Sbjct  301   KRY  303


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 75/182 (41%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +            D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAV----------GDKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_002882056.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58315.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/328 (80%), Positives = 295/328 (90%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YN++GDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNKDGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F SP RSVDFA+GD LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGSPTRSVDFALGDHLAVITTDHFVDRMA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+S GED+V+RIWD ETG
Sbjct  121   AIHVKRIAEDPEDQVSDSVLVLQCPDGKKRINRAVWGPLNQTIVSAGEDTVIRIWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLL E+++E GHKK ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV
Sbjct  181   KLLNETNEEVGHKKAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTGVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   AMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSDYFNIKI  328



>ref|XP_010678072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/327 (81%), Positives = 289/327 (88%), Gaps = 1/327 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVW CDI
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWSCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DSSRLITGSADQTVKLWDVK G QL+TFNFD+P RSV+F+VGDKLAV+TTDPFM   S
Sbjct  61    SWDSSRLITGSADQTVKLWDVKKGEQLYTFNFDAPARSVNFSVGDKLAVITTDPFMEKTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK-  628
             AIHVKRIA D ++QT ES L M+G  GRINRAVWG LNK IIS GED+++R+WD  TG+ 
Sbjct  121   AIHVKRIAEDIDEQTNESALVMRGPSGRINRAVWGLLNKNIISCGEDAIIRVWDPVTGQE  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
             ++   D E+GH   ITSL  S D SHF+TGSLDKSAKLWD R+LTL+KTY+T RPVNAVT
Sbjct  181   IMSTKDHENGHNNAITSLCFSADKSHFLTGSLDKSAKLWDTRSLTLIKTYITGRPVNAVT  240

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             MSPLLDH+VLGGGQDAS VTT+DHRAGKFEAKF+DKIL+EEIGGVKGHFGPINALAFNPD
Sbjct  241   MSPLLDHVVLGGGQDASTVTTSDHRAGKFEAKFFDKILEEEIGGVKGHFGPINALAFNPD  300

Query  267   GKSFASGGEDGYVRLHHFDADYFHIKI  187
             GKSFASGGEDGY RLHHFD DYF IKI
Sbjct  301   GKSFASGGEDGYARLHHFDPDYFTIKI  327



>ref|XP_002862549.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38807.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=328

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/328 (80%), Positives = 294/328 (90%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M PILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W A NGERLGTYRGHNGAV CCD+
Sbjct  1     MTPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLGTYRGHNGAVSCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G QLFTFNF S  RSVDF+VGD LAV+TTD FMG+ S
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFSVGDHLAVITTDHFMGVSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DP+DQ G+SVL ++   G+  INRAVWGPLN+TI+SGGED+V+RIWD ETG
Sbjct  121   AIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRIWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD E GHK+ ITSL K+ D SHF+TGS DK+AKLWD+R+LTL+K+Y T  PVNAV
Sbjct  181   KLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDMRSLTLIKSYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGPINALAFNP
Sbjct  241   AMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSNYFNIKI  328



>ref|XP_010506629.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=361

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/334 (78%), Positives = 293/334 (88%), Gaps = 2/334 (1%)
 Frame = -1

Query  1182  QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  1003
             Q+    +RPIL+KGHERPLT L+YNR+GDLLFSCAKDH PT+WF DNGERLGTYRGHNGA
Sbjct  28    QTLESWIRPILLKGHERPLTCLRYNRDGDLLFSCAKDHTPTLWFVDNGERLGTYRGHNGA  87

Query  1002  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  823
             VWCCD+SRDSSRLITGSADQT KLWDV++G QLFTF F SP R VDF+VGD LAV+TTDP
Sbjct  88    VWCCDVSRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSPARFVDFSVGDHLAVITTDP  147

Query  822   FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  649
             FM   SAIHVKRIA DP+DQ G+SVL +    G  RINRAVWG LNKTI+S GED+V+RI
Sbjct  148   FMERTSAIHVKRIAEDPQDQVGDSVLVINNPDGKKRINRAVWGLLNKTIVSAGEDAVIRI  207

Query  648   WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTE  469
             WD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTL+K+Y T 
Sbjct  208   WDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLIKSYTTV  267

Query  468   RPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPIN  289
              PVNAV MSPLL+H++LGGGQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGPIN
Sbjct  268   VPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGPIN  327

Query  288   ALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             ALAFNPDGKSF+SGGEDGYVRLHHFD++YF IKI
Sbjct  328   ALAFNPDGKSFSSGGEDGYVRLHHFDSNYFDIKI  361



>ref|XP_010508042.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=360

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/350 (76%), Positives = 302/350 (86%), Gaps = 8/350 (2%)
 Frame = -1

Query  1212  IKLFGNQKN-LQSRNKK-----MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWF  1051
             ++L G Q N +QS + +     +RPIL+KGHERPLT L+YNR+GDLLFSCAKDHNPT+WF
Sbjct  11    LRLDGRQFNDIQSSSHQTLESWIRPILLKGHERPLTCLRYNRDGDLLFSCAKDHNPTLWF  70

Query  1050  ADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRS  871
             ADNGERLGTYRGHNGAVWCCD+SRDSSRLITGSADQT KLWDV++G QLFTF F S  RS
Sbjct  71    ADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSTARS  130

Query  870   VDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGP  697
             V+F+VGD LAV+TTDPF+   SAIHVKRI  DP+DQ  +SVL +    G  RINRAVWGP
Sbjct  131   VEFSVGDHLAVITTDPFIERTSAIHVKRIVEDPQDQVDDSVLVINNPDGKKRINRAVWGP  190

Query  696   LNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK  517
             LNKTI+S GED+V+RIWD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLD +AK
Sbjct  191   LNKTIVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDNTAK  250

Query  516   LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  337
             LWD+RTLTL+K+Y T  PVNAV MSPLL+H++LGGGQDASAVTTTDHRAG FEAKFYD I
Sbjct  251   LWDMRTLTLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGNFEAKFYDTI  310

Query  336   LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  311   LQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  360



>ref|NP_182151.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 ref|NP_850450.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 sp|Q38884.2|EIF3I_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TGF-beta receptor-interacting 
protein 1; Short=TRIP-1; AltName: Full=eIF-3-beta; 
AltName: Full=eIF3 p36 [Arabidopsis thaliana]
 gb|AAC62878.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 dbj|BAE98705.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AEC10670.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10671.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=328

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 300/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSDYFNIKI  328



>ref|XP_002882057.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58316.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/336 (78%), Positives = 297/336 (88%), Gaps = 4/336 (1%)
 Frame = -1

Query  1182  QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  1003
             Q+   +M PILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W A NGERLGTYRGHNGA
Sbjct  24    QTLETRMTPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLGTYRGHNGA  83

Query  1002  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  823
             V CCD+SRDSSRLITGSADQT KLWDVK+G QLFTFNF S  RSVDF+VGD LAV+TTD 
Sbjct  84    VSCCDVSRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFSVGDHLAVITTDH  143

Query  822   FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  649
             FMG+ SAIHVKRIA DP+DQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+V+RI
Sbjct  144   FMGVSSAIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRI  203

Query  648   WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYV  475
             WD ETGKLLK+SD E GHK+ ITSL K+ D SHF+TGS DK+AK  LWD+R+LTL+K+Y 
Sbjct  204   WDTETGKLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHDKTAKACLWDMRSLTLIKSYT  263

Query  474   TERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGP  295
             T  PVNAV MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGP
Sbjct  264   TVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGP  323

Query  294   INALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             INALAFNPDGKSF+SGGEDGYVRLHHFD++YF+IKI
Sbjct  324   INALAFNPDGKSFSSGGEDGYVRLHHFDSNYFNIKI  359



>gb|AAK43862.1|AF370485_1 eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AAL47346.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/328 (82%), Positives = 299/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGK F+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGKGFSSGGEDGYVRLHHFDSDYFNIKI  328



>ref|NP_001061508.1| Os08g0308100 [Oryza sativa Japonica Group]
 gb|AAQ56413.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Japonica Group]
 gb|AAQ56424.1| TGF-beta receptor-interacting protein-like protein [Oryza sativa 
Japonica Group]
 dbj|BAC92643.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAC92579.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF23422.1| Os08g0308100 [Oryza sativa Japonica Group]
 dbj|BAI39771.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
 dbj|BAI39984.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
Length=326

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/326 (79%), Positives = 290/326 (89%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121   TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   RSFSSGGEDGYVRLHHFDSDYFNIKI  326



>ref|XP_001757566.1| predicted protein [Physcomitrella patens]
 gb|EDQ77623.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/326 (77%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTY+GHNGAVWCCD+
Sbjct  1     MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYKGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RL+T SADQTVKLWD +TG QL +FNFD+P R+V FA GDK+ V+TTDPFM   S
Sbjct  61    SRDSTRLVTSSADQTVKLWDCETGVQLHSFNFDAPARAVSFAEGDKMVVITTDPFMEQQS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI SD   Q+ E VLT+ G QGRINRA+WGPLNKTIIS GED+ +RIWDAETGKL
Sbjct  121   AIHVKRIESDRSLQSSEDVLTITGPQGRINRAMWGPLNKTIISAGEDATIRIWDAETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD E+GH+K IT++AKS DGSHFITGS DKSAKLWDIRTL +LKTY TERPVNA  +
Sbjct  181   LKESDPETGHQKVITAMAKSADGSHFITGSHDKSAKLWDIRTLQMLKTYTTERPVNAAAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VT T  RAGKFEAKF+ KI +EEIGGVKGHFGPINAL FNPDG
Sbjct  241   SPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFEEEIGGVKGHFGPINALVFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVR+H FD+DY+HIK+
Sbjct  301   RSFSSGGEDGYVRVHFFDSDYYHIKV  326



>ref|NP_001055036.1| Os05g0256000 [Oryza sativa Japonica Group]
 gb|AAV31388.1| putative TGF-beta receptor interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF16950.1| Os05g0256000 [Oryza sativa Japonica Group]
 dbj|BAG97027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78857.1| hypothetical protein OsI_19205 [Oryza sativa Indica Group]
 gb|EEE63021.1| hypothetical protein OsJ_17829 [Oryza sativa Japonica Group]
Length=326

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/326 (78%), Positives = 288/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTY GHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYSGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FMG   
Sbjct  61    SRDSTRLITGSADQTAKLWDVQTGAELFTFRFDAPARSVEFAIGDGLAVITTDNFMGNVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG  
Sbjct  121   TAQVKRIADDPDDQSEESLLVISGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGTC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L ESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LNESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   RSFSSGGEDGYVRLHHFDSDYFNIKI  326



>dbj|BAH19940.1| AT2G46280 [Arabidopsis thaliana]
Length=328

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/328 (82%), Positives = 298/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQE IGGVKGHFGPINALAFNP
Sbjct  241   SLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEGIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+ YF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSGYFNIKI  328



>ref|NP_001147501.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 gb|ACG27749.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 tpg|DAA59664.1| TPA: eukaryotic translation initiation factor 3 subunit 2 [Zea 
mays]
Length=326

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/326 (78%), Positives = 289/326 (89%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSARLITGSADQTAKLWDVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + VKRIA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+L
Sbjct  121   TVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRIWDSETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDSDYFSIKM  326



>gb|AAG53616.1|AF285835_1 eukaryotic initiation factor 3I1 subunit [Arabidopsis thaliana]
Length=328

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/328 (81%), Positives = 297/328 (91%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+  LLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNRQPHLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+ AV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRFAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  301   DGKSFSSGGEDGYVRLHHFDSDYFNIKI  328



>ref|XP_003577379.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brachypodium distachyon]
Length=326

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/326 (78%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH P VW+ADNGERLGTY+GHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHAPNVWYADNGERLGTYKGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SR S+RL+TGSADQT KLWDVKTG +LFTF FD+P RSVDFA+GD+LAV+TTD FMG   
Sbjct  61    SRHSTRLLTGSADQTAKLWDVKTGKELFTFRFDAPARSVDFAIGDRLAVITTDSFMGNQP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA D EDQT +S L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121   TAQVKRIAEDIEDQTEDSALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L ESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LNESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD DYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPDYFNIKM  326



>ref|XP_008670966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 ref|XP_008670967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 tpg|DAA42586.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42587.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42588.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
Length=326

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/326 (78%), Positives = 289/326 (89%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + VKRIA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+L
Sbjct  121   TVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGQL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDSDYFSIKM  326



>dbj|BAJ85385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/326 (78%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SR S+RLITGSADQT KLWDVKTG +LFTF FD+P RSVD A+GD LAV+TTD FMG   
Sbjct  61    SRHSTRLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLAIGDHLAVITTDSFMGNMP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121   TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPEYFNIKM  326



>gb|AFM95335.1| eukaryotic translation initiation factor 3 subunit i [Triticum 
aestivum]
Length=326

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/326 (78%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SR S+RLITGSADQT KLWDVKTG +LFTF FD+P RSVD A+GD LAV+TTD FMG   
Sbjct  61    SRHSARLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLAIGDHLAVITTDSFMGNMP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121   TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDPEYFNIKM  326



>ref|XP_004955547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Setaria italica]
Length=326

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/326 (78%), Positives = 287/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSARLITGSADQTAKLWDVSTGRELFSFRFDAPARSVEFAIGDALAVITTDNFMDHVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + VK IA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETGKL
Sbjct  121   TVQVKHIAEDLDDQTDESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGH+K I+SL+KS D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKESGHQKTISSLSKSADWSHFITGSLDKSAKLWDSRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF+IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDSDYFNIKM  326



>ref|XP_002461510.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
 gb|EER98031.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
Length=326

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/326 (77%), Positives = 288/326 (88%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + VK IA D +DQT +S L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETGKL
Sbjct  121   TVQVKHIAEDIDDQTEDSALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGH+K ITSL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKESGHQKTITSLSKSLDWSHFVTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  D +VLGGGQDA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD++YF IK+
Sbjct  301   RSFSSGGEDGYVRLHHFDSEYFSIKM  326



>ref|XP_001763986.1| predicted protein [Physcomitrella patens]
 gb|EDQ71125.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/326 (76%), Positives = 285/326 (87%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTY+GHNGAVWCCD+
Sbjct  1     MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYKGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RL+T SADQTVKLW+ +TG  L TFNFD+P R+V F+ GDK+ V++TDPFM   S
Sbjct  61    SRDSTRLVTSSADQTVKLWECETGVLLHTFNFDAPARAVSFSEGDKMVVISTDPFMEKQS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRI SD   Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK 
Sbjct  121   AIHVKRIESDRFLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD E+GH+K IT+++KS DGSHFITGS DKSAKLWDIRTLT+LKTY TERPVNA  +
Sbjct  181   LKESDPETGHQKVITAMSKSADGSHFITGSHDKSAKLWDIRTLTVLKTYTTERPVNAAAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VT T  R GKFEAKF+ KI +EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEASQVTMTSTRVGKFEAKFFHKIFEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVR+H FDADY+HIK+
Sbjct  301   RSFSSGGEDGYVRVHFFDADYYHIKV  326



>ref|XP_001758941.1| predicted protein [Physcomitrella patens]
 gb|EDQ76447.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/326 (77%), Positives = 283/326 (87%), Gaps = 0/326 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RL+T SADQTVKLWD +TG  L TF FD+P R+V F+ GDK+ V++TDPFM   S
Sbjct  61    SRDSTRLVTSSADQTVKLWDCETGVLLDTFYFDAPARAVSFSEGDKMVVISTDPFMEKQS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVK I SD   Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK 
Sbjct  121   AIHVKMINSDRSLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L ESD E+GH+K ITS+AKS DGSHFITGS DKSAKLWDIRTLT+LKTY TERPVNA  +
Sbjct  181   LIESDPETGHQKVITSMAKSADGSHFITGSQDKSAKLWDIRTLTVLKTYTTERPVNAAAI  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQ+AS VT T  RAGKFEAKF+ KI +EEIGGVKGHFGPINALAFNPDG
Sbjct  241   SPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFEEEIGGVKGHFGPINALAFNPDG  300

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVR+H FDADY+HIK+
Sbjct  301   RSFSSGGEDGYVRVHFFDADYYHIKV  326



>gb|AAC49079.1| TGF-beta receptor interacting protein 1 homolog [Arabidopsis 
thaliana]
Length=328

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/328 (80%), Positives = 294/328 (90%), Gaps = 2/328 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVK    DPE+Q  ESVL +    G  RINRAVWGPLN+TI+S GED V+RIWDAETG
Sbjct  121   AIHVKAYCEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSCGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SPLL+H+VLGGG+DASAVTTTDHRAGKFEAKF DKILQEEIGGVKGHFGPINALAFNP
Sbjct  241   SLSPLLNHVVLGGGEDASAVTTTDHRAGKFEAKFCDKILQEEIGGVKGHFGPINALAFNP  300

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKSF+SGGE GYVRLHHFD+DYF+IKI
Sbjct  301   DGKSFSSGGEGGYVRLHHFDSDYFNIKI  328



>ref|XP_002988251.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
 ref|XP_002991383.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ07495.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ10670.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
Length=323

 Score =   522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 283/325 (87%), Gaps = 2/325 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SR S+RLITGSADQ+VKLWDV+TGTQL TFNF SP R+VDFA GDKLAV++TDPFM   S
Sbjct  61    SRHSTRLITGSADQSVKLWDVETGTQLHTFNFVSPARAVDFAEGDKLAVISTDPFMESVS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+K + S    Q   S+ T  G  GRINR VWGPLNKTIIS GED+V+RIWD ETG++
Sbjct  121   AIHIKSVESSGLQQG--SIKTFTGPTGRINRVVWGPLNKTIISAGEDTVIRIWDVETGEV  178

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K++D+E+GH + ITSL+ S DGSHFITGS DK+AKLWD RTLTLLKTY TERPVNAV +
Sbjct  179   IKKTDKENGHSRAITSLSLSADGSHFITGSQDKTAKLWDTRTLTLLKTYSTERPVNAVAI  238

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL++H+V+GGGQ+AS VTT+D RAGKFEAKF+ KI  +EIGGV+GHFGPINALAFNPDG
Sbjct  239   SPLMNHVVVGGGQEASQVTTSDRRAGKFEAKFFHKIFCDEIGGVRGHFGPINALAFNPDG  298

Query  264   KSFASGGEDGYVRLHHFDADYFHIK  190
             +SF+SGGEDGYVRLHHFD DY+ ++
Sbjct  299   RSFSSGGEDGYVRLHHFDPDYYKLQ  323



>gb|EAZ42270.1| hypothetical protein OsJ_26838 [Oryza sativa Japonica Group]
Length=380

 Score =   518 bits (1333),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 257/380 (68%), Positives = 289/380 (76%), Gaps = 54/380 (14%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121   TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDH-----------------------IVLG---------------------------  415
             SPLLDH                       IV G                           
Sbjct  241   SPLLDHPCHIGPTSVSSITKCGDSWMPQRIVAGMVLDDGGAMPVVILNVGTWQQPRQSER  300

Query  414   ----GGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASG  247
                 GGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SG
Sbjct  301   VVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSG  360

Query  246   GEDGYVRLHHFDADYFHIKI  187
             GEDGYVRLHHFD+DYF+IKI
Sbjct  361   GEDGYVRLHHFDSDYFNIKI  380



>gb|KCW69348.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=280

 Score =   513 bits (1322),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 238/278 (86%), Positives = 258/278 (93%), Gaps = 0/278 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+ESD+E+GHKK +TSL KS+DGSHF+TGS DKSAKLWDIRTLTL+KTYVTERPVNAVTM
Sbjct  181   LRESDKETGHKKAVTSLMKSVDGSHFVTGSQDKSAKLWDIRTLTLIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  331
             SPLLDH+VLGGGQDASAVT TDHRAGKFEAKF+DK L+
Sbjct  241   SPLLDHVVLGGGQDASAVTMTDHRAGKFEAKFFDKFLK  278


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D +AKLW ++  T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFS-------IG---DKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  ++GH G I    + P  K+  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVI  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_006663589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oryza brachyantha]
Length=310

 Score =   503 bits (1296),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 241/326 (74%), Positives = 275/326 (84%), Gaps = 16/326 (5%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSC                LGT RGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSC----------------LGTCRGHNGAVWSCDV  44

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  45    SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMDNAP  104

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +R+WD ETGK 
Sbjct  105   TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATVRLWDTETGKC  164

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K I+SL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  165   LKESDKEQGHQKTISSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  224

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  225   SPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  284

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  285   RSFSSGGEDGYVRLHHFDSDYFNIKI  310



>gb|KJB56102.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=318

 Score =   499 bits (1285),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 234/276 (85%), Positives = 256/276 (93%), Gaps = 0/276 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  337
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DK+
Sbjct  241   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKV  276


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 74/182 (41%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++ KLW+++T   L T+    P  +V  S            D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSV----------GDKLAVI  110

Query  387  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I        +E    +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_007215753.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
 gb|EMJ16952.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
Length=295

 Score =   486 bits (1252),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 242/326 (74%), Positives = 266/326 (82%), Gaps = 31/326 (10%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL Y+REGDLL SC KDH P     DN ERLGTYRGHNGAVWC D 
Sbjct  1     MRPILMKGHERPLTFLTYDREGDLLLSCGKDHTP-----DNVERLGTYRGHNGAVWCGDF  55

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             +RDS+RLITGSADQT KLW+V+TG QLFTFNFDSP RSVD +VGD+LAV+TTDPFM L S
Sbjct  56    TRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDLSVGDRLAVITTDPFMELSS  115

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP    GES L +KG QGR  RAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  116   AIHVKRIAKDPA-IVGESALILKGPQGRRQRAVWGPLNRTIISAGEDAVIRIWDSETGKL  174

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKE+D+E GHKK ITSLAKS+DGSHF+TGSLDKSA+LWDIRTLTL+KTYVTERPVNAV M
Sbjct  175   LKENDKEVGHKKTITSLAKSVDGSHFLTGSLDKSARLWDIRTLTLIKTYVTERPVNAVAM  234

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLD +VLGGGQDASAVTTTDHRAGKFEAKFYD+ L+                      
Sbjct  235   SPLLDDVVLGGGQDASAVTTTDHRAGKFEAKFYDRFLK----------------------  272

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
                 SGGEDGYVRLHHFD+DYF+IKI
Sbjct  273   ---WSGGEDGYVRLHHFDSDYFNIKI  295



>gb|KDO58633.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=268

 Score =   471 bits (1211),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/264 (86%), Positives = 245/264 (93%), Gaps = 0/264 (0%)
 Frame = -1

Query  978  DSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAI  799
            +S  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L SAI
Sbjct  5    NSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNSAI  64

Query  798  HVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLK  619
            HVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLK
Sbjct  65   HVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLK  124

Query  618  ESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSP  439
            ESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSP
Sbjct  125  ESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSP  184

Query  438  LLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKS  259
            LLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKS
Sbjct  185  LLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKS  244

Query  258  FASGGEDGYVRLHHFDADYFHIKI  187
            F+SGGEDGYVRLHHFD DYF+IKI
Sbjct  245  FSSGGEDGYVRLHHFDPDYFNIKI  268


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -1

Query  1155  ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDI  985
             +++KG +  +    +      + S  +D    +W  + G+ L       GH   +     
Sbjct  82    LILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAK  141

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  835
             + D S  +TGS D++ KLWD +T   + T+  + P  +V  +            D  AV 
Sbjct  142   AADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVT  201

Query  834   TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  655
             TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  202   TTDHRAGKFEAKFFDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  254

Query  654   RI  649
             R+
Sbjct  255   RL  256



>gb|KJB56101.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=272

 Score =   471 bits (1211),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 235/326 (72%), Positives = 254/326 (78%), Gaps = 54/326 (17%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V                                       
Sbjct  61    SRDSMRLITGSADQTVKLWNV---------------------------------------  81

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                          QTG  + T   + G   RAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  82    -------------QTGAQLYTF--NFGSPARAVWGPLNRTIVSAGEDAVIRIWDSETGKL  126

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  127   LREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  186

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  187   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  246

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  247   KSFSSGGEDGYVRLHHFDPDYFNIKI  272



>ref|XP_006395438.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32724.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=289

 Score =   468 bits (1204),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 220/278 (79%), Positives = 248/278 (89%), Gaps = 2/278 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGER GTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT K+W+VKTG QLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61    SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETG
Sbjct  121   AIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KL+KES++E GHKK ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAV
Sbjct  181   KLIKESNEEEGHKKTITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYTTGVPVNAV  240

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKI  337
              MSPLL+H+VLGGGQDASAVTTTDHRAGKFEAKFYDK+
Sbjct  241   AMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKV  278



>gb|EMS51995.1| Eukaryotic translation initiation factor 3 subunit I [Triticum 
urartu]
Length=341

 Score =   459 bits (1182),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 256/326 (79%), Gaps = 34/326 (10%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP+LMKGHERPLTFLKYNR+GDLLFSCAKDH PTV                        
Sbjct  1     MRPVLMKGHERPLTFLKYNRDGDLLFSCAKDHTPTV------------------------  36

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                        ADQT KLWDV+TG +LFTF FD+P RSVDFA+GD LAV+TTD FMG   
Sbjct  37    ----------CADQTAKLWDVQTGRELFTFRFDAPARSVDFAIGDHLAVITTDSFMGKMP  86

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  87    TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  146

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  147   LKESDKEAGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDM  206

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP LD++V+GGGQDA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  207   SPTLDNVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  266

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD +YF+IK+
Sbjct  267   KSFSSGGEDGYVRLHHFDPEYFNIKM  292



>gb|KDO58632.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=305

 Score =   452 bits (1164),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 212/253 (84%), Positives = 231/253 (91%), Gaps = 0/253 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121   AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GHKK ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTM
Sbjct  181   LKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTM  240

Query  444   SPLLDHIVLGGGQ  406
             SPLLDH+ +G  Q
Sbjct  241   SPLLDHVCIGEPQ  253


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 75/182 (41%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +            D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAV----------GDKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>gb|KJB56103.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=264

 Score =   451 bits (1159),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 246/326 (75%), Gaps = 62/326 (19%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V                                       
Sbjct  61    SRDSMRLITGSADQTVKLWNV---------------------------------------  81

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                          QTG  + T            +G   +TI+S GED+V+RIWD+ETGKL
Sbjct  82    -------------QTGAQLYTFN----------FGSPARTIVSAGEDAVIRIWDSETGKL  118

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  119   LREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  178

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG
Sbjct  179   SPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDG  238

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  239   KSFSSGGEDGYVRLHHFDPDYFNIKI  264



>ref|XP_010275012.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nelumbo nucifera]
Length=247

 Score =   447 bits (1150),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 206/246 (84%), Positives = 229/246 (93%), Gaps = 0/246 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLW+V+TGTQL+TFNFDSP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61    SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFDSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ+GESVLT++G QGRINRA+WGPLN+TIIS GED+V+R+WD ETGKL
Sbjct  121   AIHVKRIARDPSDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRVWDTETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             + ESD+ESGH+K +TSLAKS D S+F+TGSLDKSAKLWD RTLTL+K YVTERPVNAV M
Sbjct  181   INESDKESGHQKTVTSLAKSADWSNFLTGSLDKSAKLWDARTLTLIKAYVTERPVNAVAM  240

Query  444   SPLLDH  427
             SPLLDH
Sbjct  241   SPLLDH  246



>gb|KJB56104.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=269

 Score =   443 bits (1140),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 228/249 (92%), Gaps = 0/249 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E+D+ESGHKK ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV M
Sbjct  181   LREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAM  240

Query  444   SPLLDHIVL  418
             SPLLDH+ +
Sbjct  241   SPLLDHVSM  249


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++ KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFS-------VG---DKLAVI  110

Query  387  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I        +E    +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>gb|KJB26173.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=250

 Score =   441 bits (1134),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 227/249 (91%), Gaps = 0/249 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61    SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA D  +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+ESGHKK ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV M
Sbjct  181   LKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAM  240

Query  444   SPLLDHIVL  418
             SPLLDH+ +
Sbjct  241   SPLLDHVSM  249


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++ KLW+++  T L T+    P  +V          +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSV-------EFAIG---DKLAVI  110

Query  387  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I        +E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_001418365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score =   443 bits (1140),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 249/325 (77%), Gaps = 4/325 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTF+KYNREGDLLF+CAKDH+PT+W+ DNGER+GTY GHNGAVW CD+
Sbjct  1     MRPILLKGHERPLTFIKYNREGDLLFTCAKDHHPTLWYGDNGERVGTYVGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DSS L+TGSAD T KLWD KTG   FTF FD P R+V    G     +TTDPFMG+PS
Sbjct  61    SDDSSTLVTGSADTTAKLWDTKTGECYFTFEFDQPVRAVALNAGGTQCAITTDPFMGVPS  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
             AIH+  +   D   Q GE V  ++G QGR+ R +WGPLNKT+++GGED ++R WD ETG 
Sbjct  121   AIHIVNVNLGDRAAQRGEVVKRIEGPQGRVTRVMWGPLNKTVVTGGEDGIIRSWDVETGD  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
             +LK S +   H K I  L  S DGSHFI+ SLDK+AK++D  TL  LKTY  +RPVNA  
Sbjct  181   VLKMSQE---HSKQIQHLVMSDDGSHFISASLDKTAKVFDSETLECLKTYSADRPVNAAI  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DHIVLGGGQDA AVTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAFNPD
Sbjct  238   LSPIRDHIVLGGGQDAMAVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAFNPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYFHI  193
             G+SF SGGEDGYVR+H  D  YF I
Sbjct  298   GRSFTSGGEDGYVRIHPLDNSYFEI  322



>ref|XP_003079673.1| TGF-beta receptor-interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL53318.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=323

 Score =   441 bits (1133),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 251/325 (77%), Gaps = 4/325 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTF++YNREGDLLF+CAKDH+PT+W+ D GER+GTY GHNGAVW CD+
Sbjct  1     MRPILLKGHERPLTFIRYNREGDLLFTCAKDHHPTLWYGDTGERVGTYVGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DSS L+TGSAD T KLWD KTG   FTF FD P R+V  A G K A +TTDPFMG+PS
Sbjct  61    SDDSSTLLTGSADTTAKLWDAKTGECYFTFTFDQPVRAVALAHGGKRAAITTDPFMGVPS  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
             AIH+  I   D   QT   +  + G QGR+ R +WGPLN+T+I+GGED ++R WDAE G+
Sbjct  121   AIHIVEIDLEDRSRQTARVIRRIDGPQGRVTRVLWGPLNRTVITGGEDGIIRSWDAENGE  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
             +LK S +   H K I  L+ S DGSHFI+ SLDK+AK++D  TL  +KTY  +RPVNA  
Sbjct  181   VLKISQE---HSKQIQHLSMSEDGSHFISASLDKTAKVFDSETLECMKTYSADRPVNAAI  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DHIVLGGGQDA +VTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAFNPD
Sbjct  238   LSPIRDHIVLGGGQDAMSVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAFNPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYFHI  193
             G+SF SGGEDGYVR+H  D  YF I
Sbjct  298   GRSFTSGGEDGYVRIHPLDNSYFEI  322



>ref|XP_002500789.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62047.1| predicted protein [Micromonas sp. RCC299]
Length=317

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 262/325 (81%), Gaps = 8/325 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHER      YN+EGDLLF+CAKDH+PT+W++D+GER+GTY GHNGAVW CD+
Sbjct  1     MRPILLKGHERC-----YNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIGHNGAVWTCDV  55

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + DS  L+TGSAD T K+WD +TGT  FT  F+ P R+V  + GD+  V+++DPFMG+P+
Sbjct  56    TEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMVISSDPFMGVPA  115

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             A+H+  +A++ E+QT E  ++M G +GRINRA+WGPLN+TI++GGED V+R+WD ETGK+
Sbjct  116   ALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDGVIRLWDVETGKI  175

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             + E++    HKK I  L+ S+D +HFI+ SLDK+AKL+D  TL  LKTY  +RPVNA  +
Sbjct  176   VHEAND---HKKQIQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYAADRPVNAAIL  232

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+LDHI+LGGGQDA AVTTT  +AGKF++K + KI +EEIGG++GHFGPINALA++PDG
Sbjct  233   SPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFGPINALAWHPDG  292

Query  264   KSFASGGEDGYVRLHHFDADYFHIK  190
             +SF SGGEDGYVR+HHFD DYF IK
Sbjct  293   RSFTSGGEDGYVRIHHFDNDYFRIK  317



>ref|XP_003059370.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56502.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   436 bits (1121),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 260/337 (77%), Gaps = 15/337 (4%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTF+KYNR+GDLLF+CAKDH+PT+W+AD+GER+GTY GHNGAVW CD+
Sbjct  1     MRPILLKGHERPLTFIKYNRDGDLLFTCAKDHHPTLWYADDGERVGTYVGHNGAVWTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTF-----------NFDSPGRSVDFAVGDKLAV  838
             + DS  L+TGSAD T K+WDV+TGT  FT            +FD P R+V  A GD+   
Sbjct  61    THDSRTLVTGSADTTCKMWDVETGTCYFTHQARSIHWFPYDHFDQPARAVALAQGDEKMC  120

Query  837   MTTDPFMGLPSAIHVKRIASDPEDQTGESVLTM-KGHQGRINRAVWGPLNKTIISGGEDS  661
             ++TDPFMG+P+ +H+  +A++ E+QT E V +   G +GRINRA+WGPLN+TI++GGED 
Sbjct  121   ISTDPFMGVPARVHIVNVAANREEQTNEIVASFGDGVEGRINRALWGPLNETILTGGEDG  180

Query  660   VLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKT  481
             V+R WD ETGK+  E+     HKK I  L  S D +HF++ SLDK+AKL+D  TL  LKT
Sbjct  181   VIRAWDVETGKIKLEA---RDHKKQIQHLCLSEDKTHFVSASLDKTAKLFDSETLECLKT  237

Query  480   YVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHF  301
             YV +RPVNA  +SP+LDHIVLGGGQDA AVTTT  +AGKF++K Y K+ +EEIG ++GHF
Sbjct  238   YVADRPVNAAIISPILDHIVLGGGQDAMAVTTTSSKAGKFDSKIYFKVYEEEIGSIRGHF  297

Query  300   GPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  190
             GP+NALAFNPDG+SF +GGEDGY R+HH D DYF I+
Sbjct  298   GPVNALAFNPDGRSFTTGGEDGYSRVHHLDNDYFRIR  334



>ref|XP_007512918.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16476.1| predicted protein [Bathycoccus prasinos]
Length=327

 Score =   418 bits (1074),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 199/329 (60%), Positives = 248/329 (75%), Gaps = 6/329 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGHERPLTF+KYN +GDL+ +CAKDH+PT+W+AD G R+GTY GHNGAVW  DI
Sbjct  1     MRPILLKGHERPLTFIKYNADGDLIVTCAKDHHPTLWYADTGNRVGTYIGHNGAVWTADI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             +RDS  L TGSAD + KLWDV +G    TF FD P R+V FA+GD+  ++TTDPFMG+ +
Sbjct  61    TRDSKTLATGSADTSCKLWDVGSGVCFQTFQFDQPVRAVSFAIGDEKMLITTDPFMGVNA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGH---QGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
             AIH+  I  + E+QT + + T+ G     GR+NR  WG LN+T ++ GED VLR+WD ET
Sbjct  121   AIHIVEITKNREEQTSKILKTISGDGIVNGRLNRVAWGALNETFLTAGEDGVLRVWDVET  180

Query  633   GKLLKESDQESGHK-KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVN  457
             GK+L E+     HK K I  L  S D +H IT SLDK+AK++D + L LLKTYV +RPVN
Sbjct  181   GKVLHEA--RDAHKGKPIQHLELSADKTHAITASLDKTAKIFDAQNLELLKTYVADRPVN  238

Query  456   AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  277
             A  +SP+ +HI+LGGGQDA AVTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAF
Sbjct  239   AAIISPIREHIILGGGQDAMAVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAF  298

Query  276   NPDGKSFASGGEDGYVRLHHFDADYFHIK  190
              PDGKSF SGGEDGY R+HH D  YF IK
Sbjct  299   CPDGKSFTSGGEDGYARIHHLDNTYFDIK  327



>gb|EEC83341.1| hypothetical protein OsI_28738 [Oryza sativa Indica Group]
Length=251

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 216/249 (87%), Gaps = 0/249 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1     MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61    SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121   TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E GH+K ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +
Sbjct  181   LKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDI  240

Query  444   SPLLDHIVL  418
             SPLLDH  +
Sbjct  241   SPLLDHFTI  249



>gb|KCW69349.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=254

 Score =   397 bits (1021),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61    SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121   AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAK  517
             L+ESD+E+GHKK +TSL KS+DGSHF+TGS DKSAK
Sbjct  181   LRESDKETGHKKAVTSLMKSVDGSHFVTGSQDKSAK  216


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D +AKLW ++  T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFS-------IG---DKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  ++GH G I    + P  K+  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVI  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|NP_973697.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10669.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=254

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/250 (78%), Positives = 221/250 (88%), Gaps = 2/250 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61    SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121   AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             KLLK+SD+E GHKK ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV
Sbjct  181   KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAV  240

Query  450   TMSPLLDHIV  421
             ++SPLL+H+ 
Sbjct  241   SLSPLLNHVC  250



>ref|XP_005647023.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22479.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 241/322 (75%), Gaps = 3/322 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP L+KGHERPLT LKYNREGDLLFSCAKDH+PT+WF+++G R+GTY GHNGAV  CD+
Sbjct  1     MRPYLLKGHERPLTQLKYNREGDLLFSCAKDHHPTLWFSEDGARIGTYVGHNGAVNTCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DS+RL+TGS+D T KLW+V+TG  +FTF + +P R+V F++ ++LA ++TDPFM    
Sbjct  61    SMDSTRLLTGSSDSTAKLWEVETGRNVFTFKYQAPCRAVSFSIDEQLAALSTDPFMTTTP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AI++ RI+ DP +Q+ + V  ++G   RINR  +  LN  +IS GED  +R WD ETGK+
Sbjct  121   AINIVRISEDPSEQSDQPVQRLEGFSKRINRVTFTDLNTVLISAGEDGFVRRWDVETGKV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
              +E+     H+K I  +    DG+H +T S+DK  KL D +TL +LK + T+RP NA  +
Sbjct  181   KEEAKL---HEKEIRDMQLYKDGTHMVTASVDKLVKLVDTQTLEVLKFFNTDRPANAAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ D +++GGGQDA+ VTTT  RAG F+++F  KI  EEIG V+GHFGPINA+AF PDG
Sbjct  238   SPVFDQVLIGGGQDAADVTTTSDRAGGFQSRFIHKIFMEEIGSVRGHFGPINAVAFRPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYF  199
             +SFA+GGEDGY+R++HFD DY 
Sbjct  298   RSFATGGEDGYIRINHFDNDYL  319



>gb|KHN14569.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   389 bits (998),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  819  MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
            M LPSAIHVKRIA+DP +QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+
Sbjct  1    MELPSAIHVKRIANDPAEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDS  60

Query  639  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
            ETGKLLKESD+ESGHKK +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPV
Sbjct  61   ETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPV  120

Query  459  NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
            NAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA
Sbjct  121  NAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  180

Query  279  FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
            FNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  181  FNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  211


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -1

Query  1155  ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDI  985
             +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  25    LLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAK  84

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  835
             S D S  +TGS D++ +LWD +T T + T+  + P  +V      D  V     D  AV 
Sbjct  85    SADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  144

Query  834   TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  655
             TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  145   TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  197

Query  654   RI  649
             R+
Sbjct  198   RL  199



>gb|ETO77218.1| hypothetical protein F444_07544 [Phytophthora parasitica P1976]
Length=327

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/326 (56%), Positives = 237/326 (73%), Gaps = 5/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1     MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S RL+T +AD TVKLWDV+TG +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61    SYHSERLLTAAADATVKLWDVQTGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG
Sbjct  121   AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +LL+  D  +G    IT++A +   +  IT S D +AKL DI TL +LK Y T+RPVN+ 
Sbjct  181   QLLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLLDIETLKVLKVYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P
Sbjct  238   AISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYFHI  193
             +GKS+ASG EDGYVRLHHFD DY  +
Sbjct  298   NGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_008904158.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETI48440.1| hypothetical protein F443_07533 [Phytophthora parasitica P1569]
 gb|ETK88380.1| hypothetical protein L915_07354 [Phytophthora parasitica]
 gb|ETL41778.1| hypothetical protein L916_07299 [Phytophthora parasitica]
 gb|ETL94935.1| hypothetical protein L917_07189 [Phytophthora parasitica]
 gb|ETM48172.1| hypothetical protein L914_07247 [Phytophthora parasitica]
 gb|ETN10397.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETP18232.1| hypothetical protein F441_07512 [Phytophthora parasitica CJ01A1]
 gb|ETP46176.1| hypothetical protein F442_07542 [Phytophthora parasitica P10297]
Length=327

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/326 (56%), Positives = 237/326 (73%), Gaps = 5/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1     MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S RL+T +AD TVKLWDV+TG +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61    SYHSERLLTAAADATVKLWDVQTGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG
Sbjct  121   AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +LL+  D  +G    IT++A +   +  IT S D +AKL D+ TL +LK Y T+RPVN+ 
Sbjct  181   QLLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLLDVETLKVLKVYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P
Sbjct  238   AISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYFHI  193
             +GKS+ASG EDGYVRLHHFD DY  +
Sbjct  298   NGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_009538303.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
 gb|EGZ06406.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
Length=327

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 237/326 (73%), Gaps = 5/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1     MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S RL+T +AD +VKLWDV+TG +LF+F    P RSV+FA GDK  V   D F   P+
Sbjct  61    SYHSERLLTAAADASVKLWDVQTGEELFSFQHTGPARSVNFATGDKKFVSVADKFSDRPA  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             A+ V  +A+D   Q+ E VLT+   GH+GRI  A W PLN+ I++ G D  ++++D +TG
Sbjct  121   AVFVYELAADLAQQSAEPVLTIANHGHEGRITGAYWTPLNEAIMTTGGDGCIKLFDPQTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +LL+  D  +G    IT++A +   +  IT S D +AKL D+ T+ +LK Y T+RPVN+ 
Sbjct  181   ELLESHDIHTGE---ITNVAFNKTKTLAITSSKDNTAKLLDVETMKVLKVYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P
Sbjct  238   AISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYFHI  193
             +GKS+ASG EDGYVRLHHFD DY  +
Sbjct  298   NGKSYASGAEDGYVRLHHFDNDYLKL  323



>gb|KHN32457.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  819  MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
            M LPSAIHVKRIA+DP  Q GESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+
Sbjct  1    MELPSAIHVKRIANDPSQQIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDS  60

Query  639  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
            ETGKLL+ESD+ESGHKK +TSLAKS D SHF+TGSLDKSA+LWD R+LTL+KTYVTERPV
Sbjct  61   ETGKLLQESDKESGHKKTVTSLAKSADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPV  120

Query  459  NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
            NAVTMSPLLDH+V+GGGQDASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALA
Sbjct  121  NAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALA  180

Query  279  FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
            FNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  181  FNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  211


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  1155  ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDI  985
             +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  25    LLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKLLQESDKESGHKKTVTSLAK  84

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVM  835
             S D S  +TGS D++ +LWD ++ T + T+  + P  +V  +       +G   D  AV 
Sbjct  85    SADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVT  144

Query  834   TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  655
             TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  145   TTDHRAGKFEAKFFDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  197

Query  654   RI  649
             R+
Sbjct  198   RL  199



>ref|XP_002899797.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY60851.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
Length=327

 Score =   382 bits (982),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 237/326 (73%), Gaps = 5/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1     MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S RL+T +AD TVKLWDV++G +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61    SYHSERLLTAAADATVKLWDVQSGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
             A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D +TG
Sbjct  121   AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPKTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +LL+     +G    IT++A +   +  IT S D +AKL D+ TL +LK Y T+RPVN+ 
Sbjct  181   QLLESYVIHTGE---ITNVAFNKSKTLAITSSKDNTAKLLDVETLKVLKVYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+ +H+VLGGGQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P
Sbjct  238   AISPIKEHVVLGGGQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYFHI  193
             +GKS+ASG EDGYVRLHHFD DY  +
Sbjct  298   NGKSYASGAEDGYVRLHHFDNDYLKL  323



>ref|XP_011401093.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
 gb|KFM28081.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
Length=324

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 232/326 (71%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP +++GH RPL  +KYNREGDLL +C KD    +W+ ++G+R GT+ GH GAVW  DI
Sbjct  1     MRPFILQGHSRPLNQVKYNREGDLLVTCGKDKTVNLWWTEDGQRAGTFNGHTGAVWTSDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DS+RLITG AD  V LWD+ TG +   F F  P R+V F+VG+  A +++DPFM   S
Sbjct  61    SYDSTRLITGGADSAVILWDMNTGEEQHHFRFQEPCRAVKFSVGEAFAAVSSDPFMQAVS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             A+ +  IA+DP +Q  E+V T++G +GRI R  W   N+T+I+  ED  +R WD ETGK 
Sbjct  121   AVRILPIAADPAEQGEEAVQTLRGPRGRIARVEWTDQNRTLITASEDGFVRRWDVETGKE  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L     E  H+K I  L  S+DG+HFIT S+D S+KL D +TL +LKTY +  PVN+  +
Sbjct  181   LA---AEHVHEKNIQDLQMSVDGTHFITASVDCSSKLVDTQTLAVLKTYQSNVPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH++LGGGQDAS VTTT  RAG+FE++F+ K+ QEE G V+GHFGPINA++F+PDG
Sbjct  238   SPVYDHVILGGGQDASQVTTTSSRAGRFESRFFHKVFQEEFGNVRGHFGPINAVSFSPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
               FASGGE+GYVRLH FDADYF  K 
Sbjct  298   TGFASGGEEGYVRLHKFDADYFTTKF  323



>emb|CDP11515.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  819  MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
            MGLPSAI VKRIA DP DQ+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+
Sbjct  1    MGLPSAIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDS  60

Query  639  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
            ETGKLLKESD+E+GHKKGITSL+KS D +HFI+GSLDKSAKLWD+RTLTLLKTY TERPV
Sbjct  61   ETGKLLKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPV  120

Query  459  NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
            NAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALA
Sbjct  121  NAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALA  180

Query  279  FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
            FNPDGKSFA GGEDGYVRLHHFD DYF+IKI
Sbjct  181  FNPDGKSFARGGEDGYVRLHHFDPDYFNIKI  211



>ref|XP_001693266.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP03292.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=324

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 226/326 (69%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP L+KGHERPLT +KYNREGDLL SCAK+  P +W A++G R+GTY GHNGA+W CDI
Sbjct  1     MRPYLLKGHERPLTQVKYNREGDLLVSCAKNLQPCLWSAEDGRRIGTYEGHNGAIWTCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + DS RLITGSADQTV++WD+ TG +LF      P R+V  + G++    T+D F+  P 
Sbjct  61    TWDSDRLITGSADQTVRIWDLPTGKELFQIRHREPCRAVKLSAGERFLAATSDAFIESPP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIH+ + A + EDQT  + +     +GR+ R  W   N+ +I+  +  +LR WD ETG L
Sbjct  121   AIHIYKFAENIEDQTATAAIEWTVPKGRVTRVFWTDCNRKLITSHDGGILRRWDVETGAL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E   +  H+  I  +  S D +H IT SLDK+A+L D+ T  ++KTY T R V +  +
Sbjct  181   LQE---QQVHEDAIQDMQMSPDETHVITASLDKTARLIDVDTFEVMKTYKTGRFVQSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+V+GGGQDAS VTTT  +AG FEA+F+ KI QEE G V+GHFGPIN +AF+P G
Sbjct  238   SPLFDHVVMGGGQDASQVTTTAAQAGGFEARFFHKIFQEEFGRVRGHFGPINTVAFHPSG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSF +GGEDGYVRLHH D DYF  K 
Sbjct  298   KSFTTGGEDGYVRLHHMDMDYFTTKF  323



>gb|KIZ03352.1| Eukaryotic translation initiation factor 3 subunit I [Monoraphidium 
neglectum]
Length=329

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 231/330 (70%), Gaps = 8/330 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP L+KGHERPLT +KYNREGDL+ SCAK+  P +W AD+G R+GTY GHNGAVW C+I
Sbjct  1     MRPYLLKGHERPLTQVKYNREGDLMISCAKNLYPCLWMADDGTRIGTYEGHNGAVWTCEI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DS RLIT SADQTV++WD+ TG +L     + P R+   ++G+KL   TTD FMG+P 
Sbjct  61    SMDSQRLITSSADQTVRIWDLPTGKELHQIKMNEPCRACALSIGEKLLAFTTDSFMGIPP  120

Query  804   AIHVKRIASDPEDQTGESV-----LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
              IH+  +    E  +G+       LT    +GRI R  W   NK +++  +   +R WDA
Sbjct  121   QIHIVDVDLQAEPGSGQIAGDKPRLTFDAPKGRITRIGWVEQNKVLLTSHDGGFVRRWDA  180

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
             ETG+LL+E+     H+  I  +  S DGS+ +T SLDK+AKL D+ TL +LKTY T R V
Sbjct  181   ETGELLEEAQV---HEDAIQDMQFSQDGSYVVTASLDKTAKLVDVCTLEVLKTYKTGRFV  237

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
              +  +SPL+DH++ GGGQDAS VTTT  +AG FEA+F+ KI QEE G V+GHFGPIN++A
Sbjct  238   QSAAISPLMDHVLAGGGQDASQVTTTAAKAGGFEARFFHKIYQEEFGNVRGHFGPINSVA  297

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYFHIK  190
             F PDG+SFA+GGEDGYVR+HHFD +YF  K
Sbjct  298   FAPDGRSFATGGEDGYVRIHHFDMEYFSAK  327



>ref|XP_008808070.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Phoenix dactylifera]
Length=254

 Score =   362 bits (928),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 218/326 (67%), Gaps = 72/326 (22%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLTFLKYNREGDL                                    
Sbjct  1     MRPILMKGHERPLTFLKYNREGDL------------------------------------  24

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                   L + + D T  +W    G +L T+             G   AV   D       
Sbjct  25    ------LFSCAKDHTPTVWFADNGERLGTYK------------GHNGAVWCCD-------  59

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
                          QTGESVLT+KG  GRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  60    -----------VSQTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQL  108

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LKESD+E+GH+K ITSL+KS  GSHF++GSLDKSAKLWD RTLTL+K YVTERPVNA  +
Sbjct  109   LKESDKETGHQKPITSLSKSAKGSHFLSGSLDKSAKLWDARTLTLIKAYVTERPVNACAI  168

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPLLDH+V+GGGQDAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG
Sbjct  169   SPLLDHVVIGGGQDASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDG  228

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF SGGEDGYVRLHHFD DYF+IK+
Sbjct  229   RSFTSGGEDGYVRLHHFDPDYFNIKM  254



>ref|XP_002957235.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
 gb|EFJ41733.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
Length=324

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 221/326 (68%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP L+KGHERPLT +KYNREGDLL SCAKDH P +W +++G R+GTY GHNGA+W CDI
Sbjct  1     MRPYLLKGHERPLTQVKYNREGDLLVSCAKDHQPCLWSSEDGRRIGTYEGHNGAIWTCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + +S RLITGS DQT+++WD+ TG +LF      P R+V  + G++    TTD F+  P 
Sbjct  61    TWESDRLITGSGDQTIRIWDLPTGKELFQIRHGEPCRAVKLSAGERFLAATTDAFIESPP  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              IH+   A + EDQ    V      +GRI R  W   N+ +I+  +  +LR WD ETG++
Sbjct  121   GIHIYNFAENVEDQRSTPVNAWTVPKGRITRIFWTDCNRKVITSHDYGILRRWDVETGQM  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L+E      H+  I  +  S D +H IT SLDK+A+L DI T T+LK Y T R V +  +
Sbjct  181   LQEVQV---HEDAIQDMQMSPDETHVITASLDKTARLIDIETFTVLKVYKTGRFVQSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL DH+++GGGQDAS VTTT   AG FEA+F+ K+ QEE G V+GHFGP+N +AF+P G
Sbjct  238   SPLFDHVLMGGGQDASQVTTTAAGAGGFEARFFHKVFQEEFGRVRGHFGPVNTVAFHPSG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             +SF +GGEDGYVRLHH D DYF  K 
Sbjct  298   RSFTTGGEDGYVRLHHMDLDYFTTKF  323



>emb|CCA18540.1| eukaryotic translation initiation factor 3 subunit p [Albugo 
laibachii Nc14]
Length=331

 Score =   357 bits (915),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 226/324 (70%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+KGH R +T +KYNREGDLL SC+KD+ P +W++  GER+GTY GH G++W CDI
Sbjct  1     MRPILLKGHSRSITMVKYNREGDLLVSCSKDNAPNLWYSQTGERIGTYEGHTGSLWACDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S+ L+T SAD TVKLWDV TG  LFTF    P RSV F++GD+  V   D F+  P+
Sbjct  61    SYHSTYLLTASADSTVKLWDVSTGKCLFTFRHTGPVRSVQFSLGDRYFVSVCDKFVDHPA  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGH--QGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              I V  + +D      + VL +  H   GRI  A W PLNK+I++ G D  L+++D ++G
Sbjct  121   TISVYALPNDINQLVDQPVLKITNHGFNGRITGAYWMPLNKSILASGGDGGLKVFDPKSG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             K+LKE    SG    +T+++ +   +  IT S D +AKL D+ TL +LKTY T+RPVN+ 
Sbjct  181   KVLKECKIHSG---DVTNISFNKLKTLAITSSKDNTAKLLDVETLDVLKTYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              MSP+ +H+VLGGGQ+A +VTTT  + GKFEA+F+  + QEE   VKGHFGPIN +AF+P
Sbjct  238   AMSPIREHVVLGGGQEAMSVTTTSGQVGKFEARFFHMVFQEEFARVKGHFGPINTIAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS+ SG EDGYVRLHHFD DYF
Sbjct  298   DGKSYVSGAEDGYVRLHHFDEDYF  321



>ref|XP_008613397.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|EQC33274.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|KDO31229.1| hypothetical protein SPRG_03847 [Saprolegnia parasitica CBS 223.65]
Length=325

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 228/324 (70%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M PIL+KGH R +T +K+NREGDLL + AKDH P++W++  GER+GT+ GH GAVW CDI
Sbjct  1     MHPILLKGHSRSITMIKHNREGDLLVTVAKDHVPSLWYSSTGERIGTFHGHQGAVWACDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S  S  L+T +AD TVKLWD+KTG +LF+F      RSV+FA GDK  +   D F   P+
Sbjct  61    SYHSEFLLTAAADATVKLWDLKTGKELFSFTHTGSARSVNFAHGDKQFISVADQFAENPA  120

Query  804   AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              + V  +A + E Q+ +    +T  GH+GR+  A W PLN+ I++ GED ++++++ ETG
Sbjct  121   TVFVYDLAQNGEKQSSQPKLAITKHGHKGRVTGAYWMPLNEGILTTGEDGMVKLFNPETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
              L+ E    +G    ITSL+ + D +  IT S D +AKL D+ TL +LKTY T+RPVN+ 
Sbjct  181   ALISEHKVHNG---SITSLSFNKDKTLAITSSKDNTAKLLDVETLEVLKTYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SP  +H+VLGGGQ+A  VT T  RAGKFEA+F+ ++ +EE G VKGHFGPIN++ F+P
Sbjct  238   SISPTKEHVVLGGGQEAMTVTVTAGRAGKFEARFFHQVYEEEFGRVKGHFGPINSITFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS+ SG EDGYVR+HHFD +Y 
Sbjct  298   DGKSYTSGAEDGYVRIHHFDQEYL  321



>ref|XP_009821601.1| hypothetical protein H257_00561 [Aphanomyces astaci]
 gb|ETV89201.1| hypothetical protein H257_00561 [Aphanomyces astaci]
Length=325

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 231/324 (71%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL+KGH R +T +K+NREGDLL +CAKDH P++W++ NGER+GT+ GH GAVW CDI
Sbjct  1     MQPILLKGHSRSITMIKHNREGDLLVTCAKDHVPSLWYSHNGERIGTFHGHTGAVWACDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S +S  L+T +AD +VKLWD++TG ++F+F      RSV+F++GDK  V   D F   P+
Sbjct  61    SYNSEYLLTAAADASVKLWDLQTGKEIFSFTHTGSARSVNFSLGDKSFVSVADQFGDHPA  120

Query  804   AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              + V  +A + E Q+ +    +T  GHQGR+  A W  LN+ II+ GED  +++++ ETG
Sbjct  121   TVFVYDLAQNGEKQSSQPRLAITKHGHQGRVTGAYWTALNEAIITTGEDGYVKLFNPETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
              L+ E+   +G    IT+LA + D +  IT S D +AKL D+  + +LKTY T+RPVN+ 
Sbjct  181   ALISETKVHNG---VITNLAFNKDKTLGITSSKDNTAKLIDLDAMQVLKTYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SP  +H+VLGGGQ+A  VT T  RAGKFEA+F+ ++ +EE   VKGHFGPIN++ F+P
Sbjct  238   SISPTKEHVVLGGGQEAMTVTVTAGRAGKFEARFFHQVFEEEFARVKGHFGPINSITFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS++SG EDGYVR+HHFD DY 
Sbjct  298   DGKSYSSGAEDGYVRIHHFDQDYL  321



>ref|XP_008862518.1| hypothetical protein H310_01239 [Aphanomyces invadans]
 gb|ETW08713.1| hypothetical protein H310_01239 [Aphanomyces invadans]
Length=325

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/324 (51%), Positives = 229/324 (71%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL+KGH R +T +K+NREGDLL +CAKDH P++W++ NGER+GT+ GH GAVW CDI
Sbjct  1     MQPILLKGHSRSITMIKHNREGDLLVTCAKDHVPSLWYSHNGERIGTFHGHTGAVWACDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S +S  L+T +AD +VKLWD++TG +LF+F      RSV+F++GDK  V   D F   P 
Sbjct  61    SYNSEFLLTAAADASVKLWDLQTGKELFSFTHTGSARSVNFSLGDKSFVSVADQFGDHPP  120

Query  804   AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              + V  +A + E Q+ +    +T  GHQGR+  A W  LN  II+ GED  +++++ ETG
Sbjct  121   TVFVYDLAQNGEKQSSQPRLAITKHGHQGRVTGAYWTSLNDGIITTGEDGYVKLFNPETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
              L+ E+   +G    IT+LA +   +  IT S D +AKL D+ T  +LKTY T+RPVN+ 
Sbjct  181   ALITEAKVHNG---VITNLAFNKTKTLGITSSKDNTAKLIDLETFEVLKTYETDRPVNSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
             ++SP+ +H+VLGGGQ+A +VT T  RAGKFEA+F+ ++ +EE   VKGHFGPIN++ F+P
Sbjct  238   SISPIKEHVVLGGGQEAMSVTITAGRAGKFEARFFHQVFEEEFARVKGHFGPINSITFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS+ SG EDGYVR+HHFD DY 
Sbjct  298   DGKSYTSGAEDGYVRIHHFDQDYL  321



>ref|XP_005535289.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79003.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
Length=327

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 220/324 (68%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP+L+KGHERPLT LK+N EGDLLF+ AKD  PTVW+A  GERLGTY GH GAVW CD+
Sbjct  1     MRPLLLKGHERPLTQLKFNPEGDLLFTTAKDTRPTVWWASTGERLGTYDGHTGAVWSCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               DS+RL+TGSAD T +LWDV+TG +LF ++  S  RSV  A G +L  +     +G  S
Sbjct  61    FWDSTRLLTGSADNTARLWDVQTGRELFRWSLRSSVRSVGVAPGCRLMHLANSKLLGQES  120

Query  804   AIHVKRIASDP--EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              IH+ R+ SD   ++Q  E  L ++GH   I   VW    + ++S  ED  +R WD ETG
Sbjct  121   CIHLFRLKSDGNWQEQETEPFLVLRGHTATITGVVWYNTAEYMLSVSEDGTVRKWDVETG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             K   E D+   HKK IT +  S D   F+TGS D +A LWD   +  ++++V +RP+NAV
Sbjct  181   K---EVDRAKRHKKAITDIKFSKDHQMFLTGSADGTAVLWDTHAMQEIRSFVLDRPLNAV  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SPL+ H V+GGGQ+AS VTTT  +AGKF A F   I  EEI  VKGHFGPIN L+F P
Sbjct  238   DLSPLMPHAVVGGGQEASQVTTTAGKAGKFAATFLHLIYGEEIFSVKGHFGPINCLSFTP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DG+ FASGGEDGYVRLHHFD +Y+
Sbjct  298   DGRGFASGGEDGYVRLHHFDEEYY  321



>ref|XP_005707349.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
 gb|EME30829.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
Length=324

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 220/323 (68%), Gaps = 3/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP+++KGHERPLT LKYN EGDLLFS AKD  PTVW+  NGER+GTYRGHNGAVW  D+
Sbjct  1     MRPLILKGHERPLTMLKYNSEGDLLFSTAKDSTPTVWWTSNGERIGTYRGHNGAVWSIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + DS+R++TGSAD + K W  +TG  + T+   SP R V F+  D+   + T   MG  S
Sbjct  61    NNDSTRVVTGSADNSAKFWRAETGECILTWTHKSPVRCVSFSSDDQFVFVATAMLMGQSS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I+   + S+  ++    + T  GH   + R V  P  KT+IS GED  +R WD ETG  
Sbjct  121   EIYQYLVDSESLEEASVPIRTFSGHSATVTRVVCHPTEKTLISTGEDGTVRKWDIETG--  178

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
              + ++  + H+K I  L  S  G   IT S D SAK+ D R+L +LKT++T+RPVN+  +
Sbjct  179   -RNTETVTIHQKPINDLQLSKSGGQLITASSDFSAKILDFRSLKVLKTFLTDRPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+L H++LGGGQ+AS VTTT  RAG+FEA+ +  I ++EIG ++GHFGPIN +AF+PDG
Sbjct  238   SPILPHVLLGGGQEASQVTTTGDRAGRFEARLFHLIYEDEIGIIRGHFGPINTVAFSPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFH  196
               FASG E+G++RLH+FD +YF 
Sbjct  298   LQFASGAEEGFIRLHNFDEEYFQ  320



>gb|ERN16446.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
Length=238

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  792  KRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKES  613
            K I     ++TGESVL ++G QGRINRAVWGPLN+TIISGGED+V+R+WD+ETGKLLKE+
Sbjct  37   KNICRAMREKTGESVLVIRGPQGRINRAVWGPLNRTIISGGEDAVIRMWDSETGKLLKET  96

Query  612  DQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLL  433
            D+E GH+K ITSL+KS DGSHF+TGSLDKSAKLWD+RTLTL+KTYVTERPVNA  +SPL 
Sbjct  97   DKEIGHQKTITSLSKSSDGSHFLTGSLDKSAKLWDVRTLTLIKTYVTERPVNACAISPLH  156

Query  432  DHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFA  253
            DH+V+GGGQ+AS VTTTD RAGKFEAKF+ +IL+EEIGGVKGHFGPINALAFNPDG+SF+
Sbjct  157  DHVVIGGGQEASHVTTTDRRAGKFEAKFFHQILEEEIGGVKGHFGPINALAFNPDGRSFS  216

Query  252  SGGEDGYVRLHHFDADYFHIKI  187
            SGGEDGYVRLHHFDADYF+IK+
Sbjct  217  SGGEDGYVRLHHFDADYFNIKM  238



>gb|ACF82853.1| unknown [Zea mays]
Length=211

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  801  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
            + VKRIA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+LL
Sbjct  7    VQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRIWDSETGQLL  66

Query  621  KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
            KESD+ESGH+K I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +S
Sbjct  67   KESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDIS  126

Query  441  PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
            P  D +VLGGGQDA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+
Sbjct  127  PTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGR  186

Query  261  SFASGGEDGYVRLHHFDADYFHIKI  187
            SF+SGGEDGYVRLHHFD+DYF IK+
Sbjct  187  SFSSGGEDGYVRLHHFDSDYFSIKM  211


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = -1

Query  1092  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  922
             + +  +D    +W ++ G+ L       GH   +     S D S  ITGS D++ KLWD 
Sbjct  46    IITAGEDATVRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDT  105

Query  921   KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  772
             +T T + T+  + P  +VD +            D + V  TD   G   A    +I    
Sbjct  106   RTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ--  163

Query  771   EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  649
                  E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  164   -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  199



>gb|ACD65081.1| eukaryotic translation initiation factor [Forcipomyia taiwana]
Length=325

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 222/325 (68%), Gaps = 8/325 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++M+GHER +T +KYNREGDLLFSCAKDH P VWF+ NGERLGT+ GH GAVWC D+
Sbjct  1     MKPLMMQGHERAITQIKYNREGDLLFSCAKDHKPNVWFSLNGERLGTFNGHAGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +++LITGS D +V+LWDV+TGT +      S  R+V F+     A  +TD  MG   
Sbjct  61    DWTTTKLITGSGDMSVRLWDVETGTSVACIPCKSSARTVGFSFSGNQAAYSTDRAMGHIC  120

Query  804   AIHVKRIASDPEDQT---GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
              + V  I S   D +   G+++L +   Q +I   +WG L++TII+G E+  + +WD   
Sbjct  121   ELFV--IDSREPDSSLNDGDAILKIPISQSKITAMIWGTLDETIITGHENGQITLWDLRI  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             G+   E +  + H   I  L  S DG+ F++ S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   GR---EINSVNDHMGAINDLQLSKDGTMFVSSSRDTTAKLFDSDSLMCLKTYKTERPVNS  235

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SPLL+H+VLGGGQDA  VTTT  R GKF+++F+  I +EE   VKGHFGPIN+LAF+
Sbjct  236   AAISPLLEHVVLGGGQDAMEVTTTSARQGKFDSRFFHLIYEEEFARVKGHFGPINSLAFH  295

Query  273   PDGKSFASGGEDGYVRLHHFDADYF  199
             PDG+S+A+GGEDG+VRL  FD+ Y+
Sbjct  296   PDGRSYATGGEDGFVRLQTFDSSYY  320



>gb|ELU14583.1| hypothetical protein CAPTEDRAFT_180537 [Capitella teleta]
Length=325

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 218/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GH+R LT +KYNREGDLLFSCAKD +P VW++ NGERLGT+ GH GAVWC D+
Sbjct  1     MKPLMLHGHDRALTQIKYNREGDLLFSCAKDSHPNVWYSINGERLGTFEGHGGAVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+S+++TGSAD T +LWD  TG QL  F+  S  R+  F+   +L + TTD  MG   
Sbjct  61    DWDTSKVMTGSADNTCRLWDCSTGVQLEQFDTRSAVRTCGFSYSGQLLMYTTDSTMGQKC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + +       + +  E ++ +     ++  AVWGPL++T+ISG E+  +  WD + G++
Sbjct  121   EMRIYDSRDSAQIKNNEPMMVLPMPASKVTSAVWGPLDQTVISGHENGNIIQWDMKEGEM  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             + +      H K I  +  S D + FIT S D +AKL+D +TLT  KTY TERPVN+  +
Sbjct  181   VHKV---LDHSKQINDIQFSKDMTMFITASKDNTAKLFDTQTLTHKKTYKTERPVNSAAV  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL  H++LGGGQ+A  VTTT  R GKF+A+ ++ I  EE G +KGHFGPIN +AF PDG
Sbjct  238   SPLKPHVILGGGQEAMDVTTTSTRIGKFDARLFNLIFAEEFGRIKGHFGPINTVAFQPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             + ++SGGEDGY+RLH FD+ YF   I
Sbjct  298   RGYSSGGEDGYIRLHQFDSQYFEFDI  323



>ref|XP_002021487.1| GL26537 [Drosophila persimilis]
 ref|XP_001355946.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GSH1.1|EIF3I_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
persimilis]
 sp|Q29L19.2|EIF3I_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
pseudoobscura pseudoobscura]
 gb|EDW25330.1| GL26537 [Drosophila persimilis]
 gb|EAL33005.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
Length=326

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 219/326 (67%), Gaps = 7/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               +S +LITG+ D T KLWDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWESRKLITGAGDMTTKLWDVEYGTIIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNC  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+   S   DQT    L +   + +I    WGPL++TII+G ++  + IWD   
Sbjct  121   ELFIIDVRNADSTLADQT--PTLRIPMTESKITSMQWGPLDETIITGHDNGNIAIWDVRK  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   GQ--KVVDSGSDHAAGINDMQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNS  236

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+
Sbjct  237   AAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFH  296

Query  273   PDGKSFASGGEDGYVRLHHFDADYFH  196
             PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  297   PDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_006471278.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
Length=186

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1     MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61    SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD E   +
Sbjct  121   AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTEVRVI  180

Query  624   L  622
             L
Sbjct  181   L  181


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 75/182 (41%), Gaps = 20/182 (11%)
 Frame = -1

Query  747  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  568
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  567  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  388
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +            D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAV----------GDKLAVI  110

Query  387  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  228  RL  223
            R+
Sbjct  171  RI  172



>ref|XP_005761487.1| hypothetical protein EMIHUDRAFT_438175 [Emiliania huxleyi CCMP1516]
 gb|EOD09058.1| hypothetical protein EMIHUDRAFT_438175 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   332 bits (850),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 224/326 (69%), Gaps = 5/326 (2%)
 Frame = -1

Query  1167  KMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD  988
             K+RPI++KGHER LT +KYNR+GDL+FSC+KDH P+VW+++NGER+GTY GH G VWC D
Sbjct  3     KIRPIMIKGHERALTMIKYNRDGDLIFSCSKDHVPSVWYSENGERIGTYHGHCGTVWCLD  62

Query  987   ISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLP  808
             ++ DS++L++GSAD   KLW+V++G  L T+   +P R V FA+GDK  +   D  MG  
Sbjct  63    VNWDSTKLLSGSADNCCKLWEVQSGECLHTWKHTAPVRCVGFAMGDKRFLTVLDNIMGNV  122

Query  807   SAIHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
               I+V  +  ++  +     +LT+ GH G+I RA+WGPLN+ I S  +DS LR+WD ++G
Sbjct  123   PTIYVWELELNNLANHPDCPLLTILGHTGKIGRALWGPLNEAIYSVSDDSTLRMWDPDSG  182

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +  ++   E  H K IT L  S D +   T   D+  +L++ +TL LL  + +ERP+N+ 
Sbjct  183   E--EKHVMEGVHTKKITDLQLSYDKTLLCTSCTDQFVRLFETKTLRLLYAFNSERPLNSA  240

Query  450   TMSPL--LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  277
              +SPL    +++ GGGQDA +VTTT  + GKFE  F+D    EE+G + GHFGP+N LAF
Sbjct  241   AISPLPHCPYLIAGGGQDAMSVTTTAAQQGKFETLFFDHAFGEELGCIGGHFGPVNTLAF  300

Query  276   NPDGKSFASGGEDGYVRLHHFDADYF  199
              P G+S+ASGGEDGY+R+HH D +YF
Sbjct  301   APHGRSYASGGEDGYIRIHHLDQEYF  326



>ref|XP_001968738.1| GG24335 [Drosophila erecta]
 sp|B3N4C7.1|EIF3I_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
erecta]
 gb|EDV57797.1| GG24335 [Drosophila erecta]
Length=326

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 220/326 (67%), Gaps = 7/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121   ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNS  236

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+
Sbjct  237   AAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFH  296

Query  273   PDGKSFASGGEDGYVRLHHFDADYFH  196
             PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  297   PDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|NP_523478.1| Trip1 [Drosophila melanogaster]
 ref|XP_002037884.1| GM18055 [Drosophila sechellia]
 sp|O02195.1|EIF3I_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog; AltName: 
Full=eIF-3-beta [Drosophila melanogaster]
 sp|B4I195.1|EIF3I_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
sechellia]
 gb|AAB53431.1| TRIP-1 homolog [Drosophila melanogaster]
 gb|AAF52183.1| Trip1 [Drosophila melanogaster]
 gb|AAM49896.1| LD24026p [Drosophila melanogaster]
 gb|EDW54302.1| GM18055 [Drosophila sechellia]
 gb|ACL84827.1| Trip1-PA, partial [synthetic construct]
 gb|ACL89803.1| Trip1-PA [synthetic construct]
Length=326

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 220/326 (67%), Gaps = 7/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWESRKLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121   ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNS  236

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+
Sbjct  237   AAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFH  296

Query  273   PDGKSFASGGEDGYVRLHHFDADYFH  196
             PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  297   PDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_008549768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 224/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG++WC D+
Sbjct  1     MKPLMLHGHERAITMIKYNREGDLIFSASKDKKPNVWYSLNGERLGTFNGHNGSIWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D+SR ++GS D ++++WD +TG ++   + +S  RS  F+     AV +TD  +G   
Sbjct  61    NWDTSRFLSGSGDNSLRIWDCQTGKEIGRLDTNSSVRSCAFSFSANTAVFSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +    + +P     ++++ +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121   EMFIIDTRNVEPTLSLEDAIIRIPINGPRISAILWGALDETIITGHEDGEINIWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L   + + GHK  I  +  S DG+ FIT S D +AKL+D  +L  LKTY TERPVN+ T
Sbjct  181   KL---NSQKGHKSQINDMQASKDGTMFITASKDHTAKLFDSESLMHLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+A+FY  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIYDHVVLGGGQDAMDVTTTSTRQGKFDARFYHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+SF+SGGEDGYVR++ FD  YF
Sbjct  298   GRSFSSGGEDGYVRINTFDQSYF  320



>ref|XP_002078185.1| GD22675 [Drosophila simulans]
 sp|B4Q354.1|EIF3I_DROSI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
simulans]
 gb|EDX03770.1| GD22675 [Drosophila simulans]
Length=326

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 220/326 (67%), Gaps = 7/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWESRKLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121   ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
             G+  K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNS  236

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+
Sbjct  237   AAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFH  296

Query  273   PDGKSFASGGEDGYVRLHHFDADYFH  196
             PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  297   PDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_004364074.2| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=325

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 215/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPI+++GHER LT +KYN+EGDLLFS +KD    VWF+ NGERLGTY GHNG VWC D+
Sbjct  1     MRPIILQGHERSLTQIKYNKEGDLLFSVSKDKLANVWFSHNGERLGTYDGHNGTVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                S  ++TGSADQ+ +LW+ +TG QL  F   +  R+  F+   K    TTD  MG P 
Sbjct  61    DYASKYVLTGSADQSARLWECRTGKQLVKFATPTSVRTCGFSYSGKTIFYTTDNVMGHPC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I    +  +    T    +       +I  AV+GPL+KT+I+G +D  + +WD ETGK+
Sbjct  121   RIFFHDLKDELAQSTEPKKIIDLPAGNKITAAVFGPLDKTLITGHDDGTINVWDVETGKI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K S +   H+K I S+  + D + F++ S D +AKL+D  TL +LKTY T   VN+  +
Sbjct  181   IKSSQE---HEKYINSIQLNGDQTSFVSASKDSTAKLFDTETLEVLKTYKTPTNVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SPL  H+VLGGGQ+A  VTTT  R GKFE +F+  I +EEIG VKGHFGPIN +AF+P G
Sbjct  238   SPLRPHVVLGGGQEAREVTTTSTRVGKFEVRFFHLIFEEEIGRVKGHFGPINTVAFHPSG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KSFASGGEDG++R+H FD DY+  + 
Sbjct  298   KSFASGGEDGFIRVHAFDPDYYEFEF  323



>ref|XP_001965147.1| GF23646 [Drosophila ananassae]
 gb|EDV33281.1| GF23646 [Drosophila ananassae]
Length=332

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 221/330 (67%), Gaps = 7/330 (2%)
 Frame = -1

Query  1176  RNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW  997
             R  + RP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVW
Sbjct  3     RCYRSRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVW  62

Query  996   CCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFM  817
             C D+  +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  M
Sbjct  63    CLDVDWESRKLITGAGDMTTKIWDVEYGTIIASIPSKSSVRTSNFSFSGNQAAYSTDKAM  122

Query  816   GLPSA---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIW  646
             G       I V+   S   +QT    L +   + +I   +WGPL++TII+G ++  + IW
Sbjct  123   GQSCELFIIDVRNADSSLAEQT--PTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIW  180

Query  645   DAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTER  466
             D   G+  K  D  S H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TER
Sbjct  181   DIRKGQ--KVVDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTER  238

Query  465   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINA  286
             PVN+  +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+
Sbjct  239   PVNSAAISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINS  298

Query  285   LAFNPDGKSFASGGEDGYVRLHHFDADYFH  196
             LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   LAFHPDGKSYASGGEDGFVRVQTFDSTYFE  328



>ref|XP_011337589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cerapachys biroi]
 gb|EZA54998.1| Eukaryotic translation initiation factor 3 subunit I [Cerapachys 
biroi]
Length=326

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 224/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER  T +KY+REGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERATTKIKYSREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D+SRL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTSRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121   EMFIMDIRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  TL LLKTY TERPVN+ T
Sbjct  181   KLTSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSETLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_004341724.1| eTGF-beta receptor-interacting protein, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19632.1| eTGF-beta receptor-interacting protein, putative [Acanthamoeba 
castellanii str. Neff]
Length=343

 Score =   329 bits (844),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 225/329 (68%), Gaps = 19/329 (6%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             +RPIL+KGHER LTFLKYNR+GDL+FS AKD  P VWF+D GERLGTY+GH G       
Sbjct  12    LRPILLKGHERALTFLKYNRDGDLIFSAAKDPTPCVWFSDTGERLGTYKGHTG-------  64

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               DS  L+T SAD T KLW+V+TG +LF+++  +P R V FA GD+  +  TDPF  L S
Sbjct  65    --DSKLLLTASADTTAKLWNVETGEELFSWSHRAPVRCVAFAKGDRKFLAVTDPFTKLAS  122

Query  804   AIHVKRIASDPEDQTGESVLTMK-----GHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
             +I++ ++  DPE    ++ L M+         +I +A+WGPLNK II   ED  + I D 
Sbjct  123   SIYIYKL--DPERPAKQNPLPMREIVAPTPSAKITQALWGPLNKYIIYSSEDCSVYIHDP  180

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
             E+G+LL      + H+  + S+A S D ++FIT S D++A+L+D +T  LLKT+ + +PV
Sbjct  181   ESGELLHTI---TDHQAQVNSIAFSWDETYFITSSDDRTARLYDSKTFKLLKTFESAKPV  237

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
             N+  +SP+LDH++LGGGQ A  VTT+   +G FEA+ YD I +EE+G +KGHFGPIN ++
Sbjct  238   NSAAISPILDHVLLGGGQKAHGVTTSAVESGGFEARIYDMIFEEELGSIKGHFGPINTIS  297

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYFHI  193
             + PDGKS+ SG EDGY+R++H D  YF +
Sbjct  298   YAPDGKSYTSGSEDGYMRIYHLDKFYFTL  326



>emb|CCI46504.1| unnamed protein product [Albugo candida]
Length=317

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 214/310 (69%), Gaps = 5/310 (2%)
 Frame = -1

Query  1122  FLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQ  943
              +KYNREGDLL SCAKD++P +W++  GER+GTY GH G++W CDIS  S+ L+T SAD 
Sbjct  1     MVKYNREGDLLVSCAKDNSPNLWYSQTGERIGTYEGHTGSLWACDISYHSTYLLTASADS  60

Query  942   TVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQ  763
             TVKLWD+ TG  LFTF    P RSV F++GD+  V   D F+  P+ I V  + +D    
Sbjct  61    TVKLWDLPTGKCLFTFKHTGPVRSVQFSLGDRYFVSVCDKFVDHPATISVYALPNDVNQL  120

Query  762   TGESVLTMKGH--QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKK  589
               + +L +  H   GRI  A W PLN +I++ G D  L+++D ++GK+LKE    SG   
Sbjct  121   VDQPILKITNHGFNGRITGAYWMPLNTSILASGGDGGLKLFDPKSGKVLKECKIHSG---  177

Query  588   GITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGG  409
              IT+++ +   +  IT S D +AKL D+ TL +LKTY T+RPVN+  +SP+ +H+VLGGG
Sbjct  178   DITNISFNKLKTLAITSSKDNTAKLVDVETLDVLKTYETDRPVNSAAISPIREHVVLGGG  237

Query  408   QDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  229
             Q+A +VTTT  + GKFEA+F+  + QEE   VKGHFGPIN +AF+PDGKS+ SG EDGYV
Sbjct  238   QEAMSVTTTSGQVGKFEARFFHMVFQEEFARVKGHFGPINTIAFHPDGKSYVSGAEDGYV  297

Query  228   RLHHFDADYF  199
             RLHHFD DYF
Sbjct  298   RLHHFDEDYF  307



>ref|XP_011254946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camponotus floridanus]
Length=326

 Score =   328 bits (842),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 224/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER  T +KYNREGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERATTKIKYNREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLSTNSSVRACGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121   EMFIMDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_001656392.1| AAEL013144-PA [Aedes aegypti]
 sp|Q16K15.1|EIF3I_AEDAE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Aedes aegypti]
 gb|EAT34637.1| AAEL013144-PA [Aedes aegypti]
Length=326

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/325 (49%), Positives = 221/325 (68%), Gaps = 7/325 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GHER +T +KYNREGDL+FS AKDH P+VWF+ NGERLGT+ GH GAVWC D+
Sbjct  1     MKPLMLQGHERAITQIKYNREGDLIFSTAKDHKPSVWFSLNGERLGTFNGHQGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                ++RLITGS D + KLWDV+TG+ L T   +S  R+V+F+     A  +TD  MG   
Sbjct  61    DWTTTRLITGSGDMSTKLWDVETGSVLGTIPCNSAARTVNFSYSGNQASYSTDKAMGHNC  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+ + S   +Q+    LTM   Q +I   +WG L++T+I+G E+  +RIWD   
Sbjct  121   ELFIIDVRNVDSSISNQSPVLKLTMN-QQSKITSMLWGALDETVITGHENGSIRIWDLRA  179

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
              K L   +    H   I  +  S DG+  ++ S D +AKL+D  +L  LKTY TERPVN+
Sbjct  180   AKELNSVND---HTLNINDMQLSSDGTMLVSASKDATAKLFDSESLMCLKTYKTERPVNS  236

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SP+ +H+VLGGGQ+A  VTTT  +AGKF+++F+  + +EE   VKGHFGPIN+LAF+
Sbjct  237   AAISPIHEHVVLGGGQEAMEVTTTSTKAGKFDSRFFHLVYEEEFARVKGHFGPINSLAFH  296

Query  273   PDGKSFASGGEDGYVRLHHFDADYF  199
             PDGKS+A+GGEDG+VR+  FDA Y+
Sbjct  297   PDGKSYATGGEDGFVRVQVFDASYY  321



>ref|XP_011055583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Acromyrmex echinatior]
Length=326

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 225/323 (70%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCETGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121   EMFIMDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLSSV---KGHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYMRINNFDQSYF  320



>ref|XP_011160448.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Solenopsis invicta]
Length=326

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 225/323 (70%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  ++     G RI+  +WG L++TII+G ED  L++WD  TGK
Sbjct  121   EMFIMDVRNVDSTLSQEDAISRILVNGPRISAILWGALDETIITGHEDGELKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLSSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSESLVLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYMRINNFDQSYF  320



>ref|XP_011638812.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Pogonomyrmex barbatus]
Length=326

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 224/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++     +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLTTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121   EMFIMDVRNVDSTLSQEDAISRILVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_002088703.1| Trip1 [Drosophila yakuba]
 gb|EDW88415.1| Trip1, partial [Drosophila yakuba]
Length=325

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 219/325 (67%), Gaps = 7/325 (2%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             RP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+ 
Sbjct  1     RPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVD  60

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    
Sbjct  61    WESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCE  120

Query  801   ---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
                I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   G
Sbjct  121   LFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKG  178

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             +  K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LK+Y TERPVN+ 
Sbjct  179   Q--KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKSYKTERPVNSA  236

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+P
Sbjct  237   AISPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHP  296

Query  270   DGKSFASGGEDGYVRLHHFDADYFH  196
             DGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  297   DGKSYASGGEDGFVRVQTFDSTYFE  321



>gb|KJE92223.1| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=329

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 214/325 (66%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             RPI+++GHER LT +KYN+EGDLLFS +KD    VWF+ NGERLGTY GHNG VWC D+ 
Sbjct  6     RPIILQGHERSLTQIKYNKEGDLLFSVSKDKLANVWFSHNGERLGTYDGHNGTVWCIDVD  65

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
               S  ++TGSADQ+ +LW+ +TG QL  F   +  R+  F+   K    TTD  MG P  
Sbjct  66    YASKYVLTGSADQSARLWECRTGKQLVKFATPTSVRTCGFSYSGKTIFYTTDNVMGHPCR  125

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             I    +  +    T    +       +I  AV+GPL+KT+I+G +D  + +WD ETGK++
Sbjct  126   IFFHDLKDELAQSTEPKKIIDLPAGNKITAAVFGPLDKTLITGHDDGTINVWDVETGKII  185

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
             K S +   H+K I S+  + D + F++ S D +AKL+D  TL +LKTY T   VN+  +S
Sbjct  186   KSSQE---HEKYINSIQLNGDQTSFVSASKDSTAKLFDTETLEVLKTYKTPTNVNSAAIS  242

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             PL  H+VLGGGQ+A  VTTT  R GKFE +F+  I +EEIG VKGHFGPIN +AF+P GK
Sbjct  243   PLRPHVVLGGGQEAREVTTTSTRVGKFEVRFFHLIFEEEIGRVKGHFGPINTVAFHPSGK  302

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             SFASGGEDG++R+H FD DY+  + 
Sbjct  303   SFASGGEDGFIRVHAFDPDYYEFEF  327



>ref|NP_001040433.1| eukaryotic translation initiation factor 3 subunit I [Bombyx 
mori]
 sp|Q1HPW4.1|EIF3I_BOMMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Bombyx mori]
 gb|ABF51377.1| eukaryotic translation initiation factor 3 subunit 2 beta [Bombyx 
mori]
Length=329

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 216/323 (67%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GH+R +T +KYNREGDLLFS AKD  P VW++ NGERLGT+ GH G +WC D+
Sbjct  1     MKPLMLQGHQRAITQIKYNREGDLLFSAAKDSKPNVWWSLNGERLGTFNGHGGVIWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                S  LITG  D + +LWD++TG  + T   +S  R+ +F+     A  TTD  MG P 
Sbjct  61    DWQSINLITGGGDSSCRLWDLETGKNIATLKSNSSVRTCNFSYSAYQAAYTTDKAMGHPC  120

Query  804   AIHVKRIASDPEDQTGES-VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + V    +  E  +G++ +L  +    ++   +WG L++TII+G E   L  WD  TGK
Sbjct  121   EVFVIDTRTIDETVSGQAPILKWEITDSKVTSMIWGSLDETIITGHEAGDLIQWDLRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +    +   H   IT +  S DG+ F+T S D +AKL+D  +L LLK Y TERPVN+  
Sbjct  181   KIHSVKE---HTHQITDMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAA  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN+LAF+PD
Sbjct  238   LSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             GKS+ASGGEDGYVR+H+FD  YF
Sbjct  298   GKSYASGGEDGYVRVHNFDQSYF  320



>ref|XP_011314062.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fopius arisanus]
Length=326

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 223/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDL+FS +KD NP VW++ NGERLGT+ GHNG++WC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLIFSASKDKNPNVWWSLNGERLGTFNGHNGSIWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D+SR ++GS D T+++WD +TG ++     +S  R+ +F+     AV +TD  +G   
Sbjct  61    NWDTSRFMSGSGDNTLRIWDCQTGKEIGQLPTNSSVRTCNFSYSANTAVYSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +    + DP     +++  +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121   EMFIIDTRTVDPILSQEDAIRRIPINGPRISAILWGALDETIITGHEDGEINIWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
             +L  +    GH+  I  +  + DG+ F+T S D +AKL+D   L  LKTY TERPVN+ T
Sbjct  181   ILTSA---KGHRSQINDMQFNKDGTMFVTASKDHTAKLFDSEQLVHLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+A+F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDARFFHMVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             GKSF+SGGEDGYVR++ FD  YF
Sbjct  298   GKSFSSGGEDGYVRINTFDQSYF  320



>ref|XP_011685676.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Wasmannia auropunctata]
Length=326

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 224/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLVFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRACGFSYSADLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121   EMFIMDVRNVDSTMSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L        HK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   NLSSV---RSHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLVLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHMVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_005718524.1| Translation initiation factor eIF3, subunit I [Chondrus crispus]
 emb|CDF38619.1| Translation initiation factor eIF3, subunit I [Chondrus crispus]
Length=327

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 211/322 (66%), Gaps = 3/322 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP+L+KGHERPLT  K+NREGDLLF+ A D +P+VW + NGER+GTY+GHNGAV    +
Sbjct  1     MRPLLLKGHERPLTRAKFNREGDLLFTTAMDKSPSVWRSSNGERIGTYKGHNGAVRDISV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++R+ITGSAD +  LW+ +TG +L  ++F SP RSV F+ GD    + T   MG  S
Sbjct  61    TWDTTRVITGSADNSAILWNAETGEKLHQWHFKSPVRSVAFSPGDAYIAIATAKLMGQAS  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              + +        +QT E V  ++GH+G I R +W    + +++  ED  +R WD E G  
Sbjct  121   NVFIFAHNKSSNEQTEEPVKVLEGHEGTITRVLWHASAEILLTASEDKTIRKWDVEAG--  178

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
              +E    + HK  I     S D +  IT S D +AKLW     +LL+TY  + PVN+  +
Sbjct  179   -EEIQCVTAHKNDIKDCQFSADYAMVITASKDHTAKLWSFHDFSLLRTYTVDHPVNSAAV  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+  HI+LGGGQ+AS VTTT  R GKFE K +  + +EE+G VKGHFGPIN +AF+PDG
Sbjct  238   SPIFSHILLGGGQEASQVTTTGDRQGKFEGKIFHLVYEEELGRVKGHFGPINTVAFSPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYF  199
             K + SGGEDG+VRLH FD DYF
Sbjct  298   KQYVSGGEDGFVRLHDFDPDYF  319



>ref|XP_001989068.1| GH10244 [Drosophila grimshawi]
 sp|B4JB43.1|EIF3I_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
grimshawi]
 gb|EDW03935.1| GH10244 [Drosophila grimshawi]
Length=326

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 215/324 (66%), Gaps = 3/324 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               +S +LITG+ D T KLWDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWESRKLITGAGDMTTKLWDVEYGTVIASIATKSSVRTSNFSFSGNQAAYSTDKAMGQNC  120

Query  804   AIHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  +  +D      E  L +   + +I    WGPL++TII+G ++  + IWD   G+
Sbjct  121   ELFIIDVRNADSTLSEQEPTLRIPMVESKITSMQWGPLDETIITGHDNGNIAIWDVRKGQ  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
               K  D    H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  
Sbjct  181   --KVVDSGVDHAAGINDMQLSKDGTMFVTASKDNTAKLFDAESLMCLKTYKTERPVNSAA  238

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PD
Sbjct  239   ISPIFDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPD  298

Query  267   GKSFASGGEDGYVRLHHFDADYFH  196
             GKS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   GKSYASGGEDGFVRVQSFDSTYFE  322



>ref|XP_011861038.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vollenhovia emeryi]
Length=326

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 226/323 (70%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNTLRVWDCQTGREIGQLHTNSSVRTCGFSYSSNLAVFSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  + +     + E  +      G RI+  +WG L++TII+G ED  + +WD  TGK
Sbjct  121   EMFIMDVRNVDATLSQEDAIARISVNGPRISAILWGALDETIITGHEDGEINLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
               K+S  + GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   --KQSSVK-GHKSQINDMQFNKDGTMFVTASKDHTAKLFDSESLLLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIYDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYMRINNFDQSYF  320



>gb|EFZ22632.1| hypothetical protein SINV_00160, partial [Solenopsis invicta]
Length=326

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 224/322 (70%), Gaps = 4/322 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D++
Sbjct  2     KPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDVN  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    
Sbjct  62    WDTTRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQCE  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             + +  + +     + E  ++     G RI+  +WG L++TII+G ED  L++WD  TGK 
Sbjct  122   MFIMDVRNVDSTLSQEDAISRILVNGPRISAILWGALDETIITGHEDGELKLWDVRTGKK  181

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T+
Sbjct  182   LSSV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSESLVLLKTYKTERPVNSATI  238

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+G
Sbjct  239   SPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNG  298

Query  264   KSFASGGEDGYVRLHHFDADYF  199
             +S+++GGEDGY+R+++FD  YF
Sbjct  299   RSYSTGGEDGYMRINNFDQSYF  320



>ref|XP_001868509.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 ref|XP_001868761.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 sp|B0XFT7.1|EIF3I_CULQU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Culex quinquefasciatus]
 gb|EDS27016.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 gb|EDS27653.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
Length=328

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 222/326 (68%), Gaps = 7/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GHER +T +KYNREGDL+FS AKDH P+VWF+ NGERLGTY GH GAVWC D+
Sbjct  1     MKPLMLQGHERAITQIKYNREGDLIFSTAKDHKPSVWFSLNGERLGTYNGHQGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                ++RLITG+ D + KLWDV+TG+ L T   +S  R+ +F+     A  +TD  MG  S
Sbjct  61    DWTTTRLITGAGDMSTKLWDVETGSVLGTIPCNSAARTANFSFSGNQASYSTDKAMGHNS  120

Query  804   A---IHVKRIASDPEDQTGESVLTM-KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAE  637
                 I V+ + S    Q+    LTM +  Q +I   +WG L++T+I+G E+  +RIWD  
Sbjct  121   ELFIIDVRNVDSSISSQSPVLKLTMNQSIQTKITSMLWGALDETVITGHENGSIRIWDLR  180

Query  636   TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVN  457
             T K L   +  +G    I  +  S DG+  ++ S D +AKL+D  +L  LKTY TERPVN
Sbjct  181   TAKELNSVNDHTG---VINDMQLSADGTMLVSASKDTTAKLFDSESLMCLKTYKTERPVN  237

Query  456   AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  277
             +  +SP+ +H+VLGGGQ+A  VTTT  ++GKF+++ +  + +EE   VKGHFGPIN+LAF
Sbjct  238   SAAISPIHEHVVLGGGQEAMEVTTTSTKSGKFDSRLFHLVYEEEFARVKGHFGPINSLAF  297

Query  276   NPDGKSFASGGEDGYVRLHHFDADYF  199
             +PDGKS+A+GGEDG+VR+  FDA Y+
Sbjct  298   HPDGKSYATGGEDGFVRVQVFDASYY  323



>ref|NP_001279068.1| eukaryotic translation initiation factor 3, subunit I [Callorhinchus 
milii]
 gb|AFK11321.1| eukaryotic translation initiation factor 3 subunit I-like protein 
[Callorhinchus milii]
Length=325

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 218/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFSCAKD     W++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSCAKDTIVNGWYSLNGERLGTYNGHTGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+ ++++GSAD + +LWD +TG QL  F   S  R+  F     + + TTD  MG   
Sbjct  61    DWDTKQVLSGSADNSCRLWDCETGKQLALFETSSAVRTCGFDFSGNIVMFTTDKQMGYHC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I    I    +    E  + +   + +I  AVWGPL + +I+G E+  L  + A++G++
Sbjct  121   YISFFDIRDPAQISDNEPYMKVPCSESKITSAVWGPLGEYVIAGHENGELIQYSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L ++ +   H K I  +  S+D + FIT S D +AKL+D  TL  LK++ TERPVN+  +
Sbjct  181   LVKAKE---HTKQINDIQTSLDLTMFITASKDNTAKLFDSATLEHLKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+L+H+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPILEHVVLGGGQEAMDVTTTSTRIGKFEARFFHLSFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHNFDPPYFEFEF  323



>ref|XP_006806095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Neolamprologus brichardi]
Length=325

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 220/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNFFDLRDPQQIEDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK++ +   H K I  +  S+D + FI+ S D +AKL+D  +L  +KT+ TERPVN+  +
Sbjct  181   LKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDSTSLDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_003443814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oreochromis niloticus]
 ref|XP_004563737.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Maylandia zebra]
 ref|XP_005745286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pundamilia nyererei]
 ref|XP_005950654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Haplochromis burtoni]
Length=325

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 220/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVTNVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNFFDLRDPQQIEDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK++ +   H K I  +  S+D + FI+ S D +AKL+D  +L  +KT+ TERPVN+  +
Sbjct  181   LKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDSTSLDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_011445956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Crassostrea gigas]
Length=322

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 219/326 (67%), Gaps = 6/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL+ GHER +T +KYNREGDL+FSCAKD  P VW++ NGERLG++RGHNGAVW  D+
Sbjct  1     MKPILLHGHERSITQIKYNREGDLIFSCAKDSQPNVWYSLNGERLGSFRGHNGAVWNIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + +S++++T SAD T KLWD +TG  L + +  +  R+  F+   +  + TTD  MG P 
Sbjct  61    NWESTKVLTASADNTCKLWDCETGKTLASLDTATAVRTCGFSFSGRYIMYTTDKTMGRPC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              IH+  +    + + GE  + +     +I  AVWGP  + II+G E+  +  +D ++G  
Sbjct  121   EIHIFDLN---DIRNGEPTMVIPISSSKITSAVWGPYEEYIITGHENGEICHYDLKSGDK  177

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +    +   H K I  L  S D S  I+ S D +AKL++  TL  +KTY TERPVN+ ++
Sbjct  178   INSCKE---HSKQINDLQLSKDMSMLISASKDTTAKLFETATLGHMKTYKTERPVNSASL  234

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  + GKF+A+FY  + +EE G VKGHFGPIN+ AF+PDG
Sbjct  235   SPIYDHVVLGGGQEAMDVTTTSTKVGKFDARFYHLVFEEEFGRVKGHFGPINSTAFHPDG  294

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  295   KSYSSGGEDGYVRVHYFDPSYFDFRF  320



>ref|XP_011180318.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera cucurbitae]
Length=326

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 219/324 (68%), Gaps = 3/324 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +K+NREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKFNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWTTSKLISGAGDMTTKIWDVEHGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121   ELFIIDVRTADSSIAEQNPILRLPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
               +E +  + H  GI  +  + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ +
Sbjct  181   --REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSAS  238

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PD
Sbjct  239   ISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPD  298

Query  267   GKSFASGGEDGYVRLHHFDADYFH  196
             GKS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   GKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_011198986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera dorsalis]
Length=326

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 219/324 (68%), Gaps = 3/324 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +K+NREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKFNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWTTSKLISGAGDMTTKIWDVEHGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121   ELFIIDVRTADSSIAEQNPILRIPMLPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
               +E +  + H  GI  +  + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ +
Sbjct  181   --REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSAS  238

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PD
Sbjct  239   ISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPD  298

Query  267   GKSFASGGEDGYVRLHHFDADYFH  196
             GKS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   GKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_005181692.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Musca domestica]
Length=324

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 219/323 (68%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +KYNREGDLLFSC+KD  P VW+++NGERLGTY GH GA+WC D+
Sbjct  1     MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSNNGERLGTYDGHQGAIWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +S+LITGS D T K+WDV+ G  + +    S  R+ +F+     A  TTD  MG  S
Sbjct  61    DWTTSKLITGSGDMTTKIWDVEHGLVIASIPAKSSVRTCNFSYSGNQAAYTTDKAMGQNS  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  +  +D        +L +   Q +I   +WG L++TII+G ++  + IWD   G+
Sbjct  121   ELFIIDVRTADSSLAEQNPILRIPMLQSKITSMLWGSLDETIITGHDNGQISIWDIRKGR  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
                E +  + H   I  +    DG+ F+T S D +AKL+D  +L  LKTY TERPVN+ +
Sbjct  181   ---EVNSVNDHTGSINDMQMYKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAS  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PD
Sbjct  238   ISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+ASGGEDG+VR++ FD+ Y+
Sbjct  298   GRSYASGGEDGFVRVNTFDSTYY  320



>ref|XP_002051937.1| GJ17275 [Drosophila virilis]
 gb|EDW64092.1| GJ17275, partial [Drosophila virilis]
Length=325

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 217/323 (67%), Gaps = 3/323 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             RP++++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+ 
Sbjct  1     RPLMLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVD  60

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    
Sbjct  61    WESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNCE  120

Query  801   IHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             + +  +  +D      E  L +   + +I   +WGPL++TII+G ++  + IWD   G+ 
Sbjct  121   LFIIDVRNADSSLSEQEPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ-  179

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
              K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +
Sbjct  180   -KVVDSGTDHTAGINDMQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAI  238

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDG
Sbjct  239   SPILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDG  298

Query  264   KSFASGGEDGYVRLHHFDADYFH  196
             KS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   KSYASGGEDGFVRVQSFDSTYFE  321



>ref|XP_005102454.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Aplysia californica]
Length=327

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 218/324 (67%), Gaps = 5/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PI++ GHER +T +KYNREGDL+FS AKD  P VW++ NGERLG++ GHNGAVWC D 
Sbjct  1     MKPIMLHGHERSITQIKYNREGDLIFSSAKDPQPNVWYSLNGERLGSFVGHNGAVWCIDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + DS++++TG+AD T K+WD +TG+QL +    +  R+  F+    L + +TD  MG P 
Sbjct  61    TWDSTKVLTGAADNTCKIWDCETGSQLNSLETRTAVRTNGFSYSGNLVMYSTDKTMGFPC  120

Query  804   AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              IH+  I    + ++G   LT+       +I  A+WGP    I++G E+  +  +D +TG
Sbjct  121   EIHMFDIRDGSQIESGNPYLTIPIDTSMSKITSAIWGPGEDFILTGHENGEINQFDIKTG  180

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
               +K       H K I  +    D S FIT S D +A+L+D+ TL  LK Y TERP+N+ 
Sbjct  181   TRIKGCKD---HTKQINDIQPYKDNSMFITASKDNTARLFDMETLEPLKMYKTERPINSA  237

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SPL DH+V+GGGQ+A  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN++AF+P
Sbjct  238   AISPLHDHVVMGGGQEAMQVTTTSTRVGKFDARFFHLVFEEEFGRVKGHFGPINSVAFHP  297

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS++SGGEDGYVR+H+FD +Y 
Sbjct  298   DGKSYSSGGEDGYVRVHYFDPNYL  321



>ref|XP_002167671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Hydra vulgaris]
Length=325

 Score =   323 bits (828),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 214/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+L+ GHER +T +KYNREGDLLFS AKD  PTVWF+ NGERLGTY GH GAV+C D 
Sbjct  1     MKPLLLHGHERSITQIKYNREGDLLFSSAKDKRPTVWFSINGERLGTYDGHGGAVYCLDP  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S DS  LITGS D + ++WD++TG +L  ++  S  R+  F+   K    +TD  MG   
Sbjct  61    SWDSKYLITGSGDNSARIWDIETGKELVIYDTGSAVRACGFSYSGKKVFYSTDKTMGQTC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I +  +       T    L +     ++  AVWGPL++ II+G E+  +  W A+TG L
Sbjct  121   EIKLYDVRDSISQGTPTPYLVIPVPDSKVTSAVWGPLDEFIITGHENGTVSKWCAQTGDL  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K       H   ++ L KS +   FIT S D ++KL+D  T+ LLKTY T+RPVN+  +
Sbjct  181   IKSM---RAHIDKVSDLQKSSNEMMFITASKDNTSKLFDTETMQLLKTYKTDRPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ D +VLGGGQ+A  VTTT  R GKF+A+F+  I +EEIG VKGHFGPIN+LAF+P+G
Sbjct  238   SPIRDQVVLGGGQEAMEVTTTSTRIGKFDARFFHMIFEEEIGRVKGHFGPINSLAFHPNG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR H FD  Y+  + 
Sbjct  298   KSYSSGGEDGYVRSHVFDKSYYEFEF  323



>ref|XP_011568982.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Plutella xylostella]
Length=329

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 215/323 (67%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GHER +T +KYNREGDLLFS AKD  P VW++ NGERLGT+ GH G VWC D+
Sbjct  1     MKPLMLQGHERAITQIKYNREGDLLFSVAKDSKPNVWWSLNGERLGTFNGHGGVVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +  LITG  D + +LWD++TG  + T   +S  R+V+F+     A  TTD  MG P 
Sbjct  61    DWQTINLITGGGDSSCRLWDLETGKNIATIKSNSSVRTVNFSFSAYQAAYTTDKAMGHPC  120

Query  804   AIHVKRIASDPEDQTGES-VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +    +  E  +G++ +L  +    ++   VWG L++TII+G E   +  WD  TGK
Sbjct  121   EVFIVDTRTVDESISGQAPILKWEITDSKVTSMVWGNLDETIITGHEAGDIIQWDLRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +    +   H   I  +  S DG+ FIT S D++AKL+D  +L LLK Y TERPVN+  
Sbjct  181   KIHSIKE---HTHQINDMQLSRDGTMFITASKDQTAKLFDTSSLELLKEYKTERPVNSAA  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN+LAF+PD
Sbjct  238   LSPILDHVVLGGGQDAMDVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             GKS+ASGGEDGYVR+  FD  YF
Sbjct  298   GKSYASGGEDGYVRVQSFDQSYF  320



>gb|EPY53170.1| translation initiation factor eIF3i [Schizosaccharomyces cryophilus 
OY26]
Length=328

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 218/326 (67%), Gaps = 2/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W CDI
Sbjct  1     MRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S++S+ +++G+AD T++LWDVKTG QLF + F +  + V+F   D   +  T+  MG   
Sbjct  61    SKNSALMVSGAADNTMRLWDVKTGKQLFKWEFPTAVKRVEFNEDDSRILAVTEQRMGFSG  120

Query  804   AIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + V R+ S   D   E+ L  +   + +   A W  L+K +I+G +D  +  +DA+TG 
Sbjct  121   TVTVVRVPSFENDVAAETPLYVITTRESKATVAGWSYLSKYLITGHDDGSVSRYDAKTGD  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L ES Q       IT L  S+D ++F+T   D +AK  D+ +  ++KTY+T+ P+N  +
Sbjct  181   YL-ESKQVHNPGASITDLQFSVDRTYFVTACKDTTAKAIDVESFEVIKTYLTDTPLNTSS  239

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             ++P+ D +V+GGGQ+A  VTTT  R GKFE +FY  IL+EE+G VKGHFGPIN +A +P 
Sbjct  240   ITPVQDFVVVGGGQEARDVTTTASRQGKFETRFYHAILEEELGRVKGHFGPINTIAVHPK  299

Query  267   GKSFASGGEDGYVRLHHFDADYFHIK  190
             G  +ASGGEDGYVR+H FD +YF  K
Sbjct  300   GTGYASGGEDGYVRVHAFDKNYFDFK  325



>sp|B3MVL6.2|EIF3I_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
ananassae]
Length=322

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 216/322 (67%), Gaps = 7/322 (2%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1     MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA---  802
              +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG       
Sbjct  61    RKLITGAGDMTTKIWDVEYGTIIASIPSKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFI  120

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             I V+   S   +QT    L +   + +I   +WGPL++TII+G ++  + IWD   G+  
Sbjct  121   IDVRNADSSLAEQT--PTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--  176

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
             K  D  S H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +S
Sbjct  177   KVVDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAIS  236

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGK
Sbjct  237   PILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGK  296

Query  261   SFASGGEDGYVRLHHFDADYFH  196
             S+ASGGEDG+VR+  FD+ YF 
Sbjct  297   SYASGGEDGFVRVQTFDSTYFE  318



>gb|ACQ58286.1| Eukaryotic translation initiation factor 3 subunit I [Anoplopoma 
fimbria]
Length=325

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 218/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MRPILLQGHERSITQIKYNREGDLLFSVAKDTVTNVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL  F  +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCQTGKQLALFETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  L++     +I  AVWGPL + +I+G E+     + A++G++
Sbjct  121   FLNFFDLRDPQQIEDNQPYLSIPCADHKITSAVWGPLGEFVIAGHENGEFNQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K++ +   H K I  +  S+D + FI+ S D +AKL+D  T+  +KT+ TERPVN+  +
Sbjct  181   IKKAKE---HTKQINDIQTSVDLTMFISASKDNTAKLFDSATMDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGY R+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYTRIHYFDPQYFDFEL  323



>ref|XP_010902262.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Esox lucius]
Length=325

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 217/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   YLNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H K I  +  S+D +  IT S D S+KL+D  TL  +KT+ TERPVN+  +
Sbjct  181   LKKVKE---HSKQINDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGY R+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYTRIHYFDPQYFDFEL  323



>gb|EKC38588.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Crassostrea gigas]
Length=322

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 218/325 (67%), Gaps = 6/325 (2%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL+ GHER +T +KYNREGDL+FSCAKD  P VW++ NGERLG++RGHNGAVW  D++
Sbjct  2     KPILLHGHERSITQIKYNREGDLIFSCAKDSQPNVWYSLNGERLGSFRGHNGAVWNIDVN  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              +S++++T SAD T KLWD +TG  L + +  +  R+  F+   +  + TTD  MG P  
Sbjct  62    WESTKVLTASADNTCKLWDCETGKTLASLDTATAVRTCGFSFSGRYIMYTTDKTMGRPCE  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             IH+  +    + + GE  + +     +I  AVWGP  + II+G E+  +  +D ++G  +
Sbjct  122   IHIFDLN---DIRNGEPTMVIPISSSKITSAVWGPYEEYIITGHENGEICHYDLKSGDKI  178

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  L  S D S  I+ S D +AKL++  TL  +KTY TERPVN+ ++S
Sbjct  179   NSCKE---HSKQINDLQLSKDMSMLISASKDTTAKLFETATLGHMKTYKTERPVNSASLS  235

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  + GKF+A+FY  + +EE G VKGHFGPIN+ AF+PDGK
Sbjct  236   PIYDHVVLGGGQEAMDVTTTSTKVGKFDARFYHLVFEEEFGRVKGHFGPINSTAFHPDGK  295

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  296   SYSSGGEDGYVRVHYFDPSYFDFRF  320



>ref|XP_008553489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 217/323 (67%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP +++GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG++WC DI
Sbjct  1     MRPNMLQGHERAITAVKYNREGDLIFSASKDKKPNVWWSANGERLGTFNGHNGSIWCIDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +   ++GS D T+++WD +TG ++     +S  R+  F     +AV +TD  +G   
Sbjct  61    DWRTQFFMSGSGDNTLRIWDCQTGKEISQIQTNSSVRTCAFGFSGNMAVYSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +    + D     G +++ +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121   EMFIIDTRNVDSMSSEGSAIIRIPINGPRISSILWGALDETIITGHEDGEINIWDVSTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L   + + GHK  I  +  S DG+ FIT S D +AKL+D  +L  LKTY TERPVN+ T
Sbjct  181   KL---NSQKGHKSLINDMQPSKDGTMFITASKDHTAKLFDSESLMHLKTYQTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH++LGGGQDA  VTTT  R GKF+A+FY  + +EE   +KGHFGPIN+LAF+PD
Sbjct  238   ISPIFDHVILGGGQDAMDVTTTSARQGKFDARFYHLVFEEEFARLKGHFGPINSLAFHPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+SF SGGEDG++R++ FD  YF
Sbjct  298   GRSFCSGGEDGFIRINPFDKSYF  320



>gb|ETN60290.1| eukaryotic translation initiation factor 3 subunit [Anopheles 
darlingi]
Length=327

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 218/329 (66%), Gaps = 6/329 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GH R +T +KYNREGDL+FS AKD +P+VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPLMLQGHSRAITQIKYNREGDLIFSSAKDSSPSVWYSLNGERLGTYNGHIGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                ++RLITG+ D    LWDV+TG  L T    SP R+ +F+     A  +TD  M   S
Sbjct  61    DWTTTRLITGAGDMKTFLWDVETGKSLGTIPCVSPVRTCNFSYSGNQASYSTDRSMQQQS  120

Query  804   A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
                 I V+ I S          LTM   Q +I   +WG L++T+I+G E+  +RIWD   
Sbjct  121   ELFIIDVRNIDSSIGSADPVLKLTMGEQQSKITSMLWGALDETVITGHENGSIRIWDL--  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
              + +KE +  + H   IT +  S DG+ FI+ S D +AKL+D  +L  LKTY TERPVN+
Sbjct  179   -RAVKELNSVNDHTANITDMQMSHDGTMFISSSKDTTAKLFDSESLVCLKTYKTERPVNS  237

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SPL +H+ LGGGQDA  VTTT  +AGKF+++F+  + +EE   VKGHFGPIN+LAF+
Sbjct  238   AAISPLYEHVALGGGQDAMEVTTTSTQAGKFDSRFFHLVYEEEFARVKGHFGPINSLAFH  297

Query  273   PDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             PDGKSF +GGEDG+VR+  FD+ YF  ++
Sbjct  298   PDGKSFTTGGEDGFVRVQVFDSSYFEFQL  326



>ref|XP_002115720.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV21572.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=325

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 219/324 (68%), Gaps = 7/324 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL+ GHER +T ++YNREGDLLFS  KDH+P+VW++DNGERLGTY GH+G VWC  I
Sbjct  1     MRPILLHGHERAITQIRYNREGDLLFSAGKDHSPSVWYSDNGERLGTYDGHSGVVWC--I  58

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             +RDS++++TGS D +  +WD +TG QL   +  +  RS  F+   +  ++TTD   G  S
Sbjct  59    NRDSTKVVTGSGDNSYIIWDCETGKQLHRIDTRAAVRSCGFSYSGRALLITTDQQRGYES  118

Query  804   AIHVKRIASDPEDQTGESVLTM--KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
              I +  +    +   GE  L +       +I  AVWG L++ +I G E+  +  +DA TG
Sbjct  119   EILLFGLDDPTQINDGEPYLRIPISKDNAKITTAVWGKLDRYLIVGHENGEVSQFDATTG  178

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             + L    +   H+K I+ +    D S F+T S D +AKL+D   LTLLKTY TERPVN+ 
Sbjct  179   EKLHSVTE---HRKAISDINMYKDQSMFVTASKDSTAKLFDADDLTLLKTYKTERPVNSA  235

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +S L DH+VLGGGQ+A  VTTT  +AGKF+A+FY  + +EEIG VKGHFGPIN++ F+P
Sbjct  236   ALSSLKDHVVLGGGQEAIDVTTTAAQAGKFDARFYHVVFEEEIGRVKGHFGPINSVRFHP  295

Query  270   DGKSFASGGEDGYVRLHHFDADYF  199
             DGKS++SGGEDGYVR+H FD  YF
Sbjct  296   DGKSYSSGGEDGYVRVHQFDQSYF  319



>ref|NP_001133273.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI32945.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68205.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68969.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI70142.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16123.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16168.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
Length=325

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 217/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDL+FS AKD    VW++ NGERLGTY GH GA+WC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLIFSVAKDTVANVWYSVNGERLGTYNGHTGALWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H K I  +  S+D +  IT S D S+KL+D  TL  +K++ TERPVN+  +
Sbjct  181   LKKVKE---HNKQINDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGY R+HHFD  YF  ++
Sbjct  298   KSYSSGGEDGYTRIHHFDPQYFDFEL  323



>ref|XP_392780.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Apis mellifera]
 ref|XP_003693606.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Apis florea]
 ref|XP_006570172.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Apis mellifera]
 ref|XP_006612554.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Apis dorsata]
 ref|XP_006612555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Apis dorsata]
Length=326

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 222/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLG++ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++R ++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRFLSGSGDNTLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  T K
Sbjct  121   EMFIMDIKNVDAVLSQADAISRIAVNGPRISAILWGALDETIITGHEDGEITLWDVRTRK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLTSV---KGHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+SF++GGEDGYVR++ FD  YF
Sbjct  298   GRSFSTGGEDGYVRINTFDQSYF  320



>ref|XP_004531427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Ceratitis capitata]
Length=326

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 218/324 (67%), Gaps = 3/324 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP++++GHER +T +K+NREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPLMLQGHERSITQIKFNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61    DWTTSKLISGAGDMTTKIWDVEQGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121   ELFIIDVRTADSSIAEQNPILRIPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
               +E +  + H  GI  +  + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ +
Sbjct  181   --REINSVNDHTAGINDMQMNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSAS  238

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP++DH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PD
Sbjct  239   ISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPD  298

Query  267   GKSFASGGEDGYVRLHHFDADYFH  196
             GKS+ASGGEDG+VR+  FD+ YF 
Sbjct  299   GKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_003228758.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anolis carolinensis]
Length=325

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 216/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             ++    +    + +  E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121   SVSFYDLRDSSQIEDNEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQYSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L  + +   H K I  +  S D + FIT S D +A+L+D   L  LKT+ TERPVN+  +
Sbjct  181   LMNAKE---HTKQINDIQTSRDMTMFITASKDNTARLFDSTNLDHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_003707661.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Megachile rotundata]
Length=326

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 222/323 (69%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLG++ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++R ++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRFLSGSGDNSLRVWDCETGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I +   + + E  ++     G RI+  +WG L++TII+G ED  + +WD  T K
Sbjct  121   EMFIIDIKNVDAELSQEDAISRIAVSGPRISAILWGALDETIITGHEDGEITLWDVRTRK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KLSSV---KGHKSQINDMQFNKDGTMFVTASKDNTAKLFDSDSLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+SF++GGEDGYVR++ FD  YF
Sbjct  298   GRSFSTGGEDGYVRINTFDQSYF  320



>ref|XP_316636.4| AGAP006607-PA [Anopheles gambiae str. PEST]
 sp|Q7PP77.4|EIF3I_ANOGA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Anopheles gambiae]
 gb|EAA10908.5| AGAP006607-PA [Anopheles gambiae str. PEST]
Length=327

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 220/325 (68%), Gaps = 6/325 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GH+R +T +KYNREGDL+FS AKD  P+VW++ NGERLGT+ GH GAVWC D+
Sbjct  1     MKPLMLQGHQRAITQIKYNREGDLIFSSAKDSKPSVWYSLNGERLGTFNGHIGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                ++RLITG+ D    LWDV+TGT L     +S  R+ +F+     A  +TD  M  P 
Sbjct  61    DWTTTRLITGAGDMNTFLWDVETGTALGKIPCNSSVRTCNFSFSGNQASYSTDRAMNHPC  120

Query  804   AIHVKRIAS-DPEDQTGESVL--TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  634
              + V  + + D    + + VL  TM   Q +I   +WG L++T+I+G E+  LRIWD   
Sbjct  121   ELFVIDVRNIDASISSADPVLKLTMNEQQSKITSMLWGALDETVITGHENGSLRIWDL--  178

Query  633   GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNA  454
              + +KE +  + H   IT +  S DG+ F++ S D SAKL+D  +L  LKT+ TERPVN+
Sbjct  179   -RAVKELNSVNDHTASITDMQMSSDGTMFVSSSKDCSAKLFDSDSLMCLKTFKTERPVNS  237

Query  453   VTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFN  274
               +SPL +H+ LGGGQDA  VTTT  +AGKF+++F+  + +EE   VKGHFGPIN++AF+
Sbjct  238   ACISPLFEHVALGGGQDAMEVTTTSTQAGKFDSRFFHLVYEEEFARVKGHFGPINSMAFH  297

Query  273   PDGKSFASGGEDGYVRLHHFDADYF  199
             PDGKSFA+GGEDG+VRL  FD+ Y+
Sbjct  298   PDGKSFATGGEDGFVRLQVFDSSYY  322



>ref|XP_005102453.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Aplysia californica]
Length=334

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 217/323 (67%), Gaps = 5/323 (2%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PI++ GHER +T +KYNREGDL+FS AKD  P VW++ NGERLG++ GHNGAVWC D +
Sbjct  9     KPIMLHGHERSITQIKYNREGDLIFSSAKDPQPNVWYSLNGERLGSFVGHNGAVWCIDCT  68

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              DS++++TG+AD T K+WD +TG+QL +    +  R+  F+    L + +TD  MG P  
Sbjct  69    WDSTKVLTGAADNTCKIWDCETGSQLNSLETRTAVRTNGFSYSGNLVMYSTDKTMGFPCE  128

Query  801   IHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
             IH+  I    + ++G   LT+       +I  A+WGP    I++G E+  +  +D +TG 
Sbjct  129   IHMFDIRDGSQIESGNPYLTIPIDTSMSKITSAIWGPGEDFILTGHENGEINQFDIKTGT  188

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +K       H K I  +    D S FIT S D +A+L+D+ TL  LK Y TERP+N+  
Sbjct  189   RIKGCKD---HTKQINDIQPYKDNSMFITASKDNTARLFDMETLEPLKMYKTERPINSAA  245

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SPL DH+V+GGGQ+A  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN++AF+PD
Sbjct  246   ISPLHDHVVMGGGQEAMQVTTTSTRVGKFDARFFHLVFEEEFGRVKGHFGPINSVAFHPD  305

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             GKS++SGGEDGYVR+H+FD +Y 
Sbjct  306   GKSYSSGGEDGYVRVHYFDPNYL  328



>sp|B4NW98.2|EIF3I_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
yakuba]
Length=322

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 216/322 (67%), Gaps = 7/322 (2%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1     MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA---  802
              +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG       
Sbjct  61    RKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFL  120

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  
Sbjct  121   IDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--  176

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
             K  D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LK+Y TERPVN+  +S
Sbjct  177   KVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKSYKTERPVNSAAIS  236

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGK
Sbjct  237   PILDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGK  296

Query  261   SFASGGEDGYVRLHHFDADYFH  196
             S+ASGGEDG+VR+  FD+ YF 
Sbjct  297   SYASGGEDGFVRVQTFDSTYFE  318



>ref|XP_012062135.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Atta cephalotes]
Length=322

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 220/319 (69%), Gaps = 4/319 (1%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             ++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D++ D+
Sbjct  1     MLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDVNWDT  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  793
             +RL++GS D T+++WD +TG ++     +S  R+  F+    LAV +TD  +G    + +
Sbjct  61    TRLLSGSGDNTLRVWDCETGKEIGQLTTNSSVRTCGFSYSANLAVFSTDKALGHQCEMFI  120

Query  792   KRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  616
               + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK L  
Sbjct  121   MDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGKKLSS  180

Query  615   SDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPL  436
                  GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T+SP+
Sbjct  181   V---KGHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSATISPI  237

Query  435   LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  256
              DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+
Sbjct  238   FDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSY  297

Query  255   ASGGEDGYVRLHHFDADYF  199
             ++GGEDGY+R+++FD  YF
Sbjct  298   STGGEDGYMRINNFDQSYF  316



>ref|XP_011145247.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
 ref|XP_011145248.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
Length=326

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 225/323 (70%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLVFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNSLRVWDCQTGKEIGQLDTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  TGK
Sbjct  121   EMFIMDIRNVDSTLSQDDAISRISVNGPRISAILWGALDETIITGHEDGDITLWDVRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKT+ TERPVN+ T
Sbjct  181   KLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSDSLMLLKTFKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  298   GRSYSTGGEDGYIRINNFDQSYF  320



>gb|EGI64611.1| Eukaryotic translation initiation factor 3 subunit I [Acromyrmex 
echinatior]
Length=322

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 221/319 (69%), Gaps = 4/319 (1%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             ++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D++ D+
Sbjct  1     MLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDVNWDT  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  793
             +RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    + +
Sbjct  61    TRLLSGSGDNTLRVWDCETGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQCEMFI  120

Query  792   KRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  616
               + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK L  
Sbjct  121   MDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGKKLSS  180

Query  615   SDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPL  436
                  GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T+SP+
Sbjct  181   V---KGHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSATISPI  237

Query  435   LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  256
              DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+
Sbjct  238   FDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSY  297

Query  255   ASGGEDGYVRLHHFDADYF  199
             ++GGEDGY+R+++FD  YF
Sbjct  298   STGGEDGYMRINNFDQSYF  316



>ref|XP_008294825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Stegastes partitus]
Length=325

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 217/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    +    +  L++     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   YLNFFDLRDPQQIDDNQPYLSVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H K I  +  S+D + FIT S D SAKL+D  +L  +KT+ TERPVN+  +
Sbjct  181   LKKIKE---HTKQINDIQPSVDLTIFITASKDNSAKLFDSTSLDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGY R+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYTRIHYFDPQYFDFEL  323



>ref|XP_002001737.1| GI15375 [Drosophila mojavensis]
 sp|B4KGX9.1|EIF3I_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
mojavensis]
 gb|EDW11179.1| GI15375 [Drosophila mojavensis]
Length=322

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 214/320 (67%), Gaps = 3/320 (1%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  ++
Sbjct  1     MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWET  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  793
              +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    + +
Sbjct  61    RKLITGAGDMTTKIWDVEYGTVIASIAAKSSVRTCNFSFSGNQAAYSTDKAMGQNCELFI  120

Query  792   KRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  616
               +  +D         L +   + +I   +WGPL++TII+G ++  + IWD   G+  K 
Sbjct  121   IDVRNADSSLSEQAPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KV  178

Query  615   SDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPL  436
              D  S H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+
Sbjct  179   VDSGSDHTAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPI  238

Query  435   LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  256
             LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+
Sbjct  239   LDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSY  298

Query  255   ASGGEDGYVRLHHFDADYFH  196
             ASGGEDG+VR+  FD+ YF 
Sbjct  299   ASGGEDGFVRVQTFDSTYFE  318



>ref|NP_001187527.1| eukaryotic translation initiation factor 3 subunit I [Ictalurus 
punctatus]
 gb|ADO28765.1| eukaryotic translation initiation factor 3 subunit i [Ictalurus 
punctatus]
Length=325

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 218/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDQFVNVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   + +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKHVLTGSADNSCRLWDCETGKQLAVLDTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +S L++   + +I  AVWGPL + +I+G E+  +  + A++G +
Sbjct  121   YLNFFDLRDPQQIEDNQSYLSVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGDI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S+D +  IT S D +AKL+D  +L  +K++ TERPVN+  +
Sbjct  181   LTTVKE---HTKQINDIQSSVDLTMVITASKDCAAKLFDSSSLEHIKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPHYFDFEL  323



>ref|XP_007249463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Astyanax mexicanus]
Length=325

 Score =   320 bits (821),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 220/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER LT +KYNREGDLLFS AKD    VW++ NGERLGTY GH+GAVWC D+
Sbjct  1     MKPILLQGHERSLTQIKYNREGDLLFSVAKDQFANVWYSVNGERLGTYNGHSGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLAMLETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  L++   + +I  AVWGPL + +++G E+  +  + A++G++
Sbjct  121   YLNYFDLRDPQQIEDNQPYLSIPCSESKITSAVWGPLGEFVVAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K+  +   H K I  +  S+D + FIT S D +AK++D  +L  +K++ TERPVN+  +
Sbjct  181   VKKIKE---HTKQINDIQTSVDLTMFITASKDCAAKMFDTTSLDHIKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP ++H+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPNMEHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>dbj|BAM18089.1| eukaryotic translation initiation factor 3 subunit I [Papilio 
xuthus]
Length=329

 Score =   320 bits (821),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 216/323 (67%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GHER +T +KYNREGDLLFS AKD  P VW++ NGERLGT+ GH G VWC D+
Sbjct  1     MKPLMLQGHERAITQIKYNREGDLLFSAAKDAKPNVWWSLNGERLGTFNGHGGVVWCLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +  LITG  D + +LWD++TG  + T   +S  R+ +F+     A  TTD  MG P 
Sbjct  61    DWQTINLITGGGDSSCRLWDLETGKNIATIKTNSSVRTCNFSYSAYQAAYTTDKAMGHPC  120

Query  804   AIHVKRIASDPEDQTGES-VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +    +  +  + +S +L  +    ++   VWG L++TII+G E   L  WD  TGK
Sbjct  121   EVFIIDTRTVDDSISSQSPILKWEITDSKVTSMVWGTLDETIITGHEAGDLIQWDLRTGK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +  S +E  H+  I  +  S DG+ FIT S D++AKL+D  +L LLK Y TERPVN+  
Sbjct  181   KV-HSIKEHNHQ--INDMQLSRDGTMFITASKDQTAKLFDTSSLELLKEYKTERPVNSAA  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+LDH+VLGGGQDA  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN+LAF+PD
Sbjct  238   LSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPD  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             GKS+ASGGEDGYVR+  FD  YF
Sbjct  298   GKSYASGGEDGYVRVQSFDQSYF  320



>ref|NP_998155.1| eukaryotic translation initiation factor 3 subunit I [Danio rerio]
 sp|Q7ZV55.1|EIF3I_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Danio rerio]
 gb|AAH45995.1| Eukaryotic translation initiation factor 3, subunit 2 beta [Danio 
rerio]
 gb|AAH65874.1| Eif3s2 protein [Danio rerio]
Length=325

 Score =   320 bits (820),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 219/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDPIANVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLETSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  +++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNYYDLRDPQQIEDNQPYISVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK++ +   H K I  +  S+D +  I+ S D +AK++D  TL  +KT+ TERPVN+  +
Sbjct  181   LKKAKE---HTKQINDIQSSVDLTMIISASKDCTAKMFDSSTLEHVKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPHYFDFEL  323



>gb|EPX75306.1| translation initiation factor eIF3i [Schizosaccharomyces octosporus 
yFS286]
Length=328

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 216/326 (66%), Gaps = 2/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W CDI
Sbjct  1     MRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTCDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             S++SS + +G+AD T++LWDVK+G +LF + F +  + V+F   D      T+  MG   
Sbjct  61    SKNSSLMASGAADNTMRLWDVKSGKELFKWEFPTAVKRVEFNEDDSRIFAVTEQRMGFSG  120

Query  804   AIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + V R+ S   D   E+ L  +   + +   A W  L+K +I+G +D  +  +DA TG+
Sbjct  121   TVTVFRVPSSANDVAAETPLYVITTRESKATVAGWSYLSKYLITGHDDGSVSRYDANTGE  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L ES Q       IT L  S D ++F+T   D +AKL D+ +  ++KTY+T+ P+N  +
Sbjct  181   FL-ESKQIHNVGASITDLQFSPDRTYFVTACKDTTAKLTDVDSFDVIKTYLTDTPLNTSS  239

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             ++P+ D IVLGGGQ+A  VTTT  R GKFE +FY  IL+EE+G VKGHFGPIN +A +P 
Sbjct  240   ITPVQDFIVLGGGQEARDVTTTATRQGKFETRFYHAILEEELGRVKGHFGPINTIAVHPK  299

Query  267   GKSFASGGEDGYVRLHHFDADYFHIK  190
             G  +ASGGEDGYVR+H FD +YF  K
Sbjct  300   GTGYASGGEDGYVRVHAFDKNYFDFK  325



>gb|KDR14214.1| hypothetical protein L798_11754 [Zootermopsis nevadensis]
Length=338

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/335 (46%), Positives = 220/335 (66%), Gaps = 15/335 (4%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +P+++ GHERP+T +KYNREGDLLFS AKD NP VW++ NGERLGT+ GH GAVW  D++
Sbjct  6     KPLMLHGHERPITQIKYNREGDLLFSSAKDLNPNVWYSLNGERLGTFDGHQGAVWAIDVN  65

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D++R ++G+ADQ +++WD  TG+Q+      S  RS +F+    +A  +TD  + L   
Sbjct  66    WDTTRFMSGAADQCLRIWDCATGSQIGKIENSSSVRSCNFSYSANMAAYSTDAHLAL--L  123

Query  801   IHVKRIASDPEDQTGESVLTMKGHQ----------GRINRAVWGPLNKTIISGGEDSVLR  652
             I + +I S  E     +  + K H            ++   +WGPL+K++I+G E+  L 
Sbjct  124   ICIIQILSQRETNNMTTSYSGKAHPILRIPIPNTGPKVTSMLWGPLDKSVITGHENGELT  183

Query  651   IWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVT  472
              WD   GK +  ++  SG    I  +  S  G  FIT S D +A+L+D  TL+ LKTY T
Sbjct  184   QWDLRMGKTMNSTNDHSG---SINDMQMSKHGIMFITASKDYTARLFDTDTLSCLKTYKT  240

Query  471   ERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPI  292
             ERPVN+  +SP+ DH+V+GGGQDA  VTTT  R GKF+++F+  + +EE G VKGHFGPI
Sbjct  241   ERPVNSAAISPIYDHVVVGGGQDAMDVTTTSTRIGKFDSRFFHLVFEEEFGRVKGHFGPI  300

Query  291   NALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             N++AF+PDGKS++SGGEDGY+R+H+FD+ YF    
Sbjct  301   NSVAFHPDGKSYSSGGEDGYIRIHNFDSAYFEFNF  335



>ref|XP_004074467.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Oryzias latipes]
Length=325

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 215/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD     W++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANAWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +     L++  ++ +I  AVWGPL + +I+G E+  +  + A++G+ 
Sbjct  121   YLNFFDLRDPQQIEDNNPYLSVPCNESKITSAVWGPLGEFVIAGHENGEISQFSAKSGEA  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H K I  +  S+D +  IT S D SAKL+D  +L  +KT+ TERPVN+  +
Sbjct  181   LKKVKE---HTKQINDIQSSVDLTMVITASKDNSAKLFDSTSLENIKTFRTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIKDHVVMGGGQEAMDVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_007563815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Poecilia formosa]
Length=325

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 219/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +     L++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNFFDLRDPQQMEDNNPYLSVPCSECKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK++ +   H + I  +  S+D +  IT S D ++KL+D  +L  +KT+ T+RPVN+  +
Sbjct  181   LKKAKE---HTRQINDIQSSVDLTMVITASKDNTSKLFDSNSLDHIKTFRTDRPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMDVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>ref|XP_001603140.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
 ref|XP_008210952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
 ref|XP_008210953.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
Length=326

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 217/327 (66%), Gaps = 12/327 (4%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GH+R +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GH+G+VWC D+
Sbjct  1     MKPLMLHGHDRAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHSGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RLI+GS D T++LWDV+TG QL      SP R   F+    LAV  TD  MG   
Sbjct  61    NWDTTRLISGSGDNTLRLWDVETGKQLSFLEKKSPVRCCSFSFSGNLAVFATDKSMGQNC  120

Query  804   AIHVKRIAS-----DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
              + V  + S      PED    +VL       RI+  +WG L++T+I+G E+  L IWD+
Sbjct  121   EMFVMDVRSPEPVFSPEDNVCRNVL----EGSRISSLLWGALDETLITGHENGELNIWDS  176

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
              TGK   +S    GH+  I  +  + DG+ F+T S D SAKL+D  TL  +KTY TERP+
Sbjct  177   RTGK---KSYDAQGHQGQINDMQFNKDGTMFVTASKDYSAKLFDSETLVSIKTYRTERPI  233

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
             N+ T+SP  DH+ +GGGQ A  VTTT  + GKF+  F+  + +EE   +KGHFGPIN+LA
Sbjct  234   NSATISPNFDHVAVGGGQPAMDVTTTSTKQGKFDTCFFHLVFEEEFARLKGHFGPINSLA  293

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYF  199
             F+P+G+S ++GGEDGY+R++ FD  YF
Sbjct  294   FHPNGRSLSTGGEDGYIRINTFDQSYF  320



>ref|XP_006676014.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83190.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
Length=337

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 219/332 (66%), Gaps = 9/332 (3%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL++GH R LT +KYN +GDLLF+ +KD    VW++ NGERLG++ GH+G++W  D+
Sbjct  1     MRPILLQGHTRSLTKVKYNSDGDLLFTASKDKAANVWYSHNGERLGSFEGHSGSIWDLDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFN--FDSPGRSVDFAVGDKLAVMTTDPFMGL  811
             S DS RL+T SAD +  LW+V  G  L+ ++    +  R+V FA GDK A   TD  +G 
Sbjct  61    SFDSKRLLTASADGSCILWNVSNGKILYQWSTVHQNAIRAVAFAEGDKKAFYVTDATLGQ  120

Query  810   PSAIHVKRIASDPEDQTGESV--LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAE  637
                IH+ +I  D   QTGE    + +KG +  +  A+WG LNKTII+G +  ++ +WDAE
Sbjct  121   KCTIHIFKIHEDISKQTGEFTREIIIKGQRATV--ALWGKLNKTIITGHDKGLVSLWDAE  178

Query  636   TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVN  457
             TG+L+   +    H   I  L    +  +FIT S D SA++ D  TL +LK +  ERPVN
Sbjct  179   TGELI---NSVQAHTGPIQDLQFGPEKEYFITASKDNSAQIIDATTLEVLKRFEVERPVN  235

Query  456   AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  277
             +  +SP+   I+LGGGQDA  VTTT  R GKFE +F+  + +EEIG V+GHFGPIN LAF
Sbjct  236   SAAISPIRQQIMLGGGQDAMNVTTTSARQGKFEVRFFHLVFREEIGRVRGHFGPINTLAF  295

Query  276   NPDGKSFASGGEDGYVRLHHFDADYFHIKI*G  181
             +PDGKSF+SGGEDGYVR+H FD DYF  K  G
Sbjct  296   HPDGKSFSSGGEDGYVRVHFFDNDYFTFKFPG  327



>ref|XP_006274867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Alligator mississippiensis]
Length=325

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 213/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T LKYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQLKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G+ 
Sbjct  121   FVSFFDLRDSSQIENDEPYMKIPCSESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQ  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +
Sbjct  181   LTNVKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDSTTLDHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>emb|CDQ91911.1| unnamed protein product [Oncorhynchus mykiss]
Length=332

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 216/325 (66%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDL+FS AKD    VW++ NGERLGTY GH GA+WC D  
Sbjct  9     KPILLQGHERSITQIKYNREGDLIFSVAKDTVANVWYSVNGERLGTYNGHTGALWCVDCD  68

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG    
Sbjct  69    WDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQCF  128

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++L
Sbjct  129   LNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVL  188

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
             K+  +   H K I  +  S+D +  IT S D S+KL+D  TL  +K++ TERPVN+  +S
Sbjct  189   KKVKE---HNKQINDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKSFKTERPVNSAAIS  245

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGK
Sbjct  246   PIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGK  305

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGY R+HHFD  YF  ++
Sbjct  306   SYSSGGEDGYTRIHHFDPQYFDFEL  330



>ref|NP_001157867.1| eukaryotic translation initiation factor 3 subunit I [Gallus 
gallus]
 ref|XP_009469099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Nipponia nippon]
 ref|XP_009998862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chaetura pelagica]
 ref|XP_011582244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Aquila chrysaetos canadensis]
Length=325

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ 
Sbjct  121   FVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQ  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +
Sbjct  181   LSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_005812506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Xiphophorus maculatus]
Length=325

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 219/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +     L++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121   FLNFFDLRDPQQMEDNNPYLSVPCSECKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK++ +   H + I  +  S+D +  IT S D ++KL+D  +L  +KT+ T+RPVN+  +
Sbjct  181   LKKAKE---HTRQINDIQSSVDLTMVITASKDNTSKLFDSNSLDHIKTFRTDRPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMDVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPHYFDFEL  323



>ref|XP_003969003.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Takifugu rubripes]
Length=325

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 217/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +   ++   + +I  AVWGPL   +I+G E+  +  + A++G++
Sbjct  121   FLNFFDLRDPQQIEDNQPYQSLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H + I  +  S+D + FIT S D +AKL+D  +L  +K++ TERPVN+  +
Sbjct  181   LKKVKE---HSRQINDIQTSVDLTMFITASKDNTAKLFDSNSLDHIKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFDFEL  323



>sp|B4LUA5.2|EIF3I_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
virilis]
Length=322

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 214/320 (67%), Gaps = 3/320 (1%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             +++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1     MLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  793
              +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    + +
Sbjct  61    RKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNCELFI  120

Query  792   KRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  616
               +  +D      E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K 
Sbjct  121   IDVRNADSSLSEQEPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KV  178

Query  615   SDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPL  436
              D  + H  GI  +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+
Sbjct  179   VDSGTDHTAGINDMQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAISPI  238

Query  435   LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  256
             LDH+VLGGGQDA  VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+
Sbjct  239   LDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSY  298

Query  255   ASGGEDGYVRLHHFDADYFH  196
             ASGGEDG+VR+  FD+ YF 
Sbjct  299   ASGGEDGFVRVQSFDSTYFE  318



>ref|XP_005058303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Ficedula albicollis]
 ref|XP_005529814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Pseudopodoces humilis]
 ref|XP_009096805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Serinus canaria]
Length=325

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 211/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ 
Sbjct  121   FVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQ  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +
Sbjct  181   LSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|NP_001157823.1| eukaryotic translation initiation factor 3 subunit I [Taeniopygia 
guttata]
 sp|B5FZ19.2|EIF3I_TAEGU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Taeniopygia guttata]
 gb|ACH44281.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44283.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44284.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44285.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44286.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
Length=325

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 211/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ 
Sbjct  121   FVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQ  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +
Sbjct  181   LSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLKHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|ADO28015.1| eukaryotic translation initiation factor 3 subunit i [Ictalurus 
furcatus]
Length=325

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 217/326 (67%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDQFVNVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   + +S   +  F     + + +TD  MG   
Sbjct  61    DWDTKHVLTGSADNSCRLWDCETGKQLAVLDTNSAVGTCGFDFSGNITMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +S L++   + +I  AVWGPL + +I+G E+  +  + A++G +
Sbjct  121   YLNFFDLRDPQQIEDNQSYLSVPCSESKITSAVWGPLREFVIAGHENGEINQFSAKSGDI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S+D +  IT S D +AKL+D  +L  +K++ TERPVN+  +
Sbjct  181   LTTVKE---HTKQINDIQSSVDLTMVITASKDCAAKLFDSSSLEHIKSFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYVRIHYFDPHYFDFEL  323



>ref|NP_001156064.1| eukaryotic translation initiation factor 3 subunit 2 beta-like 
[Acyrthosiphon pisum]
 dbj|BAH70836.1| ACYPI000798 [Acyrthosiphon pisum]
Length=325

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 215/321 (67%), Gaps = 3/321 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P++++GHER +T +KYNREGDLLFS AKD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MKPLMLQGHERAITQIKYNREGDLLFSSAKDVTPNVWYSLNGERLGTYNGHTGAVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                +++ ++G+AD T++LWDV TG ++   + +S  R+  F+    LA  +TD  M    
Sbjct  61    DWKTTKFLSGAADNTLRLWDVATGVEIGNISSNSAVRTCSFSYSADLASYSTDQAMKQDC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I +    +D   ++   +L M     ++   +WG L+ TII+G ED  +  WD  TGK 
Sbjct  121   EIFIVDARNDESFKSSAPILRMTVPDSKVTSLIWGTLDHTIITGHEDGAITQWDLRTGKS  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             ++       H+  I  + K+  G+ F+T S DK++KL+D+  L++ K YVTERPVN+ ++
Sbjct  181   IESVKD---HQGSINDMQKNRQGTMFVTASKDKTSKLFDVDDLSVHKVYVTERPVNSASL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  DH+VLGGGQDA  VTTT  +AGKF+A+F+  I +EE   VKGHFGPIN+LAF+PDG
Sbjct  238   SPKYDHVVLGGGQDAMDVTTTAAQAGKFDARFFHVIFEEEFARVKGHFGPINSLAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADY  202
             +SF++GGEDG++R+  FD  Y
Sbjct  298   ESFSTGGEDGFIRVQSFDPTY  318



>gb|KFP00122.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Calypte anna]
Length=325

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  2     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  62    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  122   VSFFDLRDSSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  181

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  182   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  238

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  239   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  298

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  299   SYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_008491107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Calypte anna]
Length=340

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 212/331 (64%), Gaps = 3/331 (1%)
 Frame = -1

Query  1179  SRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAV  1000
             S + + +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAV
Sbjct  11    SPSPRQKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAV  70

Query  999   WCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPF  820
             WC D   D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  
Sbjct  71    WCVDADWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQ  130

Query  819   MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  640
             MG    +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A
Sbjct  131   MGYQCFVSFFDLRDSSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSA  190

Query  639   ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPV  460
             ++G+ L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPV
Sbjct  191   KSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPV  247

Query  459   NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  280
             N+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++A
Sbjct  248   NSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVA  307

Query  279   FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             F+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  308   FHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  338



>emb|CAF99511.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=325

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 216/325 (66%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  2     KPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDCD  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG    
Sbjct  62    WDTKNVLTGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFSGNIIMFSTDKQMGYQCY  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             ++   +    + +  +  L++   + +I  AVWGPL   +I+G E+  +  + A++G +L
Sbjct  122   LNFFDLRDPQQIEDNQPYLSLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGDIL  181

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
             K+  +   H + I  +  S+D + FIT S D +AKL+D  +L  +K++ TERPVN+  +S
Sbjct  182   KKVKE---HSRQINDIQTSVDLTMFITASKDNTAKLFDSNSLDHIKSFKTERPVNSAAIS  238

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGK
Sbjct  239   PIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGK  298

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  ++
Sbjct  299   SYSSGGEDGYVRIHYFDPQYFDFEL  323



>gb|ACO09379.1| Eukaryotic translation initiation factor 3 subunit 2 [Osmerus 
mordax]
Length=325

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 214/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F     + + +TD  MG   
Sbjct  61    DWDTKNVLTGSADNSCRLWDCETGKQLALLQTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E   +  + A++G++
Sbjct  121   FLNYFDLRDPQQIEDNQPYLTVPCSESKITSAVWGPLGEYVIAGHESGEINQFSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             LK+  +   H K I  +  S+D +  IT S D  AKL+D  +L  +KT+ TERPVN+  +
Sbjct  181   LKKVKE---HTKQINDIQTSVDLTMVITASKDNHAKLFDSTSLDHIKTFKTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP++DH+V+GGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDG
Sbjct  238   SPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGY R+H+FD  YF  ++
Sbjct  298   KSYSSGGEDGYTRIHYFDPHYFDFEL  323



>gb|KIO29603.1| hypothetical protein M407DRAFT_167483 [Tulasnella calospora MUT 
4182]
Length=334

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 213/323 (66%), Gaps = 3/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL++GHER LT +KYNREGDLLF+C+KDH   VW++ NGERLGTY GHNG+VW  D+
Sbjct  1     MRPILLQGHERSLTQIKYNREGDLLFTCSKDHVINVWYSHNGERLGTYEGHNGSVWSVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
                S  L++G+AD T++LW V TG  L+T+ FD+  R V F+  DK  +  T+  MG   
Sbjct  61    DSKSEFLVSGAADNTMRLWQVSTGKCLYTWEFDTAVRRVAFSEDDKQVIQITEQRMGFQG  120

Query  804   AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
             AI +  I   D  +Q+ + +        ++    +     TI++G E   L +WD   G+
Sbjct  121   AIRIFNINQQDQTNQSAQPLYEFNPVGSKVTVIAFAKDPTTIVTGHESGKLSLWDVRKGE  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +    +E  H   IT +  S D S+ IT S DKSAKL + + LT LKTY TE P+N+  
Sbjct  181   EIL--TKERAHNDFITDMQFSPDRSYLITSSKDKSAKLHETKNLTPLKTYPTETPLNSAA  238

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             ++PL  +++LGGGQ+A +VTTT  R GKFE +F+ K+ +EE+G VKGHFGPIN +A +P 
Sbjct  239   IAPLRPYVLLGGGQEAMSVTTTSARQGKFETRFWHKVFEEEVGRVKGHFGPINTIAVHPS  298

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+ASGGEDG+VR+HHFD +YF
Sbjct  299   GRSYASGGEDGFVRVHHFDENYF  321



>gb|EFN69223.1| Eukaryotic translation initiation factor 3 subunit I [Camponotus 
floridanus]
Length=322

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 218/319 (68%), Gaps = 4/319 (1%)
 Frame = -1

Query  1152  LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  973
             ++ GHER  T +KYNREGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D++ D+
Sbjct  1     MLHGHERATTKIKYNREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDVNWDT  60

Query  972   SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  793
             +RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    + +
Sbjct  61    TRLLSGSGDNTLRVWDCQTGKEIGQLSTNSSVRACGFSYSANLAVFSTDKALGHQCEMFI  120

Query  792   KRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  616
               + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD    K L  
Sbjct  121   MDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRARKKLSS  180

Query  615   SDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPL  436
                  GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T+SP+
Sbjct  181   V---KGHKSQINDMQCNKDGTMFVTASKDHTAKLFDSESLMLLKTYKTERPVNSATISPI  237

Query  435   LDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  256
              DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+
Sbjct  238   FDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSY  297

Query  255   ASGGEDGYVRLHHFDADYF  199
             ++GGEDGY+R+++FD  YF
Sbjct  298   STGGEDGYIRINNFDQSYF  316



>ref|XP_010574327.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Haliaeetus leucocephalus]
Length=325

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 209/326 (64%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +     +I  AVWGPL   II+G E   L  + A++G+ 
Sbjct  121   FVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGDFIIAGHESGELNQFSAKSGEQ  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +
Sbjct  181   LSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_005302240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chrysemys picta bellii]
Length=325

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 216/326 (66%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSINGERLGTYTGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLTGSADNSCRLWDCETGKQLALVKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + ++ E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121   FVSFFDLRDPSQIESDEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H K I  +  S D + FIT S D SAKL+D  TL   K++ TERPVN+  +
Sbjct  181   LVNVKE---HTKQINDIQTSRDMTMFITASKDNSAKLFDSTTLEHQKSFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDG
Sbjct  238   SPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_010168387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Caprimulgus carolinensis]
Length=331

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  8     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  67

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  68    WDTQHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  127

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  128   VSFFDLRDSSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  187

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  188   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  244

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  245   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  304

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  305   SYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_003387873.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Amphimedon queenslandica]
Length=320

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 220/326 (67%), Gaps = 8/326 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRP+++ GHER +T ++YN +GDLLFS AKDH PTVW++DNGERLGTY GHNGAVWC D+
Sbjct  1     MRPLMLHGHERAITQIRYNYDGDLLFSVAKDHKPTVWYSDNGERLGTYNGHNGAVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + DS+ ++TG+AD T KLWD + G  + T+N  S  RS  F+    L + +T+    +  
Sbjct  61    NLDSTLVLTGAADDTAKLWDCEKGVAIQTWNTSSAIRSCGFSHLGNLLMFSTEDRKDVDC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              I V    S+       +V  +K    R++  +WGP ++ II+G  D  +R +D    K 
Sbjct  121   EIFVYDTRSNEG-----AVSRIKVEGERVSSGLWGPFDEFIITGHADGKVRHYDYRNNKC  175

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +K   Q+  H+  +T L  S D +  IT S D +A L+D+  L+L+KT+ T+RPVN+  +
Sbjct  176   IK---QQHMHRGTVTDLQLSQDKTMIITSSKDCNAMLYDVDELSLIKTFRTDRPVNSAAI  232

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  ++GKFEAKF+  I  EEIG VKGHFGPIN+L F+P+G
Sbjct  233   SPIKDHVVLGGGQEAMEVTTTTTKSGKFEAKFFHLIHAEEIGRVKGHFGPINSLKFHPNG  292

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  +I
Sbjct  293   KSYSSGGEDGYVRVHNFDPSYFEFEI  318



>ref|XP_009283047.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Aptenodytes forsteri]
Length=331

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 210/325 (65%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  8     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  67

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  68    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  127

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L
Sbjct  128   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQL  187

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  188   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  244

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  245   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  304

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  305   SYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_007170666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Balaenoptera acutorostrata scammoni]
Length=325

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 213/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL   N +S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTKHVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    +  + E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121   FVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVWGPLGECIIAGHEGGELNQYSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H + I  +  S D + F+T S D +AKL+D  TL   KT+ TERPVN+  +
Sbjct  181   LVTVKE---HSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFQTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAIEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_011582243.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Aquila chrysaetos canadensis]
Length=332

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 211/333 (63%), Gaps = 3/333 (1%)
 Frame = -1

Query  1185  LQSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNG  1006
             + S     +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH G
Sbjct  1     MASPPASQKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTG  60

Query  1005  AVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTD  826
             AVWC D   D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD
Sbjct  61    AVWCVDADWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTD  120

Query  825   PFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIW  646
               MG    +    +    + +  E  + +     +I  AVWGPL + II+G E   L  +
Sbjct  121   KQMGYQCFVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQF  180

Query  645   DAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTER  466
              A++G+ L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TER
Sbjct  181   SAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTER  237

Query  465   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINA  286
             PVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN+
Sbjct  238   PVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINS  297

Query  285   LAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             +AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   VAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  330



>gb|EOB00694.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Anas platyrhynchos]
 gb|KFU91822.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Chaetura pelagica]
Length=325

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  2     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  62    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  122   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  181

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  182   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  238

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  239   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  298

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  299   SYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|KFV75063.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Picoides pubescens]
Length=324

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  1     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  60

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  61    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  120

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  121   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  180

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  181   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  237

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  238   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  297

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   SYSSGGEDGYVRIHYFDPQYFEFEF  322



>ref|XP_006019466.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Alligator sinensis]
Length=329

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 212/325 (65%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T LKYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  6     KPILLQGHERSITQLKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  65

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  66    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  125

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G+ L
Sbjct  126   VSFFDLRDSSQIENDEPYMKIPCSESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQL  185

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  186   TNVKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDSTTLDHLKTFRTERPVNSAALS  242

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDGK
Sbjct  243   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDGK  302

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  303   SYSSGGEDGYVRIHYFDPQYFEFEF  327



>ref|XP_005239876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco peregrinus]
 ref|XP_005432815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco cherrug]
 ref|XP_009946176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Leptosomus discolor]
 ref|XP_010180366.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Mesitornis unicolor]
Length=331

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  8     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  67

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  68    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  127

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  128   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  187

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  188   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  244

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  245   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  304

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  305   SYSSGGEDGYVRIHYFDPQYFEFEF  329



>ref|XP_003500685.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cricetulus griseus]
 ref|XP_007637086.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cricetulus griseus]
 gb|EGW00112.1| Eukaryotic translation initiation factor 3 subunit I [Cricetulus 
griseus]
Length=325

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 213/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERSITQIKYNREGDLLFTVAKDPTVNVWYSVNGERLGTYIGHGGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G  + +++TD  MG   
Sbjct  61    DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMLSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
             ++    +    +  T E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121   SVSFFDLRDPSQIDTNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H + I  +  S D + F+T S D +AKL+D  +L   KT+ TERPVN+  +
Sbjct  181   LVSVKE---HSRQINDIQLSRDMTMFVTASKDNTAKLFDSTSLEHQKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|KFP75614.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Acanthisitta chloris]
Length=325

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 210/325 (65%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  2     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  61

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  62    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  121

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L
Sbjct  122   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQL  181

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +S
Sbjct  182   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALS  238

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  239   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  298

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  299   SYSSGGEDGYVRIHYFDPQYFEFEF  323



>gb|EFN80704.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=324

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 225/323 (70%), Gaps = 6/323 (2%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1     MKPLMLHGHERAITKIKYNREGDLVFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++RL++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRLLSGSGDNSLRVWDCQTGKEIGQLDTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  TGK
Sbjct  121   EMFIMDIRNVDSTLSQDDAISRISVNGPRISAILWGALDETIITGHEDGDITLWD--TGK  178

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              L       GHK  I  +  + DG+ F+T S D +AKL+D  +L LLKT+ TERPVN+ T
Sbjct  179   KLSNV---KGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSDSLMLLKTFKTERPVNSAT  235

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  236   ISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  295

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+S+++GGEDGY+R+++FD  YF
Sbjct  296   GRSYSTGGEDGYIRINNFDQSYF  318



>ref|NP_001015781.1| eukaryotic translation initiation factor 3 subunit I [Xenopus 
(Silurana) tropicalis]
 sp|Q5EBE8.1|EIF3I_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Xenopus (Silurana) tropicalis]
 gb|AAH89722.1| MGC108352 protein [Xenopus (Silurana) tropicalis]
 emb|CAL49363.1| eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa 
[Xenopus (Silurana) tropicalis]
 gb|AAI57540.1| MGC108352 protein [Xenopus (Silurana) tropicalis]
Length=325

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 213/322 (66%), Gaps = 3/322 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL++GHER +T +KYNR+GDLLF+ AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1     MRPILLQGHERSITQIKYNRDGDLLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  +++GSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61    DWDTRHVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121   FVSFIDLRDPTQIEDNEPYMKIPCSESKITSAVWGPLGENIIAGHENGELNQYSAKSGEI  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             +    +   H K I  +  S D + F+T S D ++KL+D  +L   KT+ TERPVN+  +
Sbjct  181   VNSIKE---HSKQINDIQTSRDMTMFVTASKDCTSKLFDSTSLEHQKTFRTERPVNSAAI  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN+LAF+PDG
Sbjct  238   SPIYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHVAFEEEFGRVKGHFGPINSLAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYF  199
             KS++SGGEDGYVR+H+FD  YF
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYF  319



>ref|XP_009068306.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Acanthisitta chloris]
Length=324

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 210/325 (65%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  1     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  60

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  61    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  120

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L
Sbjct  121   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQL  180

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +S
Sbjct  181   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALS  237

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  238   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  297

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   SYSSGGEDGYVRIHYFDPQYFEFEF  322



>ref|XP_010721802.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Meleagris gallopavo]
Length=351

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 210/328 (64%), Gaps = 3/328 (1%)
 Frame = -1

Query  1170  KKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCC  991
             +  +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC 
Sbjct  25    RTQKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCV  84

Query  990   DISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGL  811
             D   D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG 
Sbjct  85    DADWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGY  144

Query  810   PSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  631
                +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G
Sbjct  145   QCFVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSG  204

Query  630   KLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAV  451
             + L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+ 
Sbjct  205   EQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSA  261

Query  450   TMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNP  271
              +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+P
Sbjct  262   ALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHP  321

Query  270   DGKSFASGGEDGYVRLHHFDADYFHIKI  187
             DGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  322   DGKSYSSGGEDGYVRIHYFDPQYFEFEF  349



>ref|XP_010574326.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Haliaeetus leucocephalus]
Length=332

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 210/333 (63%), Gaps = 3/333 (1%)
 Frame = -1

Query  1185  LQSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNG  1006
             + S     +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH G
Sbjct  1     MASPPASQKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTG  60

Query  1005  AVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTD  826
             AVWC D   D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD
Sbjct  61    AVWCVDADWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTD  120

Query  825   PFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIW  646
               MG    +    +    + +  E  + +     +I  AVWGPL   II+G E   L  +
Sbjct  121   KQMGYQCFVSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGDFIIAGHESGELNQF  180

Query  645   DAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTER  466
              A++G+ L    +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TER
Sbjct  181   SAKSGEQLSNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTER  237

Query  465   PVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINA  286
             PVN+  +SP+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN+
Sbjct  238   PVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINS  297

Query  285   LAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  187
             +AF+PDGKS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   VAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF  330



>ref|XP_009906815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Picoides pubescens]
Length=340

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  17    KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  76

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  77    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  136

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  137   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  196

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +S
Sbjct  197   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALS  253

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  254   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  313

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  314   SYSSGGEDGYVRIHYFDPQYFEFEF  338



>dbj|BAD96203.1| eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa 
variant [Homo sapiens]
Length=325

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 210/326 (64%), Gaps = 3/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+PIL++GHERP+T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1     MKPILLQGHERPITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
               D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G    + +TD  MG   
Sbjct  61    DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNTIMFSTDKQMGYQC  120

Query  804   AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  625
              +    +    +    E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121   FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV  180

Query  624   LKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTM  445
             L    +   H + I  +  S D + F+T S D +AKL+D  TL   KT+ TERPVN+  +
Sbjct  181   LVNVKE---HSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAAL  237

Query  444   SPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG  265
             SP  DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDG
Sbjct  238   SPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDG  297

Query  264   KSFASGGEDGYVRLHHFDADYFHIKI  187
             KS++SGGEDGYVR+H+FD  YF  + 
Sbjct  298   KSYSSGGEDGYVRIHYFDPQYFEFEF  323



>ref|XP_003487069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Bombus impatiens]
Length=326

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 220/323 (68%), Gaps = 4/323 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLG++ GHNG+VWC DI
Sbjct  1     MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDI  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             + D++R ++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61    NWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120

Query  804   AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + +  I + D      +++  +  +  +I   +WG L++TII+G ED  + +WD  T K
Sbjct  121   EMFIIDIKNVDAVLSQADAISRIAVNGPKITAILWGALDETIITGHEDGEITLWDVRTRK  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +        HK  I  +  + DG+ F+T S D +AKL+D  +L LLKTY TERPVN+ T
Sbjct  181   KMTSV---RSHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERPVNSAT  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             +SP+ DH+VLGGGQDA  VTTT  R GKF+++F+  + +EE   +KGHFGPIN+LAF+P+
Sbjct  238   ISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYF  199
             G+SF++GGEDGYVR++ FD  YF
Sbjct  298   GRSFSTGGEDGYVRINTFDQSYF  320



>gb|ERZ95383.1| hypothetical protein GLOINDRAFT_341253 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX76099.1| Tif34p [Rhizophagus irregularis DAOM 197198w]
Length=327

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 219/326 (67%), Gaps = 4/326 (1%)
 Frame = -1

Query  1164  MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  985
             MRPIL++GH R LT +KYN EGDLLFS AKD    VW++ NGERLGTY GH GA+W  D+
Sbjct  1     MRPILLQGHTRSLTQIKYNYEGDLLFSVAKDQVVNVWYSHNGERLGTYHGHVGAIWTVDV  60

Query  984   SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  805
             +  SS L+TGSAD + KLW+V+TG  L T+ F +  + V F+  D +A++ T+  MG P 
Sbjct  61    NSTSSILLTGSADNSAKLWEVRTGKCLHTWEFKTAVKRVAFSEDDSMALVVTENRMGYPG  120

Query  804   AIHVKRIASDPE-DQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  628
              + V  + +D + +Q+ E  + +     +   A WG LNK II+G E+  +  +D +TG+
Sbjct  121   TVTVFSVKNDIDAEQSDEPTMIINQEGSKAMVAAWGYLNKYIITGHENGEISQYDWKTGE  180

Query  627   LLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVT  448
              +K       H   I+ L  S D ++FIT S DKSA++++  TL  LK Y T+ P+N+ +
Sbjct  181   KIKSIHP---HTDVISDLQMSEDRTYFITSSKDKSAQIFESNTLNPLKKYATDAPLNSAS  237

Query  447   MSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPD  268
             ++P+ D ++LGGGQ+A  VT T  R GKFE +F+ KIL+EE+G VKGHFGPIN +A +P+
Sbjct  238   ITPIQDFVILGGGQEAMEVTLTKLRHGKFECRFWHKILEEEVGRVKGHFGPINTIAVHPN  297

Query  267   GKSFASGGEDGYVRLHHFDADYFHIK  190
             GK F+SGGEDGYVR+HHFD DYF  K
Sbjct  298   GKGFSSGGEDGYVRVHHFDEDYFKFK  323



>ref|XP_008633416.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus brachyrhynchos]
 ref|XP_010406518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus cornix cornix]
Length=326

 Score =   315 bits (807),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 209/325 (64%), Gaps = 3/325 (1%)
 Frame = -1

Query  1161  RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  982
             +PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  3     KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDAD  62

Query  981   RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  802
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG    
Sbjct  63    WDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQCF  122

Query  801   IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  622
             +    +    + +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L
Sbjct  123   VSFFDLRDPSQIENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQL  182

Query  621   KESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS  442
                 +   H K I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +S
Sbjct  183   SNIKE---HTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALS  239

Query  441   PLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  262
             P+ DH+VLGGGQ+A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGK
Sbjct  240   PIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK  299

Query  261   SFASGGEDGYVRLHHFDADYFHIKI  187
             S++SGGEDGYVR+H+FD  YF  + 
Sbjct  300   SYSSGGEDGYVRIHYFDPQYFEFEF  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3623520585481