BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4367

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU26866.1|  hypothetical protein MIMGU_mgv1a002476mg                125   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_011087395.1|  PREDICTED: lysosomal beta glucosidase-like         128   4e-33   Sesamum indicum [beniseed]
ref|XP_004230073.1|  PREDICTED: lysosomal beta glucosidase              123   4e-32   Solanum lycopersicum
ref|XP_006347719.1|  PREDICTED: lysosomal beta glucosidase-like i...    124   5e-32   Solanum tuberosum [potatoes]
emb|CBI24995.3|  unnamed protein product                                121   7e-32   Vitis vinifera
ref|XP_002262992.1|  PREDICTED: lysosomal beta glucosidase              121   8e-32   Vitis vinifera
ref|XP_009595456.1|  PREDICTED: lysosomal beta glucosidase-like i...    120   3e-31   Nicotiana tomentosiformis
ref|XP_009799725.1|  PREDICTED: lysosomal beta glucosidase-like         120   3e-31   Nicotiana sylvestris
emb|CDP06849.1|  unnamed protein product                                114   9e-31   Coffea canephora [robusta coffee]
ref|XP_007147489.1|  hypothetical protein PHAVU_006G128800g             114   2e-30   Phaseolus vulgaris [French bean]
ref|XP_006445671.1|  hypothetical protein CICLE_v10014537mg             113   3e-30   Citrus clementina [clementine]
gb|KHN14336.1|  Lysosomal beta glucosidase                              112   3e-30   Glycine soja [wild soybean]
ref|XP_003546253.1|  PREDICTED: lysosomal beta glucosidase-like i...    112   4e-30   
ref|XP_006445670.1|  hypothetical protein CICLE_v10014537mg             113   4e-30   
gb|KDO48683.1|  hypothetical protein CISIN_1g045895mg                   113   5e-30   Citrus sinensis [apfelsine]
gb|KHN22996.1|  Lysosomal beta glucosidase                              107   1e-28   Glycine soja [wild soybean]
ref|XP_003535075.1|  PREDICTED: lysosomal beta glucosidase-like i...    106   1e-28   Glycine max [soybeans]
ref|XP_012076264.1|  PREDICTED: lysosomal beta glucosidase-like         108   2e-28   Jatropha curcas
ref|XP_004306422.2|  PREDICTED: lysosomal beta glucosidase-like         102   3e-27   Fragaria vesca subsp. vesca
ref|XP_010067089.1|  PREDICTED: lysosomal beta glucosidase              102   4e-27   
ref|XP_006379440.1|  hypothetical protein POPTR_0008s01410g             103   4e-27   
ref|XP_008375543.1|  PREDICTED: lysosomal beta glucosidase              103   4e-27   
ref|XP_008347332.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    102   9e-27   
ref|XP_008363217.1|  PREDICTED: lysosomal beta glucosidase-like         102   2e-26   
gb|KJB60360.1|  hypothetical protein B456_009G301800                    100   3e-26   Gossypium raimondii
ref|XP_004141128.1|  PREDICTED: lysosomal beta glucosidase-like         101   3e-26   Cucumis sativus [cucumbers]
ref|XP_009418960.1|  PREDICTED: lysosomal beta glucosidase-like         105   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685489.1|  PREDICTED: lysosomal beta glucosidase-like         102   3e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004135054.1|  PREDICTED: lysosomal beta glucosidase isofor...  99.4    3e-26   Cucumis sativus [cucumbers]
gb|EEC71555.1|  hypothetical protein OsI_03907                          107   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_002514453.1|  Periplasmic beta-glucosidase precursor, puta...    102   3e-26   
ref|XP_011655822.1|  PREDICTED: lysosomal beta glucosidase isofor...  99.4    4e-26   Cucumis sativus [cucumbers]
ref|XP_011032947.1|  PREDICTED: lysosomal beta glucosidase            99.8    4e-26   Populus euphratica
ref|XP_009368627.1|  PREDICTED: lysosomal beta glucosidase-like       98.6    4e-26   Pyrus x bretschneideri [bai li]
ref|XP_008446716.1|  PREDICTED: lysosomal beta glucosidase isofor...  99.0    5e-26   Cucumis melo [Oriental melon]
ref|XP_011089216.1|  PREDICTED: uncharacterized protein LOC105170243    102   5e-26   
ref|XP_008344529.1|  PREDICTED: lysosomal beta glucosidase-like       99.4    6e-26   
ref|XP_008446717.1|  PREDICTED: lysosomal beta glucosidase isofor...  98.6    6e-26   Cucumis melo [Oriental melon]
ref|XP_008240500.1|  PREDICTED: lysosomal beta glucosidase-like       99.8    8e-26   Prunus mume [ume]
ref|XP_009341596.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    102   9e-26   
emb|CAN61369.1|  hypothetical protein VITISV_011685                     101   9e-26   Vitis vinifera
ref|XP_007204092.1|  hypothetical protein PRUPE_ppa002894mg           99.8    1e-25   
ref|XP_008464959.1|  PREDICTED: lysosomal beta glucosidase-like       99.8    1e-25   Cucumis melo [Oriental melon]
ref|XP_008354865.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...  98.6    1e-25   
ref|XP_007208190.1|  hypothetical protein PRUPE_ppa020836mg           97.4    2e-25   
gb|AAQ17461.1|  beta-D-glucosidase                                    98.2    2e-25   Gossypium hirsutum [American cotton]
ref|XP_010917928.1|  PREDICTED: uncharacterized protein LOC105042425    100   2e-25   
emb|CAA07070.1|  beta-D-glucosidase                                     100   2e-25   Tropaeolum majus
ref|XP_007015579.1|  Glycosyl hydrolase family protein isoform 2      97.8    2e-25   
ref|XP_007015578.1|  Glycosyl hydrolase family protein isoform 1      97.8    2e-25   
ref|XP_010266636.1|  PREDICTED: lysosomal beta glucosidase-like       97.8    3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010088030.1|  Lysosomal beta glucosidase                       98.2    3e-25   
ref|XP_008230878.1|  PREDICTED: lysosomal beta glucosidase-like         100   3e-25   Prunus mume [ume]
ref|XP_009804819.1|  PREDICTED: lysosomal beta glucosidase-like       99.0    3e-25   Nicotiana sylvestris
ref|XP_010908052.1|  PREDICTED: lysosomal beta glucosidase-like i...    102   3e-25   Elaeis guineensis
ref|XP_004236622.1|  PREDICTED: lysosomal beta glucosidase-like         100   3e-25   Solanum lycopersicum
ref|XP_003545548.1|  PREDICTED: lysosomal beta glucosidase-like       97.8    3e-25   Glycine max [soybeans]
ref|XP_003594509.1|  Beta-D-glucosidase                               98.2    3e-25   Medicago truncatula
ref|XP_008231857.1|  PREDICTED: lysosomal beta glucosidase isofor...  95.9    3e-25   Prunus mume [ume]
ref|XP_010088029.1|  Periplasmic beta-glucosidase                     97.8    3e-25   
ref|XP_010908054.1|  PREDICTED: lysosomal beta glucosidase-like i...    102   3e-25   Elaeis guineensis
gb|KHM99112.1|  Lysosomal beta glucosidase                            97.8    3e-25   Glycine soja [wild soybean]
ref|XP_007010544.1|  Glycosyl hydrolase family protein isoform 3      96.3    4e-25   
ref|XP_008231858.1|  PREDICTED: lysosomal beta glucosidase isofor...  95.9    4e-25   Prunus mume [ume]
ref|XP_008347396.1|  PREDICTED: G-type lectin S-receptor-like ser...  97.4    4e-25   
ref|XP_002874024.1|  glycosyl hydrolase family 3 protein              97.1    4e-25   
gb|AFS50097.1|  beta-D-glucan exohydolase                             99.0    4e-25   Elaeis guineensis
ref|XP_010908055.1|  PREDICTED: lysosomal beta glucosidase-like i...    102   4e-25   Elaeis guineensis
ref|XP_008391778.1|  PREDICTED: lysosomal beta glucosidase-like       99.8    4e-25   
ref|XP_007010542.1|  Glycosyl hydrolase family protein isoform 1      96.3    4e-25   
ref|XP_007010543.1|  Glycosyl hydrolase family protein isoform 2      96.3    4e-25   
ref|XP_008245228.1|  PREDICTED: lysosomal beta glucosidase-like       96.3    4e-25   Prunus mume [ume]
ref|XP_008230855.1|  PREDICTED: lysosomal beta glucosidase-like       96.3    4e-25   Prunus mume [ume]
ref|XP_011470452.1|  PREDICTED: lysosomal beta glucosidase-like       99.0    4e-25   Fragaria vesca subsp. vesca
ref|XP_009131828.1|  PREDICTED: lysosomal beta glucosidase            97.1    4e-25   Brassica rapa
ref|XP_004295138.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    4e-25   Fragaria vesca subsp. vesca
emb|CDX88832.1|  BnaA03g08170D                                        97.1    4e-25   
gb|EPS66822.1|  hypothetical protein M569_07948                       99.0    4e-25   Genlisea aurea
ref|XP_007207411.1|  hypothetical protein PRUPE_ppa014605mg           96.3    5e-25   
gb|KHG09998.1|  Lysosomal beta glucosidase                            96.3    5e-25   Gossypium arboreum [tree cotton]
ref|XP_004502135.1|  PREDICTED: lysosomal beta glucosidase-like       97.4    5e-25   
ref|XP_010541670.1|  PREDICTED: lysosomal beta glucosidase-like       97.8    6e-25   Tarenaya hassleriana [spider flower]
ref|XP_007205098.1|  hypothetical protein PRUPE_ppa014607mg           95.9    6e-25   
ref|XP_007206306.1|  hypothetical protein PRUPE_ppa025914mg           99.0    6e-25   
ref|XP_002523935.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  96.3    6e-25   Ricinus communis
ref|XP_008791319.1|  PREDICTED: uncharacterized protein LOC103708257  99.4    7e-25   
ref|XP_009417082.1|  PREDICTED: lysosomal beta glucosidase-like         101   7e-25   
ref|XP_007030059.1|  Glycosyl hydrolase family protein                  100   7e-25   
ref|XP_010535769.1|  PREDICTED: lysosomal beta glucosidase-like       98.6    7e-25   Tarenaya hassleriana [spider flower]
ref|XP_010653212.1|  PREDICTED: lysosomal beta glucosidase-like i...  97.4    7e-25   Vitis vinifera
ref|XP_009757149.1|  PREDICTED: lysosomal beta glucosidase-like       99.0    7e-25   Nicotiana sylvestris
emb|CBI39076.3|  unnamed protein product                              97.4    7e-25   Vitis vinifera
ref|XP_002266470.2|  PREDICTED: lysosomal beta glucosidase-like i...  97.4    7e-25   Vitis vinifera
ref|XP_010420942.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    8e-25   
gb|KHN34680.1|  Lysosomal beta glucosidase                            97.8    8e-25   Glycine soja [wild soybean]
ref|XP_006487803.1|  PREDICTED: lysosomal beta glucosidase-like i...  97.8    9e-25   Citrus sinensis [apfelsine]
ref|XP_008385601.1|  PREDICTED: lysosomal beta glucosidase-like       98.2    9e-25   
gb|KDO54375.1|  hypothetical protein CISIN_1g006872mg                 97.8    9e-25   Citrus sinensis [apfelsine]
ref|XP_009368634.1|  PREDICTED: lysosomal beta glucosidase-like       98.2    9e-25   Pyrus x bretschneideri [bai li]
ref|XP_010679654.1|  PREDICTED: lysosomal beta glucosidase-like       95.9    1e-24   
ref|XP_010493212.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010420941.1|  PREDICTED: lysosomal beta glucosidase-like       94.4    1e-24   
ref|XP_006289165.1|  hypothetical protein CARUB_v10002603mg           96.7    1e-24   Capsella rubella
ref|XP_010279030.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    1e-24   Nelumbo nucifera [Indian lotus]
gb|KJB35516.1|  hypothetical protein B456_006G118100                  97.8    1e-24   Gossypium raimondii
ref|XP_009595457.1|  PREDICTED: lysosomal beta glucosidase-like i...  98.2    1e-24   
ref|XP_011089217.1|  PREDICTED: lysosomal beta glucosidase-like       97.4    1e-24   Sesamum indicum [beniseed]
ref|XP_010679080.1|  PREDICTED: lysosomal beta glucosidase-like       95.5    1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007202161.1|  hypothetical protein PRUPE_ppa006354mg           95.9    1e-24   
ref|XP_004301060.1|  PREDICTED: lysosomal beta glucosidase-like       98.6    2e-24   Fragaria vesca subsp. vesca
ref|XP_010456613.1|  PREDICTED: lysosomal beta glucosidase-like       94.0    2e-24   
ref|XP_006286473.1|  hypothetical protein CARUB_v10000466mg           94.0    2e-24   Capsella rubella
ref|XP_002266675.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    2e-24   Vitis vinifera
gb|EEE55456.1|  hypothetical protein OsJ_03617                          101   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044387.1|  Os01g0771900                                       101   2e-24   
ref|XP_002266589.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    2e-24   Vitis vinifera
ref|XP_007218946.1|  hypothetical protein PRUPE_ppa002559mg           93.6    2e-24   Prunus persica
ref|XP_002874025.1|  glycosyl hydrolase family 3 protein              94.0    2e-24   
emb|CDP10537.1|  unnamed protein product                              97.4    2e-24   Coffea canephora [robusta coffee]
emb|CDP15624.1|  unnamed protein product                              96.3    2e-24   Coffea canephora [robusta coffee]
ref|XP_006424024.1|  hypothetical protein CICLE_v10028018mg           96.7    2e-24   Citrus clementina [clementine]
gb|KHG17513.1|  gluA                                                  97.8    2e-24   Gossypium arboreum [tree cotton]
ref|NP_001051275.1|  Os03g0749300                                     97.8    2e-24   
ref|XP_002278363.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    2e-24   Vitis vinifera
emb|CBI22348.3|  unnamed protein product                              96.7    2e-24   Vitis vinifera
gb|KHN46760.1|  Lysosomal beta glucosidase                            96.3    2e-24   Glycine soja [wild soybean]
ref|XP_003548716.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.9    2e-24   Glycine max [soybeans]
emb|CBI22347.3|  unnamed protein product                              96.3    2e-24   Vitis vinifera
ref|XP_006598973.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.9    2e-24   Glycine max [soybeans]
ref|XP_011094175.1|  PREDICTED: lysosomal beta glucosidase-like       96.3    2e-24   
ref|XP_009614218.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    2e-24   
ref|XP_008245226.1|  PREDICTED: lysosomal beta glucosidase-like       96.3    2e-24   Prunus mume [ume]
ref|XP_010558244.1|  PREDICTED: lysosomal beta glucosidase            96.3    3e-24   Tarenaya hassleriana [spider flower]
ref|XP_011021458.1|  PREDICTED: lysosomal beta glucosidase-like       97.4    3e-24   Populus euphratica
ref|XP_006575592.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.5    3e-24   
ref|XP_010031608.1|  PREDICTED: lysosomal beta glucosidase-like       93.6    3e-24   Eucalyptus grandis [rose gum]
ref|XP_006575593.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.5    3e-24   
ref|XP_008344965.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    3e-24   
ref|XP_006479136.1|  PREDICTED: lysosomal beta glucosidase-like       95.9    3e-24   Citrus sinensis [apfelsine]
ref|XP_006443452.1|  hypothetical protein CICLE_v10019305mg           95.5    3e-24   
ref|XP_011089010.1|  PREDICTED: lysosomal beta glucosidase-like       94.4    3e-24   Sesamum indicum [beniseed]
ref|XP_003601350.1|  Beta-D-glucosidase                               94.7    3e-24   Medicago truncatula
ref|XP_010097917.1|  Periplasmic beta-glucosidase                     95.9    3e-24   
ref|XP_009120747.1|  PREDICTED: lysosomal beta glucosidase-like       94.0    3e-24   Brassica rapa
ref|XP_003519468.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.1    3e-24   Glycine max [soybeans]
gb|KHN38459.1|  Lysosomal beta glucosidase                            95.1    3e-24   Glycine soja [wild soybean]
ref|XP_008355265.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    3e-24   
ref|XP_006400664.1|  hypothetical protein EUTSA_v10012963mg           94.0    3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008464960.1|  PREDICTED: lysosomal beta glucosidase-like       95.1    3e-24   
ref|XP_004241372.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    3e-24   Solanum lycopersicum
gb|KHG17514.1|  gluA                                                  97.1    3e-24   Gossypium arboreum [tree cotton]
ref|XP_009342674.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    4e-24   Pyrus x bretschneideri [bai li]
ref|XP_003638320.1|  Beta-D-glucosidase                               94.4    4e-24   
ref|XP_009769527.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    4e-24   Nicotiana sylvestris
ref|XP_006347720.1|  PREDICTED: lysosomal beta glucosidase-like i...  97.4    4e-24   
ref|XP_009760946.1|  PREDICTED: lysosomal beta glucosidase-like       95.5    4e-24   Nicotiana sylvestris
gb|KDP39682.1|  hypothetical protein JCGZ_02702                       95.1    4e-24   Jatropha curcas
ref|XP_009610986.1|  PREDICTED: lysosomal beta glucosidase-like       98.2    4e-24   Nicotiana tomentosiformis
ref|XP_009609161.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.9    4e-24   Nicotiana tomentosiformis
ref|XP_002525724.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  95.5    4e-24   Ricinus communis
ref|XP_012070424.1|  PREDICTED: lysosomal beta glucosidase-like       95.1    4e-24   Jatropha curcas
ref|XP_009609162.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.9    4e-24   Nicotiana tomentosiformis
gb|AFU52664.1|  beta-1,3-glucanase 31                                 97.4    4e-24   Solanum tuberosum [potatoes]
ref|XP_011652313.1|  PREDICTED: lysosomal beta glucosidase-like       97.1    4e-24   Cucumis sativus [cucumbers]
ref|XP_006361126.1|  PREDICTED: lysosomal beta glucosidase-like i...  96.3    4e-24   Solanum tuberosum [potatoes]
ref|XP_008385616.1|  PREDICTED: lysosomal beta glucosidase-like       97.4    5e-24   
ref|XP_006604247.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.1    5e-24   
ref|XP_006350208.1|  PREDICTED: lysosomal beta glucosidase-like       97.8    5e-24   Solanum tuberosum [potatoes]
ref|XP_002451476.1|  hypothetical protein SORBIDRAFT_04g002570        97.1    5e-24   Sorghum bicolor [broomcorn]
ref|XP_002456420.1|  hypothetical protein SORBIDRAFT_03g035970        99.0    5e-24   Sorghum bicolor [broomcorn]
ref|XP_003569924.1|  PREDICTED: lysosomal beta glucosidase-like         100   5e-24   Brachypodium distachyon [annual false brome]
gb|KJB44572.1|  hypothetical protein B456_007G260000                  94.0    5e-24   Gossypium raimondii
gb|KHG23007.1|  Lysosomal beta glucosidase                            94.0    5e-24   Gossypium arboreum [tree cotton]
ref|XP_008777968.1|  PREDICTED: lysosomal beta glucosidase-like i...  98.6    6e-24   Phoenix dactylifera
ref|XP_009619848.1|  PREDICTED: lysosomal beta glucosidase-like       95.9    6e-24   Nicotiana tomentosiformis
ref|XP_010031611.1|  PREDICTED: lysosomal beta glucosidase-like       98.2    6e-24   Eucalyptus grandis [rose gum]
ref|XP_008777967.1|  PREDICTED: lysosomal beta glucosidase-like i...  98.6    6e-24   Phoenix dactylifera
ref|XP_009801845.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    6e-24   Nicotiana sylvestris
gb|AIO11756.1|  beta-glucosidase                                      95.5    6e-24   Glycine max [soybeans]
ref|XP_003535890.1|  PREDICTED: lysosomal beta glucosidase            95.5    6e-24   
ref|XP_008777969.1|  PREDICTED: lysosomal beta glucosidase-like i...  98.2    7e-24   
gb|KHN45535.1|  Lysosomal beta glucosidase                            95.5    7e-24   Glycine soja [wild soybean]
ref|XP_011077752.1|  PREDICTED: lysosomal beta glucosidase-like       95.1    7e-24   Sesamum indicum [beniseed]
ref|XP_008443733.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    7e-24   Cucumis melo [Oriental melon]
ref|XP_007141605.1|  hypothetical protein PHAVU_008G210100g           93.6    7e-24   Phaseolus vulgaris [French bean]
ref|XP_010103976.1|  Lysosomal beta glucosidase                       95.1    7e-24   
emb|CDX92422.1|  BnaA10g14610D                                        92.8    7e-24   
ref|XP_007145577.1|  hypothetical protein PHAVU_007G250300g           95.5    7e-24   Phaseolus vulgaris [French bean]
emb|CDY16581.1|  BnaC09g36920D                                        92.8    7e-24   Brassica napus [oilseed rape]
gb|EPS66823.1|  hypothetical protein M569_07949                       95.1    8e-24   Genlisea aurea
ref|XP_004228467.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.5    8e-24   Solanum lycopersicum
ref|XP_004954724.1|  PREDICTED: lysosomal beta glucosidase-like       94.4    9e-24   Setaria italica
dbj|BAK02950.1|  predicted protein                                    95.9    9e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13489.1|  Lysosomal beta glucosidase                            95.9    9e-24   
gb|KJB60361.1|  hypothetical protein B456_009G301800                  92.0    1e-23   Gossypium raimondii
ref|XP_006644778.1|  PREDICTED: lysosomal beta glucosidase-like       99.0    1e-23   Oryza brachyantha
ref|NP_197595.2|  glycosyl hydrolase family protein                   91.7    1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917869.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.1    1e-23   Elaeis guineensis
ref|XP_009609160.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.5    1e-23   Nicotiana tomentosiformis
ref|XP_010917874.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.1    1e-23   Elaeis guineensis
ref|XP_011004424.1|  PREDICTED: lysosomal beta glucosidase-like       94.4    1e-23   Populus euphratica
ref|XP_009609159.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.5    1e-23   Nicotiana tomentosiformis
ref|XP_010312450.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.1    1e-23   
emb|CDP15627.1|  unnamed protein product                              95.9    1e-23   Coffea canephora [robusta coffee]
ref|XP_009588263.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    1e-23   Nicotiana tomentosiformis
ref|XP_006379343.1|  hypothetical protein POPTR_0009s15590g           94.4    1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002313632.1|  beta-D-glucan exohydrolase family protein        94.4    1e-23   
ref|XP_002453253.1|  hypothetical protein SORBIDRAFT_04g002560        96.7    1e-23   Sorghum bicolor [broomcorn]
gb|KHN03708.1|  Lysosomal beta glucosidase                            92.4    1e-23   Glycine soja [wild soybean]
emb|CDX70953.1|  BnaC03g10370D                                        91.7    1e-23   
ref|XP_007151483.1|  hypothetical protein PHAVU_004G050500g           95.9    1e-23   Phaseolus vulgaris [French bean]
gb|EYU18174.1|  hypothetical protein MIMGU_mgv1a002879mg              94.4    1e-23   Erythranthe guttata [common monkey flower]
ref|XP_003519089.1|  PREDICTED: lysosomal beta glucosidase-like       92.0    2e-23   
ref|NP_001130296.1|  exoglucanase1 precursor                          96.7    2e-23   Zea mays [maize]
ref|XP_004242118.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    2e-23   
gb|EYU18175.1|  hypothetical protein MIMGU_mgv1a002782mg              96.3    2e-23   Erythranthe guttata [common monkey flower]
ref|XP_010535771.1|  PREDICTED: lysosomal beta glucosidase-like       92.4    2e-23   Tarenaya hassleriana [spider flower]
ref|XP_008664722.1|  PREDICTED: exoglucanase1 isoform X2              96.7    2e-23   Zea mays [maize]
gb|EMT13488.1|  Lysosomal beta glucosidase                            94.0    2e-23   
gb|AEP33577.1|  b-1,4-glucanase                                       98.2    2e-23   Gossypium davidsonii
ref|XP_010677827.1|  PREDICTED: lysosomal beta glucosidase-like       95.1    2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011044008.1|  PREDICTED: lysosomal beta glucosidase-like       94.0    2e-23   Populus euphratica
ref|XP_010054740.1|  PREDICTED: lysosomal beta glucosidase-like       95.5    2e-23   Eucalyptus grandis [rose gum]
ref|XP_002325849.2|  beta-D-glucan exohydrolase family protein        94.4    2e-23   
gb|AAC49170.1|  beta-D-glucan exohydrolase, isoenzyme ExoII           94.7    2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002319151.2|  beta-D-glucan exohydrolase family protein        94.0    2e-23   Populus trichocarpa [western balsam poplar]
gb|AAS97960.1|  cell wall beta-glucosidase                            96.3    2e-23   Secale cereale
gb|ABK95015.1|  unknown                                               94.4    2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006371173.1|  hypothetical protein POPTR_0019s05340g           94.4    2e-23   Populus trichocarpa [western balsam poplar]
gb|KHN46759.1|  Lysosomal beta glucosidase                            92.8    2e-23   Glycine soja [wild soybean]
ref|XP_003559563.1|  PREDICTED: lysosomal beta glucosidase-like       94.0    2e-23   Brachypodium distachyon [annual false brome]
ref|XP_003548467.1|  PREDICTED: lysosomal beta glucosidase-like i...  92.8    2e-23   
ref|XP_008385600.1|  PREDICTED: lysosomal beta glucosidase-like       90.5    3e-23   
gb|EMS60525.1|  Lysosomal beta glucosidase                            94.0    3e-23   Triticum urartu
ref|XP_006367581.1|  PREDICTED: lysosomal beta glucosidase-like       95.5    3e-23   Solanum tuberosum [potatoes]
ref|XP_011648555.1|  PREDICTED: lysosomal beta glucosidase-like       91.7    3e-23   Cucumis sativus [cucumbers]
gb|ACR36695.1|  unknown                                               95.9    3e-23   Zea mays [maize]
gb|EMT00661.1|  Lysosomal beta glucosidase                            95.5    4e-23   
ref|XP_004970125.1|  PREDICTED: lysosomal beta glucosidase-like       96.3    4e-23   Setaria italica
ref|XP_006361125.1|  PREDICTED: lysosomal beta glucosidase-like       92.0    4e-23   Solanum tuberosum [potatoes]
gb|AEP33582.1|  b-1,4-glucanase                                       96.3    4e-23   Gossypium trilobum
gb|AAF79936.1|  exoglucanase precursor                                96.7    4e-23   Zea mays [maize]
ref|XP_009801866.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.4    4e-23   Nicotiana sylvestris
ref|XP_009801863.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.0    5e-23   Nicotiana sylvestris
ref|XP_002523937.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  94.0    5e-23   Ricinus communis
ref|XP_012070425.1|  PREDICTED: lysosomal beta glucosidase-like       93.6    5e-23   Jatropha curcas
ref|XP_008791332.1|  PREDICTED: uncharacterized protein LOC103708265  95.1    5e-23   
gb|KJB44566.1|  hypothetical protein B456_007G260100                  92.4    5e-23   Gossypium raimondii
ref|XP_011094172.1|  PREDICTED: lysosomal beta glucosidase-like i...  92.4    5e-23   Sesamum indicum [beniseed]
ref|XP_010917875.1|  PREDICTED: lysosomal beta glucosidase-like i...  93.2    5e-23   Elaeis guineensis
ref|XP_010917877.1|  PREDICTED: lysosomal beta glucosidase-like i...  93.2    5e-23   
gb|AEP33580.1|  b-1,4-glucanase                                       96.3    5e-23   Gossypium gossypioides
gb|AEP33563.1|  b-1,4-glucanase                                       96.3    5e-23   Gossypium turneri
ref|XP_004952003.1|  PREDICTED: lysosomal beta glucosidase-like       94.4    5e-23   Setaria italica
gb|AAL58976.1|AC091811_25  putative exohydrolase                      94.4    5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AEP33579.1|  b-1,4-glucanase                                       96.3    5e-23   Gossypium aridum
gb|AEP33560.1|  b-1,4-glucanase                                       96.3    5e-23   Gossypium thurberi
ref|XP_006651822.1|  PREDICTED: lysosomal beta glucosidase-like       95.1    5e-23   
gb|AEP33562.1|  b-1,4-glucanase                                       96.3    5e-23   Gossypium schwendimanii
gb|ADZ16110.1|  endo-alpha-1,4-glucanase                              96.3    6e-23   Gossypium raimondii
ref|XP_004981774.1|  PREDICTED: lysosomal beta glucosidase-like i...  95.9    6e-23   
gb|AAR14129.1|  exo-beta-glucanase                                    95.9    6e-23   Lilium longiflorum [Easter lily]
ref|NP_001051277.1|  Os03g0749500                                     94.0    6e-23   
dbj|BAD13764.1|  exo-1,3-beta-glucanase                               96.3    6e-23   Lilium longiflorum [Easter lily]
ref|XP_008672746.1|  PREDICTED: uncharacterized protein LOC100280...  95.1    6e-23   
gb|AAM13694.1|  beta-D-glucan exohydrolase                            94.7    6e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006604246.1|  PREDICTED: lysosomal beta glucosidase-like i...  93.6    6e-23   Glycine max [soybeans]
ref|XP_004137360.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    6e-23   Cucumis sativus [cucumbers]
gb|KHN34681.1|  Lysosomal beta glucosidase                            93.6    6e-23   Glycine soja [wild soybean]
ref|XP_011094173.1|  PREDICTED: lysosomal beta glucosidase-like i...  92.0    6e-23   Sesamum indicum [beniseed]
gb|AEP33567.1|  b-1,4-glucanase                                       96.3    7e-23   Gossypium darwinii
gb|KJB80779.1|  hypothetical protein B456_013G114800                  95.9    7e-23   Gossypium raimondii
tpg|DAA57426.1|  TPA: hypothetical protein ZEAMMB73_853432            95.1    7e-23   
ref|XP_011089012.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    7e-23   
ref|XP_004981777.1|  PREDICTED: lysosomal beta glucosidase-like       91.7    7e-23   Setaria italica
ref|XP_012066314.1|  PREDICTED: lysosomal beta glucosidase-like       92.0    7e-23   Jatropha curcas
gb|AEP33561.1|  b-1,4-glucanase                                       96.3    7e-23   Gossypium laxum
ref|NP_197594.2|  glycosyl hydrolase family protein                   94.7    7e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42928.1|  hypothetical protein JCGZ_23870                       92.0    7e-23   Jatropha curcas
ref|XP_006361124.1|  PREDICTED: lysosomal beta glucosidase-like       92.4    8e-23   
gb|KJB80777.1|  hypothetical protein B456_013G114800                  95.9    8e-23   
ref|XP_007161964.1|  hypothetical protein PHAVU_001G112600g           93.2    8e-23   
gb|KFK26306.1|  hypothetical protein AALP_AA8G230300                  89.4    8e-23   
gb|KFK26305.1|  hypothetical protein AALP_AA8G230300                  89.7    8e-23   
gb|EMS53505.1|  Lysosomal beta glucosidase                            97.1    8e-23   
gb|KJB80775.1|  hypothetical protein B456_013G114800                  95.9    8e-23   
ref|XP_011100592.1|  PREDICTED: lysosomal beta glucosidase-like       95.9    8e-23   
ref|XP_004489701.1|  PREDICTED: lysosomal beta glucosidase-like       97.8    9e-23   
gb|KJB80774.1|  hypothetical protein B456_013G114800                  95.5    9e-23   
ref|XP_004241371.1|  PREDICTED: lysosomal beta glucosidase-like       92.4    1e-22   
ref|XP_011101353.1|  PREDICTED: lysosomal beta glucosidase-like       95.9    1e-22   
ref|XP_011094168.1|  PREDICTED: lysosomal beta glucosidase-like       92.0    1e-22   
ref|XP_004489688.1|  PREDICTED: lysosomal beta glucosidase-like       97.4    1e-22   
dbj|BAD95001.1|  beta-D-glucan exohydrolase-like protein              89.0    1e-22   
ref|XP_011032946.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    1e-22   
ref|XP_002311926.2|  beta-D-glucan exohydrolase family protein        94.7    1e-22   
dbj|BAJ88993.1|  predicted protein                                    95.5    1e-22   
ref|NP_001146552.1|  uncharacterized protein LOC100280148             94.4    1e-22   
gb|EMT27147.1|  Periplasmic beta-glucosidase                          90.9    1e-22   
ref|XP_004296272.2|  PREDICTED: lysosomal beta glucosidase-like       93.2    1e-22   
gb|EEE56242.1|  hypothetical protein OsJ_05253                        90.5    1e-22   
gb|AEP33565.1|  b-1,4-glucanase                                       94.7    2e-22   
ref|XP_010550691.1|  PREDICTED: lysosomal beta glucosidase-like       93.2    2e-22   
ref|XP_010696623.1|  PREDICTED: lysosomal beta glucosidase-like       89.4    2e-22   
dbj|BAD07748.1|  putative beta-D-glucan exohydrolase                  90.1    2e-22   
ref|NP_001045791.2|  Os02g0131400                                     90.1    2e-22   
ref|XP_003559555.1|  PREDICTED: lysosomal beta glucosidase-like       90.9    2e-22   
ref|XP_012066396.1|  PREDICTED: wall-associated receptor kinase 4...  92.0    2e-22   
ref|XP_009395658.1|  PREDICTED: lysosomal beta glucosidase-like       90.9    2e-22   
emb|CDY09090.1|  BnaA02g05160D                                        88.2    2e-22   
ref|XP_004493183.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.4    2e-22   
gb|AEP33568.1|  b-1,4-glucanase                                       95.5    2e-22   
gb|ADZ16108.1|  endo-alpha-1,4-glucanase                              95.5    2e-22   
gb|KEH25597.1|  beta-D-glucoside glucohydrolase                       96.3    2e-22   
emb|CDP15622.1|  unnamed protein product                              87.0    2e-22   
ref|XP_009126493.1|  PREDICTED: lysosomal beta glucosidase-like       87.8    2e-22   
gb|AAZ15705.1|  endo-alpha-1,4-glucanase                              95.5    2e-22   
ref|XP_004493184.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.4    2e-22   
emb|CDM84404.1|  unnamed protein product                              94.7    2e-22   
ref|XP_006340437.1|  PREDICTED: lysosomal beta glucosidase-like       88.6    2e-22   
gb|KEH25593.1|  beta-D-glucoside glucohydrolase                       94.7    3e-22   
ref|XP_004493185.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.4    3e-22   
gb|KEH23536.1|  beta-D-glucoside glucohydrolase                       94.4    3e-22   
gb|KHN20835.1|  Lysosomal beta glucosidase                            93.6    3e-22   
gb|KHG06450.1|  gluA                                                  95.5    3e-22   
ref|XP_004493181.1|  PREDICTED: lysosomal beta glucosidase-like i...  94.0    3e-22   
gb|KDP42940.1|  hypothetical protein JCGZ_23882                       93.6    3e-22   
ref|XP_003551104.1|  PREDICTED: lysosomal beta glucosidase-like       93.6    3e-22   
ref|XP_010034245.1|  PREDICTED: lysosomal beta glucosidase-like       96.7    3e-22   
ref|XP_009396473.1|  PREDICTED: lysosomal beta glucosidase-like       92.8    3e-22   
gb|KHG06451.1|  gluA                                                  95.5    3e-22   
ref|XP_003624652.1|  Periplasmic beta-glucosidase                     94.4    3e-22   
gb|KCW50974.1|  hypothetical protein EUGRSUZ_J00603                   96.7    3e-22   
emb|CDY68165.1|  BnaUnng02770D                                        87.4    4e-22   
ref|XP_010034246.1|  PREDICTED: lysosomal beta glucosidase-like       94.7    4e-22   
gb|EPS57810.1|  hypothetical protein M569_17006                       89.7    4e-22   
gb|KEH25596.1|  beta-D-glucoside glucohydrolase                       96.7    4e-22   
gb|KCW50975.1|  hypothetical protein EUGRSUZ_J00604                   94.7    4e-22   
ref|XP_004954723.1|  PREDICTED: lysosomal beta glucosidase-like       90.5    4e-22   
ref|XP_008648088.1|  PREDICTED: LOC541703 isoform X2                  93.2    4e-22   
ref|XP_008453517.1|  PREDICTED: lysosomal beta glucosidase-like       94.0    4e-22   
tpg|DAA51354.1|  TPA: exhydrolase II                                  93.2    4e-22   
ref|XP_006388312.1|  hypothetical protein POPTR_0231s00220g           90.5    4e-22   
ref|XP_007015581.1|  Glycosyl hydrolase family protein                93.6    4e-22   
ref|NP_001104913.1|  LOC541703 precursor                              93.2    4e-22   
ref|XP_006826367.2|  PREDICTED: lysosomal beta glucosidase            91.7    4e-22   
tpg|DAA51353.1|  TPA: exhydrolase II                                  93.2    4e-22   
tpg|DAA51355.1|  TPA: hypothetical protein ZEAMMB73_928187            93.2    4e-22   
gb|ERM93604.1|  hypothetical protein AMTR_s00004p00129620             91.7    4e-22   
ref|XP_008648090.1|  PREDICTED: LOC541703 isoform X1                  93.2    4e-22   
gb|AEP33574.1|  b-1,4-glucanase                                       94.7    5e-22   
ref|XP_010694376.1|  PREDICTED: lysosomal beta glucosidase              105   5e-22   
ref|XP_007161966.1|  hypothetical protein PHAVU_001G112700g           92.0    5e-22   
ref|XP_004952004.1|  PREDICTED: lysosomal beta glucosidase-like       90.9    6e-22   
ref|XP_010313613.1|  PREDICTED: lysosomal beta glucosidase-like       89.0    6e-22   
gb|EPS69367.1|  hypothetical protein M569_05399                       88.6    7e-22   
gb|KEH25595.1|  beta-D-glucoside glucohydrolase                       96.7    7e-22   
ref|XP_009400035.1|  PREDICTED: lysosomal beta glucosidase-like       89.7    7e-22   
ref|XP_004981770.1|  PREDICTED: lysosomal beta glucosidase-like i...  91.7    8e-22   
emb|CDP15625.1|  unnamed protein product                              89.0    8e-22   
ref|XP_009412936.1|  PREDICTED: lysosomal beta glucosidase-like       92.4    8e-22   
ref|XP_004981769.1|  PREDICTED: lysosomal beta glucosidase-like i...  91.7    8e-22   
ref|XP_004981771.1|  PREDICTED: lysosomal beta glucosidase-like i...  91.7    8e-22   
ref|XP_004981768.1|  PREDICTED: lysosomal beta glucosidase-like i...  91.7    9e-22   
gb|KJB55533.1|  hypothetical protein B456_009G081100                  90.1    1e-21   
gb|KDO54374.1|  hypothetical protein CISIN_1g038523mg                 89.0    1e-21   
ref|XP_011090231.1|  PREDICTED: lysosomal beta glucosidase-like       89.0    1e-21   
ref|XP_006424026.1|  hypothetical protein CICLE_v10030270mg           89.0    1e-21   
ref|XP_006487879.1|  PREDICTED: lysosomal beta glucosidase-like       89.0    1e-21   
gb|EYU38727.1|  hypothetical protein MIMGU_mgv1a003439mg              90.9    1e-21   
ref|NP_001051274.1|  Os03g0749100                                     90.5    1e-21   
ref|XP_002271545.1|  PREDICTED: lysosomal beta glucosidase            90.9    1e-21   
gb|KHG30203.1|  Lysosomal beta glucosidase                            91.3    1e-21   
gb|EAY91867.1|  hypothetical protein OsI_13514                        90.5    1e-21   
gb|EPS64616.1|  hypothetical protein M569_10162                       90.5    1e-21   
emb|CBI27259.3|  unnamed protein product                              90.5    1e-21   
gb|EMT23539.1|  Lysosomal beta glucosidase                            90.9    2e-21   
ref|XP_004971583.1|  PREDICTED: lysosomal beta glucosidase-like       87.8    2e-21   
gb|KJB09176.1|  hypothetical protein B456_001G127600                  92.8    2e-21   
dbj|BAJ97948.1|  predicted protein                                    94.0    2e-21   
gb|ABK24242.1|  unknown                                               90.5    2e-21   
ref|XP_009620993.1|  PREDICTED: lysosomal beta glucosidase-like       85.9    2e-21   
ref|XP_004489700.1|  PREDICTED: lysosomal beta glucosidase-like       95.5    2e-21   
ref|XP_009786310.1|  PREDICTED: lysosomal beta glucosidase-like       85.9    2e-21   
gb|KEH25594.1|  beta-D-glucoside glucohydrolase                       97.4    2e-21   
dbj|BAA33065.1|  beta-D-glucan exohydrolase                           85.5    3e-21   
ref|XP_009368884.1|  PREDICTED: lysosomal beta glucosidase-like       83.6    3e-21   
ref|XP_009412935.1|  PREDICTED: lysosomal beta glucosidase-like       89.7    3e-21   
ref|XP_010086714.1|  Lysosomal beta glucosidase                       95.1    3e-21   
ref|XP_004300933.2|  PREDICTED: lysosomal beta glucosidase-like i...  85.5    3e-21   
gb|AEP33566.1|  b-1,4-glucanase                                       91.7    3e-21   
ref|XP_011464064.1|  PREDICTED: lysosomal beta glucosidase-like i...  85.5    3e-21   
emb|CDP15623.1|  unnamed protein product                              93.2    3e-21   
ref|XP_003559419.1|  PREDICTED: lysosomal beta glucosidase-like       91.3    3e-21   
ref|XP_007208726.1|  hypothetical protein PRUPE_ppa015239mg           84.0    4e-21   
gb|EYU38726.1|  hypothetical protein MIMGU_mgv1a002845mg              89.7    4e-21   
ref|XP_009394272.1|  PREDICTED: lysosomal beta glucosidase-like       89.7    4e-21   
ref|XP_009395659.1|  PREDICTED: lysosomal beta glucosidase-like       91.7    4e-21   
gb|EYU25636.1|  hypothetical protein MIMGU_mgv1a002814mg              89.7    6e-21   
ref|XP_010034247.1|  PREDICTED: lysosomal beta glucosidase-like       90.5    6e-21   
gb|ERM93605.1|  hypothetical protein AMTR_s00004p00130660             89.0    7e-21   
gb|ACN25332.1|  unknown                                               93.6    7e-21   
ref|XP_004251206.1|  PREDICTED: lysosomal beta glucosidase isofor...  84.7    9e-21   
ref|XP_010313472.1|  PREDICTED: lysosomal beta glucosidase isofor...  84.7    9e-21   
ref|XP_010553801.1|  PREDICTED: lysosomal beta glucosidase-like       87.4    1e-20   
ref|XP_010313473.1|  PREDICTED: lysosomal beta glucosidase isofor...  84.7    1e-20   
pdb|3WLT|A  Chain A, Crystal Structure Analysis Of Plant Exohydro...  90.5    1e-20   
pdb|3WLQ|A  Chain A, Crystal Structure Analysis Of Plant Exohydro...  90.5    1e-20   
gb|ADC55526.1|  beta-D-glucan glucohydrolase precursor                90.5    1e-20   
pdb|3WLI|A  Chain A, Crystal Structure Analysis Of Plant Exohydro...  90.5    1e-20   
dbj|BAJ96045.1|  predicted protein                                    90.5    1e-20   
gb|EPS62891.1|  hypothetical protein M569_11897                       90.5    1e-20   
ref|XP_010034248.1|  PREDICTED: lysosomal beta glucosidase-like       89.4    1e-20   
dbj|BAK05680.1|  predicted protein                                    90.5    1e-20   
pdb|1EX1|A  Chain A, Beta-D-Glucan Exohydrolase From Barley           90.5    1e-20   
gb|AAD23382.1|AF102868_1  beta-D-glucan exohydrolase isoenzyme ExoI   90.5    1e-20   
pdb|1LQ2|A  Chain A, Crystal Structure Of Barley Beta-D-Glucan Gl...  90.5    1e-20   
ref|XP_008679988.1|  PREDICTED: lysosomal beta glucosidase-like i...  84.7    2e-20   
dbj|BAC42711.1|  unknown protein                                      81.3    2e-20   
gb|AFW66696.1|  hypothetical protein ZEAMMB73_778261                  84.3    2e-20   
ref|XP_008679990.1|  PREDICTED: lysosomal beta glucosidase-like i...  84.3    2e-20   
ref|NP_680141.2|  Glycosyl hydrolase family protein                   81.3    2e-20   
ref|XP_010651644.1|  PREDICTED: lysosomal beta glucosidase-like       86.7    2e-20   
emb|CAN63654.1|  hypothetical protein VITISV_027177                   86.3    2e-20   
ref|XP_006287219.1|  hypothetical protein CARUB_v10000396mg           82.8    2e-20   
emb|CBI24413.3|  unnamed protein product                              86.3    3e-20   
ref|XP_010491016.1|  PREDICTED: lysosomal beta glucosidase-like       82.0    5e-20   
ref|XP_010423523.1|  PREDICTED: lysosomal beta glucosidase-like i...  82.0    5e-20   
ref|XP_006340297.1|  PREDICTED: lysosomal beta glucosidase-like       84.7    5e-20   
ref|XP_010423522.1|  PREDICTED: lysosomal beta glucosidase-like i...  82.0    6e-20   
ref|XP_002871119.1|  glycosyl hydrolase family 3 protein              81.3    7e-20   
emb|CBI24414.3|  unnamed protein product                              90.5    7e-20   
emb|CDY11314.1|  BnaA03g01500D                                        81.3    8e-20   
ref|XP_006826369.1|  PREDICTED: lysosomal beta glucosidase            83.2    1e-19   
emb|CAN72380.1|  hypothetical protein VITISV_007501                   90.1    1e-19   
ref|XP_001761531.1|  predicted protein                                80.1    2e-19   
ref|XP_009130844.1|  PREDICTED: lysosomal beta glucosidase-like       81.6    2e-19   
gb|EPS58072.1|  exo-beta-glucanase                                    82.0    2e-19   
ref|XP_010452390.1|  PREDICTED: lysosomal beta glucosidase-like       79.3    3e-19   
ref|XP_002466456.1|  hypothetical protein SORBIDRAFT_01g008050        96.7    4e-19   
ref|XP_006485566.1|  PREDICTED: lysosomal beta glucosidase-like       80.5    4e-19   
gb|EMS62631.1|  Lysosomal beta glucosidase                            80.9    4e-19   
ref|XP_002985402.1|  hypothetical protein SELMODRAFT_157260           79.7    4e-19   
ref|XP_002987109.1|  hypothetical protein SELMODRAFT_125622           79.7    4e-19   
emb|CDX80926.1|  BnaC03g01800D                                        79.0    4e-19   
ref|XP_006445678.1|  hypothetical protein CICLE_v100182711mg          80.1    6e-19   
ref|XP_002960733.1|  hypothetical protein SELMODRAFT_74114            83.2    6e-19   
ref|XP_002983938.1|  hypothetical protein SELMODRAFT_119324           83.2    7e-19   
ref|XP_010473764.1|  PREDICTED: lysosomal beta glucosidase-like       82.4    7e-19   
emb|CDY25116.1|  BnaC06g18580D                                        79.0    8e-19   
ref|XP_006485565.1|  PREDICTED: lysosomal beta glucosidase-like       79.0    8e-19   
ref|XP_006445675.1|  hypothetical protein CICLE_v10017853mg           79.0    9e-19   
ref|XP_010418561.1|  PREDICTED: probable beta-glucosidase J           81.6    1e-18   
emb|CDX67902.1|  BnaA07g19420D                                        77.8    2e-18   
ref|NP_001105671.1|  beta-glucanase precursor                         94.7    2e-18   
gb|AFW67621.1|  hypothetical protein ZEAMMB73_646186                  94.7    2e-18   
ref|XP_006398941.1|  hypothetical protein EUTSA_v10012900mg           77.4    2e-18   
ref|XP_006292741.1|  hypothetical protein CARUB_v10018993mg           80.1    2e-18   
ref|XP_010512667.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...  80.5    3e-18   
ref|XP_010495552.1|  PREDICTED: lysosomal beta glucosidase-like       75.9    3e-18   
ref|XP_001777176.1|  predicted protein                                84.0    6e-18   
ref|XP_010423524.1|  PREDICTED: lysosomal beta glucosidase-like i...  75.1    6e-18   
ref|XP_009105551.1|  PREDICTED: lysosomal beta glucosidase-like       79.0    6e-18   
ref|XP_001786487.1|  predicted protein                                80.5    6e-18   
ref|XP_006402350.1|  hypothetical protein EUTSA_v10005832mg           77.8    7e-18   
ref|XP_010545174.1|  PREDICTED: lysosomal beta glucosidase            78.6    8e-18   
ref|XP_006650588.1|  PREDICTED: lysosomal beta glucosidase-like       92.4    9e-18   
ref|XP_010525248.1|  PREDICTED: lysosomal beta glucosidase-like       79.0    1e-17   
emb|CDX70189.1|  BnaA10g25380D                                        73.2    2e-17   
gb|KFK35444.1|  hypothetical protein AALP_AA5G285000                  79.0    2e-17   
ref|XP_008644501.1|  PREDICTED: lysosomal beta glucosidase-like i...  90.9    3e-17   
ref|XP_008644502.1|  PREDICTED: lysosomal beta glucosidase-like i...  90.9    3e-17   
ref|XP_010229891.1|  PREDICTED: lysosomal beta glucosidase-like i...  84.0    4e-17   
ref|XP_003559552.1|  PREDICTED: lysosomal beta glucosidase-like i...  84.0    4e-17   
emb|CDX98794.1|  BnaC09g50410D                                        71.6    5e-17   
ref|NP_191830.1|  glycosyl hydrolase family protein                   75.5    9e-17   
gb|ERN11077.1|  hypothetical protein AMTR_s00024p00127950             79.7    1e-16   
ref|XP_001781708.1|  predicted protein                                77.8    2e-16   
ref|XP_002878473.1|  glycosyl hydrolase family 3 protein              74.7    2e-16   
ref|XP_011625348.1|  PREDICTED: lysosomal beta glucosidase            79.3    2e-16   
ref|XP_008230844.1|  PREDICTED: uncharacterized protein LOC103330075  68.2    2e-16   
ref|XP_009138723.1|  PREDICTED: lysosomal beta glucosidase            77.4    2e-16   
emb|CDX89145.1|  BnaA04g00410D                                        77.4    2e-16   
emb|CDY70824.1|  BnaC04g55020D                                        77.0    3e-16   
ref|XP_006848113.1|  PREDICTED: lysosomal beta glucosidase            77.4    1e-15   
ref|XP_010686158.1|  PREDICTED: lysosomal beta glucosidase-like       80.1    1e-15   
ref|XP_009346882.1|  PREDICTED: lysosomal beta glucosidase-like       74.3    2e-15   
ref|XP_012068057.1|  PREDICTED: lysosomal beta glucosidase-like       75.5    3e-15   
ref|XP_006290765.1|  hypothetical protein CARUB_v10016871mg           73.9    7e-15   
ref|XP_009337307.1|  PREDICTED: lysosomal beta glucosidase-like       74.3    7e-15   
ref|XP_008366240.1|  PREDICTED: lysosomal beta glucosidase-like i...  74.3    8e-15   
ref|XP_009346879.1|  PREDICTED: lysosomal beta glucosidase-like i...  73.9    1e-14   
gb|AFG71455.1|  hypothetical protein 0_10642_01                       70.9    2e-14   
gb|AFG71444.1|  hypothetical protein 0_10642_01                       70.9    2e-14   
gb|KHF98973.1|  Lysosomal beta glucosidase                            73.6    2e-14   
gb|AFG71445.1|  hypothetical protein 0_10642_01                       70.9    2e-14   
ref|XP_010253611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  83.2    2e-14   
emb|CDX86119.1|  BnaC03g56340D                                        72.0    2e-14   
ref|XP_007220051.1|  hypothetical protein PRUPE_ppa026252mg           71.2    2e-14   
gb|KJB83715.1|  hypothetical protein B456_013G260700                  72.8    2e-14   



>gb|EYU26866.1| hypothetical protein MIMGU_mgv1a002476mg [Erythranthe guttata]
Length=668

 Score =   125 bits (315),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + VTDVLFGDYGFTGKL +TWF++VDQLPMNVGD HYDPLFPFGFGLTT + VAR  S G
Sbjct  584  QGVTDVLFGDYGFTGKLPRTWFRSVDQLPMNVGDSHYDPLFPFGFGLTTKTMVARSVSAG  643

Query  480  VDKRPYFFAIALSVFIGLYFQVI  412
            +D RPY   + + +F GLYFQ I
Sbjct  644  IDGRPYIAFVVIFLFAGLYFQGI  666


 Score = 43.9 bits (102),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  563  IEPYMSVIDALVAAWLPGTEGQG  585



>ref|XP_011087395.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=700

 Score =   128 bits (321),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -3

Query  654  VTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGGVD  475
            VTDVLFGDYGFTGKL +TWFKTV+QLPMNVGD HYDPLFPFGFGLTT + VAR  S GV 
Sbjct  581  VTDVLFGDYGFTGKLPRTWFKTVNQLPMNVGDSHYDPLFPFGFGLTTKTMVARSVSAGVR  640

Query  474  KRPYFFAIALSVFIGLYFQVIKRRELRSWERIINPSRFISSHLFNNF  334
            +  Y   + + +F+GLYFQV + +  RS   +    R++SS L N+F
Sbjct  641  RAAYVPIVMVFLFVGLYFQVKRTKLSRSPASLF--PRWVSSFLLNHF  685


 Score = 41.2 bits (95),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+S+IDALVAAWLPGTEG G
Sbjct  560  PYMSTIDALVAAWLPGTEGLG  580



>ref|XP_004230073.1| PREDICTED: lysosomal beta glucosidase [Solanum lycopersicum]
Length=662

 Score =   123 bits (308),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN-SSVAR-VAS  487
            + +TD+LFGDYGFTGKL +TWF+TV+QLPMNVGD HYDPLFPFGFGLTT+ S++AR V++
Sbjct  575  QGITDLLFGDYGFTGKLPRTWFRTVNQLPMNVGDPHYDPLFPFGFGLTTSKSTIARSVSA  634

Query  486  GGVDKRPYFFAIALSVFIGLYFQVI  412
            G  D+RPY   I +SV IGLY Q +
Sbjct  635  GAADERPYVLGIMVSVIIGLYIQCL  659


 Score = 42.7 bits (99),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+ SIDALVAAWLPGTEGQG
Sbjct  556  PYLPSIDALVAAWLPGTEGQG  576



>ref|XP_006347719.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
tuberosum]
Length=662

 Score =   124 bits (310),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN-SSVAR-VAS  487
            + +TD+LFGDYGFTGKL +TWF+TVDQLPMNVGD HYDPLFPFGFGLTT+ S++AR V++
Sbjct  575  QGITDLLFGDYGFTGKLPRTWFRTVDQLPMNVGDPHYDPLFPFGFGLTTSKSTIARSVSA  634

Query  486  GGVDKRPYFFAIALSVFIGLYFQV  415
            G  D+RPY   I +SV IGLY Q 
Sbjct  635  GAADERPYVLGIMVSVIIGLYIQC  658


 Score = 41.6 bits (96),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            P++ SIDALVAAWLPGTEGQG
Sbjct  556  PFLPSIDALVAAWLPGTEGQG  576



>emb|CBI24995.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   121 bits (304),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + +TDVLFGDYGF+GKLS+TWFK VDQLPMNVGD HYDPLFPFGFGL T + VAR  S G
Sbjct  535  QGLTDVLFGDYGFSGKLSRTWFKNVDQLPMNVGDSHYDPLFPFGFGLATKTVVARSTSAG  594

Query  480  VDKRPYFFAIALSVFIGLYFQV  415
            V  RP+ F I   VFI LY  +
Sbjct  595  VGGRPHLFTIMAMVFISLYLGI  616


 Score = 43.5 bits (101),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  514  IEPYMSLIDALVAAWLPGTEGQG  536



>ref|XP_002262992.1| PREDICTED: lysosomal beta glucosidase [Vitis vinifera]
Length=658

 Score =   121 bits (303),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + +TDVLFGDYGF+GKLS+TWFK VDQLPMNVGD HYDPLFPFGFGL T + VAR  S G
Sbjct  574  QGLTDVLFGDYGFSGKLSRTWFKNVDQLPMNVGDSHYDPLFPFGFGLATKTVVARSTSAG  633

Query  480  VDKRPYFFAIALSVFIGLYFQV  415
            V  RP+ F I   VFI LY  +
Sbjct  634  VGGRPHLFTIMAMVFISLYLGI  655


 Score = 43.5 bits (101),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  553  IEPYMSLIDALVAAWLPGTEGQG  575



>ref|XP_009595456.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=661

 Score =   120 bits (302),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGL-TTNSSVARVASG  484
            + +TD+LFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGL T+ S+VAR  S 
Sbjct  575  QGITDLLFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKSTVARSVSS  634

Query  483  GVDKRPYFFAIALSVFIGLY  424
            G   +PY F I +SVFIGL+
Sbjct  635  GAAGKPYVFGIMVSVFIGLW  654


 Score = 42.4 bits (98),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDALVAAWLPG+EGQG
Sbjct  554  IEPYLPSIDALVAAWLPGSEGQG  576



>ref|XP_009799725.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009799726.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=661

 Score =   120 bits (302),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGL-TTNSSVARVASG  484
            + +TD+LFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGL T+ S+VAR  S 
Sbjct  575  QGITDILFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKSTVARSVSS  634

Query  483  GVDKRPYFFAIALSVFIGLY  424
            G   +PY F I +SVFIGL+
Sbjct  635  GAVGKPYVFGIMVSVFIGLW  654


 Score = 42.4 bits (98),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDALVAAWLPG+EGQG
Sbjct  554  IEPYLPSIDALVAAWLPGSEGQG  576



>emb|CDP06849.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   114 bits (286),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS-VARVASG  484
            + VTDVLFGDY FTGKL +TWF+T+DQLPMNVGD HYDPLFPFGFGLTT+ S V+R  S 
Sbjct  531  QGVTDVLFGDYEFTGKLPRTWFRTIDQLPMNVGDSHYDPLFPFGFGLTTHQSIVSRSKSS  590

Query  483  GVDKRPYFFAIALSVFIGLYFQ  418
            G    PY   I + V IGLYFQ
Sbjct  591  GFKGHPYATLILIFVLIGLYFQ  612


 Score = 46.6 bits (109),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  510  IEPYISSIDALVAAWLPGTEGQG  532



>ref|XP_007147489.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
 gb|ESW19483.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
Length=661

 Score =   114 bits (285),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPL+PFGFGLTT S    VAR  
Sbjct  577  QGVTDVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLYPFGFGLTTESVKDLVARST  636

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S  +  R   F I +++FI LY 
Sbjct  637  SAAISVRACIFTIMVTLFISLYL  659


 Score = 46.2 bits (108),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  556  IEPYVSTIDALVAAWLPGTEGQG  578



>ref|XP_006445671.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
 ref|XP_006485522.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
 gb|ESR58911.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
Length=659

 Score =   113 bits (283),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGF+GKL ++WFKTVDQLPMNVGD HYDPLFPF FGL T S    VAR  
Sbjct  575  QGVTDVLFGDYGFSGKLPRSWFKTVDQLPMNVGDPHYDPLFPFDFGLKTESVPSIVARST  634

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S GVD +P+ F + +S+   LYF
Sbjct  635  SAGVDGKPFVFLVMISLIFALYF  657


 Score = 46.2 bits (108),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SS+DALVAAWLPGTEGQG
Sbjct  554  IEPYISSVDALVAAWLPGTEGQG  576



>gb|KHN14336.1| Lysosomal beta glucosidase [Glycine soja]
Length=688

 Score =   112 bits (281),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    VAR  
Sbjct  578  QGMTDVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTESVKDLVARST  637

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S  V  R   F I +++ I LY 
Sbjct  638  SAAVGARACIFTIIVTLIISLYL  660


 Score = 46.6 bits (109),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  557  IEPYISSIDALVAAWLPGTEGQG  579



>ref|XP_003546253.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006597657.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=661

 Score =   112 bits (281),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    VAR  
Sbjct  577  QGMTDVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTESVKDLVARST  636

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S  V  R   F I +++ I LY 
Sbjct  637  SAAVGARACIFTIIVTLIISLYL  659


 Score = 46.6 bits (109),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  556  IEPYISSIDALVAAWLPGTEGQG  578



>ref|XP_006445670.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
 gb|ESR58910.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
Length=563

 Score =   113 bits (282),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGF+GKL ++WFKTVDQLPMNVGD HYDPLFPF FGL T S    VAR  
Sbjct  479  QGVTDVLFGDYGFSGKLPRSWFKTVDQLPMNVGDPHYDPLFPFDFGLKTESVPSIVARST  538

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S GVD +P+ F + +S+   LYF
Sbjct  539  SAGVDGKPFVFLVMISLIFALYF  561


 Score = 45.8 bits (107),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SS+DALVAAWLPGTEGQG
Sbjct  458  IEPYISSVDALVAAWLPGTEGQG  480



>gb|KDO48683.1| hypothetical protein CISIN_1g045895mg, partial [Citrus sinensis]
Length=194

 Score =   113 bits (282),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGF+GKL ++WFKTVDQLPMNVGD HYDPLFPF FGL T S    VAR  
Sbjct  111  QGVTDVLFGDYGFSGKLPRSWFKTVDQLPMNVGDPHYDPLFPFDFGLKTESVPSIVARST  170

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S GVD +P+ F + +S+   LYF
Sbjct  171  SAGVDGKPFVFLVMISLIFALYF  193


 Score = 45.8 bits (107),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SS+DALVAAWLPGTEGQG
Sbjct  90   IEPYISSVDALVAAWLPGTEGQG  112



>gb|KHN22996.1| Lysosomal beta glucosidase [Glycine soja]
Length=689

 Score =   107 bits (266),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGFTGKL++TWFK+VDQLPMN GD HYDPLFPFGFGLTT S    VAR  
Sbjct  578  QGVTDVLFGDYGFTGKLARTWFKSVDQLPMNFGDPHYDPLFPFGFGLTTESVKDLVARST  637

Query  489  SGGVDKRPYFFAIALSVFI  433
            S  V  R   F I ++  I
Sbjct  638  SAAVGARACIFTIIVTTLI  656


 Score = 47.4 bits (111),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSIDALVAAWLPGTEGQG
Sbjct  557  IEPYVSSIDALVAAWLPGTEGQG  579



>ref|XP_003535075.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006586833.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=662

 Score =   106 bits (265),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGFTGKL++TWFK+VDQLPMN GD HYDPLFPFGFGLTT S    VAR  
Sbjct  577  QGVTDVLFGDYGFTGKLARTWFKSVDQLPMNFGDPHYDPLFPFGFGLTTESVKDLVARST  636

Query  489  SGGVDKRPYFFAIALSVFI  433
            S  V  R   F I ++  I
Sbjct  637  SAAVGARACIFTIIVTTLI  655


 Score = 47.0 bits (110),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSIDALVAAWLPGTEGQG
Sbjct  556  IEPYVSSIDALVAAWLPGTEGQG  578



>ref|XP_012076264.1| PREDICTED: lysosomal beta glucosidase-like [Jatropha curcas]
 ref|XP_012076265.1| PREDICTED: lysosomal beta glucosidase-like [Jatropha curcas]
 gb|KDP34274.1| hypothetical protein JCGZ_12843 [Jatropha curcas]
Length=660

 Score =   108 bits (269),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN---SSVARVA  490
            + V+DVLFGDYGFTGKLS+TWFK V+QLPMNVGD HYDPLFPFGFGL T    S VAR +
Sbjct  572  QGVSDVLFGDYGFTGKLSRTWFKNVEQLPMNVGDSHYDPLFPFGFGLKTGSVPSVVARSS  631

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S GV  RP   ++ + V   LY 
Sbjct  632  SAGVVGRPSILSVMILVIFCLYI  654


 Score = 45.4 bits (106),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSIDALVAAWLPG+EGQG
Sbjct  551  IEPYVSSIDALVAAWLPGSEGQG  573



>ref|XP_004306422.2| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=715

 Score =   102 bits (255),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVL+G++GF+GKL +TWF++VDQLPMN+GD HYDPLFPFGFGL T S    V R  
Sbjct  630  QGITDVLYGEHGFSGKLPRTWFRSVDQLPMNIGDPHYDPLFPFGFGLETESVKELVTRST  689

Query  489  SGGVDKRPYFFAIALSVFIGLYFQ  418
            S  V +RP+ F +A+++ I L  +
Sbjct  690  SADVFRRPWTFLVAVALIISLRLE  713


 Score = 47.0 bits (110),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSIDALVAAWLPGTEGQG
Sbjct  609  IEPYVSSIDALVAAWLPGTEGQG  631



>ref|XP_010067089.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 ref|XP_010067090.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 gb|KCW65161.1| hypothetical protein EUGRSUZ_G02657 [Eucalyptus grandis]
Length=669

 Score =   102 bits (255),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V DVLFGDYGF+GKL +TWFK+VDQLPMN GDLHYDPLFPF FGL T S    VAR  
Sbjct  577  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNFGDLHYDPLFPFDFGLKTESVPGLVARAT  636

Query  489  SGGVDKRPYFFAIALSVFIGLY  424
            S G D  P    +   + I LY
Sbjct  637  SHGADGGPRLLMVTACLAISLY  658


 Score = 46.6 bits (109),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  556  IEPYISSIDALVAAWLPGTEGQG  578



>ref|XP_006379440.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
 gb|ERP57237.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
Length=654

 Score =   103 bits (256),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V D LFGDYGFTGKL +TWFK VDQLPMNVGD HYDPLFPF FGL T S+   V R  
Sbjct  570  QGVADALFGDYGFTGKLPRTWFKNVDQLPMNVGDPHYDPLFPFDFGLKTKSAPDIVRRST  629

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S G+  RPY   + +SV   L F
Sbjct  630  SAGIIGRPYALFLMVSVIFSLCF  652


 Score = 45.8 bits (107),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  549  IEPYLSSIDALVAAWLPGTEGQG  571



>ref|XP_008375543.1| PREDICTED: lysosomal beta glucosidase [Malus domestica]
Length=658

 Score =   103 bits (257),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL++TWF+TVDQLPMNVGD HYDPLFP G GL T S    VAR  
Sbjct  578  QGITDVLFGDHGFSGKLARTWFRTVDQLPMNVGDSHYDPLFPLGHGLATESVKQLVARST  637

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S G   RP  F + +++ + L
Sbjct  638  SAGAVARPCIFVVVVALILSL  658


 Score = 45.4 bits (106),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  557  IEPYISSIDALVAAWLPGSEGQG  579



>ref|XP_008347332.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Malus domestica]
Length=574

 Score =   102 bits (254),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD GF+GKL +TWF+TVDQLPMNVGD HYDPLFPFGFGL T S    V R  
Sbjct  494  QGITDVLFGDXGFSGKLPRTWFRTVDQLPMNVGDSHYDPLFPFGFGLETESVKELVTRST  553

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + +++ + L
Sbjct  554  SAGVVARPCILIVLVALILSL  574


 Score = 45.4 bits (106),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  473  IEPYISSIDALVAAWLPGSEGQG  495



>ref|XP_008363217.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=703

 Score =   102 bits (253),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD GF+GKL +TWF+TVDQLPMNVGD HYDPLFPFGFGL T S    V R  
Sbjct  605  QGITDVLFGDXGFSGKLPRTWFRTVDQLPMNVGDSHYDPLFPFGFGLETESVKELVTRST  664

Query  489  SGGVDKRPYFFAIALSVFIGLYFQVIKRREL  397
            S GV  RP      L V + L    I  R+L
Sbjct  665  SAGVVARPCI----LIVLVALILSFIVXRKL  691


 Score = 45.1 bits (105),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  584  IEPYISSIDALVAAWLPGSEGQG  606



>gb|KJB60360.1| hypothetical protein B456_009G301800 [Gossypium raimondii]
Length=656

 Score =   100 bits (249),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVL+GDY F+GKL +TWFKTVDQLPMNVGD HYDPLFP GFGL T S    V+R  
Sbjct  571  QGVTDVLYGDYRFSGKLPRTWFKTVDQLPMNVGDSHYDPLFPLGFGLKTESGASIVSRST  630

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S    +RP  F   ++V +  Y 
Sbjct  631  SSATPRRPGLFIFMITVTLSFYI  653


 Score = 45.8 bits (107),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IEPYVSAIDALVAAWLPGTEGQG  572



>ref|XP_004141128.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN59734.1| hypothetical protein Csa_3G842070 [Cucumis sativus]
Length=628

 Score =   101 bits (252),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K ++DVLFGDYGF+GKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTTN
Sbjct  574  KGISDVLFGDYGFSGKLSRTWFKTVDQLPMNVGDAHYDPLFPFGFGLTTN  623


 Score = 44.7 bits (104),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEG+G
Sbjct  553  LQPYISSIDALVAAWLPGTEGKG  575



>ref|XP_009418960.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418961.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418962.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418963.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418964.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418966.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score =   105 bits (263),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + VTDVLFGDYGFTGKLS+TWFK+VDQLPMNVGD+HYDPLFPFGFGLTT  + AR+++
Sbjct  573  QGVTDVLFGDYGFTGKLSRTWFKSVDQLPMNVGDMHYDPLFPFGFGLTTGPTTARLST  630


 Score = 40.0 bits (92),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DAL+AAWLPG+EGQG
Sbjct  552  IEPYVHLMDALIAAWLPGSEGQG  574



>ref|XP_010685489.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=628

 Score =   102 bits (254),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTDVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTTNS+
Sbjct  574  QGVTDVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTNST  625


 Score = 43.9 bits (102),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+++IDALVAAWLPGTEGQG
Sbjct  553  IQPYLATIDALVAAWLPGTEGQG  575



>ref|XP_004135054.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Cucumis sativus]
 gb|KGN52155.1| hypothetical protein Csa_5G612840 [Cucumis sativus]
Length=658

 Score = 99.4 bits (246),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTD L+GD+GF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    VAR  
Sbjct  576  QGVTDALYGDHGFSGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTGSVKDIVARST  635

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S G+   P   A +++V I L  
Sbjct  636  SAGIYGTPSLIA-SIAVAIALCI  657


 Score = 46.6 bits (109),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  555  IEPYISSIDALVAAWLPGTEGQG  577



>gb|EEC71555.1| hypothetical protein OsI_03907 [Oryza sativa Indica Group]
Length=1030

 Score =   107 bits (266),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGDLHYDPLFPFGFGLT NSS
Sbjct  940  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDLHYDPLFPFGFGLTINSS  991


 Score = 39.3 bits (90),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ++ALVAAWLPGTEGQG
Sbjct  919  IEPYLPMMEALVAAWLPGTEGQG  941



>ref|XP_002514453.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF47949.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=648

 Score =   102 bits (254),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVLFGDYGFTGKL +TWFK V+QLPMN+GD HYDPLFPF FG+ T S+   VAR  
Sbjct  572  QGVTDVLFGDYGFTGKLPRTWFKNVEQLPMNIGDSHYDPLFPFDFGIRTKSAPGVVARST  631

Query  489  SGGVDKRPYFFAIAL  445
            S GV +RP+  ++ +
Sbjct  632  STGVIERPHMLSVVV  646


 Score = 43.5 bits (101),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV S+DALVAAWLPGTEGQG
Sbjct  551  IEPYVFSMDALVAAWLPGTEGQG  573



>ref|XP_011655822.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Cucumis sativus]
Length=680

 Score = 99.4 bits (246),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTD L+GD+GF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    VAR  
Sbjct  598  QGVTDALYGDHGFSGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTGSVKDIVARST  657

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S G+   P   A +++V I L  
Sbjct  658  SAGIYGTPSLIA-SIAVAIALCI  679


 Score = 46.6 bits (109),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  577  IEPYISSIDALVAAWLPGTEGQG  599



>ref|XP_011032947.1| PREDICTED: lysosomal beta glucosidase [Populus euphratica]
Length=662

 Score = 99.8 bits (247),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + + D LFGDYGFTGKL +TWFK VDQLPMNVGD HYDPLFPF FGL T  +   V R  
Sbjct  578  QGLADALFGDYGFTGKLPRTWFKNVDQLPMNVGDPHYDPLFPFDFGLKTKPAPDIVRRST  637

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S G+  RPY   + +SV   L F
Sbjct  638  SAGIIGRPYALFLMVSVIFSLCF  660


 Score = 45.8 bits (107),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  557  IEPYLSSIDALVAAWLPGTEGQG  579



>ref|XP_009368627.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score = 98.6 bits (244),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V+DVLFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  577  QGVSDVLFGDYGFTGKLPRTWFKTVDQLPMNVGDAHYDPLFPFGFGLTTD  626


 Score = 47.4 bits (111),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSIDALVAAWLPGTEGQG
Sbjct  556  IEPYVSSIDALVAAWLPGTEGQG  578



>ref|XP_008446716.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Cucumis melo]
Length=777

 Score = 99.0 bits (245),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTD L+GD+GF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    +AR  
Sbjct  695  QGVTDALYGDHGFSGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTGSVKDIIARST  754

Query  489  SGGVDKRPYFFA---IALSVFI  433
            S G+   P   A   +A+++ I
Sbjct  755  SAGIRGTPSLIASIVVAITLCI  776


 Score = 46.6 bits (109),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  674  IEPYISSIDALVAAWLPGTEGQG  696



>ref|XP_011089216.1| PREDICTED: uncharacterized protein LOC105170243 [Sesamum indicum]
Length=1344

 Score =   102 bits (253),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  660   KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVA  490
             + +TDVLFG+YGFTGKL++TWF+TVDQLPMN+GD HYDPLFPFG+GLTTN  + + +
Sbjct  1287  QGITDVLFGEYGFTGKLARTWFRTVDQLPMNIGDPHYDPLFPFGYGLTTNPRLLKAS  1343


 Score = 43.1 bits (100),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724   VXPYVSSIDALVAAWLPGTEGQG  656
             + PY+  IDALVAAWLPGTEGQG
Sbjct  1266  IEPYLEKIDALVAAWLPGTEGQG  1288


 Score =   102 bits (255),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  572  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTT  620


 Score = 41.6 bits (96),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  551  IQPYLPLIDALVAAWLPGTEGQG  573



>ref|XP_008344529.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=533

 Score = 99.4 bits (246),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL +TWF+TVDQLPMNVGD ++DPLFPFGFGL T S    V R  
Sbjct  453  QGITDVLFGDHGFSGKLPRTWFRTVDQLPMNVGDSNHDPLFPFGFGLETESVKELVTRST  512

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + + + + L
Sbjct  513  SAGVVARPCMLIVMVXLILSL  533


 Score = 45.8 bits (107),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  432  IEPYISSIDALVAAWLPGSEGQG  454



>ref|XP_008446717.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Cucumis melo]
Length=658

 Score = 98.6 bits (244),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTD L+GD+GF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT S    +AR  
Sbjct  576  QGVTDALYGDHGFSGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTGSVKDIIARST  635

Query  489  SGGVDKRPYFFA---IALSVFI  433
            S G+   P   A   +A+++ I
Sbjct  636  SAGIRGTPSLIASIVVAITLCI  657


 Score = 46.6 bits (109),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  555  IEPYISSIDALVAAWLPGTEGQG  577



>ref|XP_008240500.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=636

 Score = 99.8 bits (247),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  582  QGVADVLFGDYGFTGKLSRTWFKTVDQLPMNVGDAHYDPLFPFGFGLTTTPT  633


 Score = 45.1 bits (105),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPGTEGQG
Sbjct  561  IQPYVVSIDALVAAWLPGTEGQG  583



>ref|XP_009341596.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase C-like [Pyrus 
x bretschneideri]
Length=360

 Score =   102 bits (253),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL +TWFK VDQLPMNVGD H DPLFPFGFGL T S    V R  
Sbjct  280  QGITDVLFGDHGFSGKLPRTWFKNVDQLPMNVGDSHXDPLFPFGFGLETESVKELVTRST  339

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + +++ +GL
Sbjct  340  SAGVVARPCILIVMVALVLGL  360


 Score = 42.7 bits (99),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSSI ALVAAWLPG+EGQG
Sbjct  259  IEPYVSSIGALVAAWLPGSEGQG  281



>emb|CAN61369.1| hypothetical protein VITISV_011685 [Vitis vinifera]
Length=185

 Score =   101 bits (251),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + +TDVLFGDYGF+GKLS+TWFK VDQLPMNVGD HYDPLFPFGFGLTT + VAR  S
Sbjct  126  QGLTDVLFGDYGFSGKLSRTWFKNVDQLPMNVGDSHYDPLFPFGFGLTTKTVVARYES  183


 Score = 43.5 bits (101),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  105  IEPYMSLIDALVAAWLPGTEGQG  127



>ref|XP_007204092.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
 gb|EMJ05291.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
Length=623

 Score = 99.8 bits (247),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  569  QGVADVLFGDYGFTGKLSRTWFKTVDQLPMNVGDAHYDPLFPFGFGLTTTPT  620


 Score = 44.7 bits (104),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+SIDALV AWLPGTEGQG
Sbjct  548  IQPYVASIDALVTAWLPGTEGQG  570



>ref|XP_008464959.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score = 99.8 bits (247),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K ++DVLFGDYGF+GKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  574  KGISDVLFGDYGFSGKLSRTWFKTVDQLPMNVGDAHYDPLFPFGFGLTTD  623


 Score = 44.7 bits (104),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+SSIDALVAAWLPGTEG+G
Sbjct  555  PYISSIDALVAAWLPGTEGKG  575



>ref|XP_008354865.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Malus domestica]
Length=574

 Score = 98.6 bits (244),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL +TWF+TVDQLPMNVGD ++DPLFPFGFGL T S    V R  
Sbjct  494  QGITDVLFGDHGFSGKLPRTWFRTVDQLPMNVGDSNHDPLFPFGFGLETESVKELVTRST  553

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + + + + L
Sbjct  554  SAGVVARPCMLIVMVVLILSL  574


 Score = 45.4 bits (106),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  473  IEPYISSIDALVAAWLPGSEGQG  495



>ref|XP_007208190.1| hypothetical protein PRUPE_ppa020836mg [Prunus persica]
 gb|EMJ09389.1| hypothetical protein PRUPE_ppa020836mg [Prunus persica]
Length=632

 Score = 97.4 bits (241),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + VTDVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPF FGLTT+S
Sbjct  578  QGVTDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDAHYDPLFPFDFGLTTDS  628


 Score = 46.2 bits (108),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSS+DALVAAWLPGTEGQG
Sbjct  557  IEPYVSSMDALVAAWLPGTEGQG  579



>gb|AAQ17461.1| beta-D-glucosidase [Gossypium hirsutum]
Length=628

 Score = 98.2 bits (243),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V+DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVSDVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  625


 Score = 45.4 bits (106),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P+VSS+DALVAAWLPGTEGQG
Sbjct  553  VQPFVSSVDALVAAWLPGTEGQG  575



>ref|XP_010917928.1| PREDICTED: uncharacterized protein LOC105042425 [Elaeis guineensis]
Length=1310

 Score =   100 bits (248),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660   KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
             + V DVLFGDY F+GKLS+TWFK+VDQLPMNVGD HYDP+FPFGFGLTT  ++A
Sbjct  1256  QGVADVLFGDYAFSGKLSRTWFKSVDQLPMNVGDPHYDPIFPFGFGLTTKPAIA  1309


 Score = 43.5 bits (101),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724   VXPYVSSIDALVAAWLPGTEGQG  656
             + PYV  IDALVAAWLPGTEGQG
Sbjct  1235  IEPYVHMIDALVAAWLPGTEGQG  1257


 Score = 99.0 bits (245),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  575  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTEPANA  628


 Score = 44.3 bits (103),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  554  IEPYINKIDALVAAWLPGTEGQG  576



>emb|CAA07070.1| beta-D-glucosidase [Tropaeolum majus]
Length=654

 Score =   100 bits (249),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTDVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  575  QGVTDVLFGDYGFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGFGLTTKPS  626


 Score = 43.1 bits (100),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPGTEGQG
Sbjct  554  LQPYVSYMDALVAAWLPGTEGQG  576



>ref|XP_007015579.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 ref|XP_007015580.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33198.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33199.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=628

 Score = 97.8 bits (242),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  625


 Score = 45.4 bits (106),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  553  MQPYLSSIDALVAAWLPGTEGQG  575



>ref|XP_007015578.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY33197.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=595

 Score = 97.8 bits (242),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  541  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  592


 Score = 45.4 bits (106),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  520  MQPYLSSIDALVAAWLPGTEGQG  542



>ref|XP_010266636.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=665

 Score = 97.8 bits (242),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTT  622


 Score = 45.1 bits (105),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDALVAAWLPGTEGQG
Sbjct  553  IQPYIDSIDALVAAWLPGTEGQG  575



>ref|XP_010088030.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB31249.1| Lysosomal beta glucosidase [Morus notabilis]
Length=634

 Score = 98.2 bits (243),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKL +TWFKTVDQLPMN GDLHYDPLFPFGFGLTT  + A
Sbjct  580  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNFGDLHYDPLFPFGFGLTTEPTKA  633


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+ IDALVAAWLPGTEGQG
Sbjct  559  IQPYVAQIDALVAAWLPGTEGQG  581



>ref|XP_008230878.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=630

 Score =   100 bits (248),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTDVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  576  QGVTDVLFGDYGFTGKLARTWFKTVDQLPMNVGDQHYDPLFPFGFGLTTKPT  627


 Score = 42.7 bits (99),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DALVAAWLPGTEGQG
Sbjct  555  IQPYLAKVDALVAAWLPGTEGQG  577



>ref|XP_009804819.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009804820.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=634

 Score = 99.0 bits (245),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFGDY FTGKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT     ++AS
Sbjct  576  QGVADVLFGDYEFTGKLSRTWFKTVDQLPMNVGDSHYDPLFPFGFGLTTTKVQDQIAS  633


 Score = 43.9 bits (102),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P++S+IDALVAAWLPGTEGQG
Sbjct  555  VQPHLSNIDALVAAWLPGTEGQG  577



>ref|XP_010908052.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   102 bits (255),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR-VASG  484
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT   VAR  +S 
Sbjct  574  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMVARSSSSA  633

Query  483  GVDKRPYFFAIAL  445
            GV ++  ++ ++L
Sbjct  634  GVGRKDEYWMMSL  646


 Score = 40.0 bits (92),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  553  IEPYVPLMDALVAAWLPGSEGQG  575



>ref|XP_004236622.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
 ref|XP_010319196.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=631

 Score =   100 bits (249),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGDLHYDPLFPFGFGLTT 
Sbjct  578  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTE  627


 Score = 42.4 bits (98),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DALVAAWLPGTEGQG
Sbjct  557  IQPYLAQMDALVAAWLPGTEGQG  579



>ref|XP_003545548.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score = 97.8 bits (242),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN++
Sbjct  574  QGVTDLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNTT  625


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  553  IQPYLSKIDALVAAWLPGTEGQG  575



>ref|XP_003594509.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES64760.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=660

 Score = 98.2 bits (243),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFP+GFGLT+ S    V R  
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPYGFGLTSESVRDLVTRST  635

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S     R     I  ++   LY 
Sbjct  636  STAEFVRACIVTIMATLLTSLYL  658


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  555  IEPYLSSIDALVAAWLPGSEGQG  577



>ref|XP_008231857.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Prunus mume]
Length=688

 Score = 95.9 bits (237),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+ F+GKL +TWF+TVDQLPMN GD HYDPLFP GFG+ T S    V R  
Sbjct  608  QGITDVLFGDHEFSGKLPRTWFRTVDQLPMNFGDPHYDPLFPLGFGIETESIKELVTRST  667

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + L++ + L
Sbjct  668  SDGVVGRPCMLVLVLALILSL  688


 Score = 46.6 bits (109),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  587  IEPYISSIDALVAAWLPGTEGQG  609



>ref|XP_010088029.1| Periplasmic beta-glucosidase [Morus notabilis]
 gb|EXB31248.1| Periplasmic beta-glucosidase [Morus notabilis]
Length=653

 Score = 97.8 bits (242),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL +TWFKTVDQLPMN GDLHYDPLFPFGFGLTT
Sbjct  584  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNAGDLHYDPLFPFGFGLTT  632


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  563  IQPYLSQIDALVAAWLPGTEGQG  585



>ref|XP_010908054.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Elaeis 
guineensis]
Length=614

 Score =   102 bits (255),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR-VASG  484
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT   VAR  +S 
Sbjct  528  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMVARSSSSA  587

Query  483  GVDKRPYFFAIAL  445
            GV ++  ++ ++L
Sbjct  588  GVGRKDEYWMMSL  600


 Score = 40.0 bits (92),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  507  IEPYVPLMDALVAAWLPGSEGQG  529



>gb|KHM99112.1| Lysosomal beta glucosidase [Glycine soja]
Length=586

 Score = 97.8 bits (242),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN++
Sbjct  533  QGVTDLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNTT  584


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  512  IQPYLSKIDALVAAWLPGTEGQG  534



>ref|XP_007010544.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
 gb|EOY19354.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
Length=495

 Score = 96.3 bits (238),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V D L+GDYGF+GKL +TWFKTVDQLPMNV D HYDPLFP GFGL T+S    V+R  
Sbjct  406  QGVIDALYGDYGFSGKLPRTWFKTVDQLPMNVEDSHYDPLFPLGFGLKTDSVASIVSRST  465

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S    + P  F + +++ +  YF
Sbjct  466  SAAALEGPCLFILIITISLSFYF  488


 Score = 46.2 bits (108),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  385  IEPYVSTIDALVAAWLPGTEGQG  407



>ref|XP_008231858.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Prunus mume]
Length=658

 Score = 95.9 bits (237),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+ F+GKL +TWF+TVDQLPMN GD HYDPLFP GFG+ T S    V R  
Sbjct  578  QGITDVLFGDHEFSGKLPRTWFRTVDQLPMNFGDPHYDPLFPLGFGIETESIKELVTRST  637

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + L++ + L
Sbjct  638  SDGVVGRPCMLVLVLALILSL  658


 Score = 46.6 bits (109),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  557  IEPYISSIDALVAAWLPGTEGQG  579



>ref|XP_008347396.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Malus domestica]
Length=670

 Score = 97.4 bits (241),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL +TWF+TVDQLPMNVGD ++DPLFPFGFGL T S    V R  
Sbjct  590  QGITDVLFGDHGFSGKLPRTWFRTVDQLPMNVGDSNHDPLFPFGFGLETESVKELVTRST  649

Query  489  SGGVDKRPYFFAIALSVFIGL  427
            S GV  RP    + + + + L
Sbjct  650  SAGVVARPCMLIVMVVLILSL  670


 Score = 45.1 bits (105),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPG+EGQG
Sbjct  569  IEPYISSIDALVAAWLPGSEGQG  591



>ref|XP_002874024.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50283.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=630

 Score = 97.1 bits (240),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPL+PFGFGL TN
Sbjct  579  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLYPFGFGLITN  628


 Score = 45.4 bits (106),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S+IDALVAAWLPGTEGQG
Sbjct  558  MQPYISNIDALVAAWLPGTEGQG  580



>gb|AFS50097.1| beta-D-glucan exohydolase [Elaeis guineensis]
Length=629

 Score = 99.0 bits (245),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGF+GKLS+TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  ++A
Sbjct  575  QGVADVLFGDYGFSGKLSRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTKPAIA  628


 Score = 43.5 bits (101),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPGTEGQG
Sbjct  554  IEPYVHMIDALVAAWLPGTEGQG  576



>ref|XP_010908055.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Elaeis 
guineensis]
Length=564

 Score =   102 bits (254),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR-VASG  484
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT   VAR  +S 
Sbjct  478  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMVARSSSSA  537

Query  483  GVDKRPYFFAIAL  445
            GV ++  ++ ++L
Sbjct  538  GVGRKDEYWMMSL  550


 Score = 40.0 bits (92),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  457  IEPYVPLMDALVAAWLPGSEGQG  479



>ref|XP_008391778.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=820

 Score = 99.8 bits (247),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS+TWFKTVDQLPMNVGD HYDPLFPFG+GLTT ++
Sbjct  766  QGVADVLFGDYGFTGKLSRTWFKTVDQLPMNVGDAHYDPLFPFGYGLTTTTA  817


 Score = 42.7 bits (99),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPGTEGQG
Sbjct  745  IQPYVPLMDALVAAWLPGTEGQG  767



>ref|XP_007010542.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY19352.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=662

 Score = 96.3 bits (238),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V D L+GDYGF+GKL +TWFKTVDQLPMNV D HYDPLFP GFGL T+S    V+R  
Sbjct  572  QGVIDALYGDYGFSGKLPRTWFKTVDQLPMNVEDSHYDPLFPLGFGLKTDSVASIVSRST  631

Query  489  SGGVDKRPYFFAIALSVFIGLYFQVIK  409
            S    + P  F + +++ +  YF   K
Sbjct  632  SAAALEGPCLFILIITISLSFYFTAGK  658


 Score = 45.8 bits (107),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  551  IEPYVSTIDALVAAWLPGTEGQG  573



>ref|XP_007010543.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY19353.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=661

 Score = 96.3 bits (238),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + V D L+GDYGF+GKL +TWFKTVDQLPMNV D HYDPLFP GFGL T+S    V+R  
Sbjct  572  QGVIDALYGDYGFSGKLPRTWFKTVDQLPMNVEDSHYDPLFPLGFGLKTDSVASIVSRST  631

Query  489  SGGVDKRPYFFAIALSVFIGLYF  421
            S    + P  F + +++ +  YF
Sbjct  632  SAAALEGPCLFILIITISLSFYF  654


 Score = 45.8 bits (107),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  551  IEPYVSTIDALVAAWLPGTEGQG  573



>ref|XP_008245228.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V+DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPF FGLTT+S
Sbjct  578  QGVSDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDAHYDPLFPFDFGLTTDS  628


 Score = 46.2 bits (108),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSS+DALVAAWLPGTEGQG
Sbjct  557  IEPYVSSMDALVAAWLPGTEGQG  579



>ref|XP_008230855.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V+DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPF FGLTT+S
Sbjct  578  QGVSDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDAHYDPLFPFDFGLTTDS  628


 Score = 46.2 bits (108),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSS+DALVAAWLPGTEGQG
Sbjct  557  IEPYVSSMDALVAAWLPGTEGQG  579



>ref|XP_011470452.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score = 99.0 bits (245),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVL+ ++GF+GKLS+TWF+ VDQLPM +GD HYDPLFPFGFGL T S    V R  
Sbjct  189  QGITDVLYDEHGFSGKLSRTWFRRVDQLPMKIGDPHYDPLFPFGFGLETESVKELVTRST  248

Query  489  SGGVDKRPYFFAIALSVFIGLYFQVIKRRELRSWERIINPSRFI  358
            S  V +RP+ F +A+++ I L  +       ++  R+I+  + +
Sbjct  249  SADVFRRPWTFLVAVALIISLRLEFPIVTSWQTVRRVIDRVKIL  292


 Score = 43.5 bits (101),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = -2

Query  715  YVSSIDALVAAWLPGTEGQG  656
            YVSSIDALVAAWLPGTEGQG
Sbjct  171  YVSSIDALVAAWLPGTEGQG  190



>ref|XP_009131828.1| PREDICTED: lysosomal beta glucosidase [Brassica rapa]
 ref|XP_009131829.1| PREDICTED: lysosomal beta glucosidase [Brassica rapa]
Length=631

 Score = 97.1 bits (240),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWF+TVDQLPMNVGD HYDPL+PFGFGLTT ++
Sbjct  577  QGVADVLFGDYGFTGKLARTWFRTVDQLPMNVGDPHYDPLYPFGFGLTTKAN  628


 Score = 45.4 bits (106),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS IDALVAAWLPGTEGQG
Sbjct  556  MQPYVSEIDALVAAWLPGTEGQG  578



>ref|XP_004295138.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=628

 Score = 97.1 bits (240),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDAHYDPLFPFGFGLTTKPT  625


 Score = 45.1 bits (105),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+S IDALVAAWLPGTEGQG
Sbjct  553  VQPYLSKIDALVAAWLPGTEGQG  575



>emb|CDX88832.1| BnaA03g08170D [Brassica napus]
Length=596

 Score = 97.1 bits (240),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWF+TVDQLPMNVGD HYDPL+PFGFGLTT ++
Sbjct  542  QGVADVLFGDYGFTGKLARTWFRTVDQLPMNVGDPHYDPLYPFGFGLTTKAN  593


 Score = 45.4 bits (106),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS IDALVAAWLPGTEGQG
Sbjct  521  MQPYVSEIDALVAAWLPGTEGQG  543



>gb|EPS66822.1| hypothetical protein M569_07948 [Genlisea aurea]
Length=610

 Score = 99.0 bits (245),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGDYGFTGKLS+TWF++VDQLPMNVGD HYDPLFPFGFGLTT    AR
Sbjct  556  QGVADVLFGDYGFTGKLSRTWFRSVDQLPMNVGDKHYDPLFPFGFGLTTEPVKAR  610


 Score = 43.5 bits (101),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  535  IEPYVSQVDALVAAWLPGSEGQG  557



>ref|XP_007207411.1| hypothetical protein PRUPE_ppa014605mg [Prunus persica]
 gb|EMJ08610.1| hypothetical protein PRUPE_ppa014605mg [Prunus persica]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V+DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPF FGLTT+S
Sbjct  578  QGVSDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDAHYDPLFPFDFGLTTDS  628


 Score = 46.2 bits (108),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVSS+DALVAAWLPGTEGQG
Sbjct  557  IEPYVSSMDALVAAWLPGTEGQG  579



>gb|KHG09998.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=686

 Score = 96.3 bits (238),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTDVL+GDY F+GKL +TWFKTVDQLPMNVGD HYDPLFP GFGL T S    V+R  
Sbjct  572  QGVTDVLYGDYRFSGKLPRTWFKTVDQLPMNVGDSHYDPLFPLGFGLKTESGASIVSRST  631

Query  489  SGGVDKRPYFF  457
            S    +RP  F
Sbjct  632  SSATLRRPGLF  642


 Score = 45.8 bits (107),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  551  IEPYVSAIDALVAAWLPGTEGQG  573



>ref|XP_004502135.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=705

 Score = 97.4 bits (241),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTTN
Sbjct  652  QGVADVLYGDYAFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGFGLTTN  701


 Score = 44.7 bits (104),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  631  IQPYLSKIDALVAAWLPGTEGQG  653



>ref|XP_010541670.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
 ref|XP_010541671.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=630

 Score = 97.8 bits (242),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDSHYDPLFPFGFGLTTKPT  627


 Score = 44.3 bits (103),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S++DALVAAWLPGTEGQG
Sbjct  555  MQPYISNMDALVAAWLPGTEGQG  577



>ref|XP_007205098.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
 gb|EMJ06297.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
Length=602

 Score = 95.9 bits (237),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + ++DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT+
Sbjct  549  QGISDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDRHYDPLFPFGFGLTTD  598


 Score = 45.8 bits (107),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  528  IEPYLSSIDALVAAWLPGTEGQG  550



>ref|XP_007206306.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
 gb|EMJ07505.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
Length=647

 Score = 99.0 bits (245),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTDVLFGDYGFTGKL+ TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  593  QGVTDVLFGDYGFTGKLAHTWFKTVDQLPMNVGDQHYDPLFPFGFGLTTKPT  644


 Score = 42.7 bits (99),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DALVAAWLPGTEGQG
Sbjct  572  IQPYLAKVDALVAAWLPGTEGQG  594



>ref|XP_002523935.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF38422.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D+LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  579  QGVADLLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTT  627


 Score = 45.4 bits (106),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+S+IDALVAAWLPGTEGQG
Sbjct  558  VQPYLSNIDALVAAWLPGTEGQG  580



>ref|XP_008791319.1| PREDICTED: uncharacterized protein LOC103708257 [Phoenix dactylifera]
Length=1262

 Score = 99.4 bits (246),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660   KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
             + V DVLFGDYGF+GKLS+TWFK+VDQLPMNVGD HYDPLFPFGFGL+T  +
Sbjct  1208  QGVADVLFGDYGFSGKLSRTWFKSVDQLPMNVGDPHYDPLFPFGFGLSTEPA  1259


 Score = 42.4 bits (98),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724   VXPYVSSIDALVAAWLPGTEGQG  656
             + PY+  IDALVAAWLPGTEGQG
Sbjct  1187  IEPYMHMIDALVAAWLPGTEGQG  1209


 Score = 97.8 bits (242),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGF+GKL +TWF++VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  575  QGVADVLFGDYGFSGKLPRTWFRSVDQLPMNVGDPHYDPLFPFGFGLTT  623


 Score = 42.4 bits (98),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  IDA VAAWLPGTEGQG
Sbjct  554  VEPYIDGIDAFVAAWLPGTEGQG  576



>ref|XP_009417082.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417083.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=656

 Score =   101 bits (251),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + +TDVL+GDYGFTGKLS+TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +  R++S  
Sbjct  573  QGLTDVLYGDYGFTGKLSRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPTSGRLSSAA  632


 Score = 40.4 bits (93),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  552  IEPYVPLVDALVAAWLPGSEGQG  574



>ref|XP_007030059.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY10561.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=1220

 Score =   100 bits (249),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  660   KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
             + V DVLFGDYGFTGKLS TWFKTVDQLPM+VGD HYDPLFPFGFGLTT  + A
Sbjct  1167  QGVADVLFGDYGFTGKLSFTWFKTVDQLPMHVGDSHYDPLFPFGFGLTTKPTKA  1220


 Score = 41.2 bits (95),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724   VXPYVSSIDALVAAWLPGTEGQG  656
             + PYV  IDA+VAAWLPG+EGQG
Sbjct  1146  IQPYVRYIDAIVAAWLPGSEGQG  1168


 Score = 43.9 bits (102),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P+++SIDALVAAWLPGTEGQG
Sbjct  570  IQPFLNSIDALVAAWLPGTEGQG  592


 Score = 30.4 bits (67),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGK  613
            + V DVLFGDYGFT K
Sbjct  591  QGVADVLFGDYGFTDK  606



>ref|XP_010535769.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
 ref|XP_010535770.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=630

 Score = 98.6 bits (244),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPS  627


 Score = 43.1 bits (100),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +D+LVAAWLPGTEGQG
Sbjct  555  MQPYVSGVDSLVAAWLPGTEGQG  577



>ref|XP_010653212.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Vitis 
vinifera]
Length=627

 Score = 97.4 bits (241),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKLS+TWF+TV+QLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  574  QGVADVLFGDYGFTGKLSRTWFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTKA  627


 Score = 43.9 bits (102),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPGTEGQG
Sbjct  553  IQPYVDQIDALVAAWLPGTEGQG  575



>ref|XP_009757149.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=628

 Score = 99.0 bits (245),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDSHYDPLFPFGFGLTTEPTKA  627


 Score = 42.7 bits (99),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DALVAAWLPGTEGQG
Sbjct  553  IQPYLAQVDALVAAWLPGTEGQG  575



>emb|CBI39076.3| unnamed protein product [Vitis vinifera]
Length=635

 Score = 97.4 bits (241),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKLS+TWF+TV+QLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  582  QGVADVLFGDYGFTGKLSRTWFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTKA  635


 Score = 43.9 bits (102),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPGTEGQG
Sbjct  561  IQPYVDQIDALVAAWLPGTEGQG  583



>ref|XP_002266470.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Vitis 
vinifera]
Length=676

 Score = 97.4 bits (241),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKLS+TWF+TV+QLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  623  QGVADVLFGDYGFTGKLSRTWFRTVEQLPMNVGDRHYDPLFPFGFGLTTEPTKA  676


 Score = 43.9 bits (102),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPGTEGQG
Sbjct  602  IQPYVDQIDALVAAWLPGTEGQG  624



>ref|XP_010420942.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=628

 Score = 97.1 bits (240),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPL+PFGFGL TN
Sbjct  577  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLYPFGFGLITN  626


 Score = 44.3 bits (103),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S++DALVAAWLPGTEGQG
Sbjct  556  MQPYISNMDALVAAWLPGTEGQG  578



>gb|KHN34680.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score = 97.8 bits (242),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNVGDLHYDPLFPFGFGL+T  +
Sbjct  574  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVGDLHYDPLFPFGFGLSTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV S+DALVAAWLPG+EGQG
Sbjct  553  IEPYVDSVDALVAAWLPGSEGQG  575



>ref|XP_006487803.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487804.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Citrus 
sinensis]
Length=628

 Score = 97.8 bits (242),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  553  IQPYLAQIDALVAAWLPGTEGQG  575



>ref|XP_008385601.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
 ref|XP_008359191.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score = 98.2 bits (243),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  579  QGVTDALFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  630


 Score = 43.1 bits (100),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  558  IQPYLAGIDALVAAWLPGTEGQG  580



>gb|KDO54375.1| hypothetical protein CISIN_1g006872mg [Citrus sinensis]
Length=628

 Score = 97.8 bits (242),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  553  IQPYLAQIDALVAAWLPGTEGQG  575



>ref|XP_009368634.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score = 98.2 bits (243),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  579  QGVTDALFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  630


 Score = 43.1 bits (100),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  558  IQPYLAGIDALVAAWLPGTEGQG  580



>ref|XP_010679654.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679655.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=645

 Score = 95.9 bits (237),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + VTDVLFGDY F GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTTN
Sbjct  582  QGVTDVLFGDYDFKGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTN  631


 Score = 45.1 bits (105),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++SIDALVAAWLPGTEGQG
Sbjct  561  IEPYMASIDALVAAWLPGTEGQG  583



>ref|XP_010493212.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=624

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT +
Sbjct  571  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTTKA  621


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IQPYVSTIDALVAAWLPGTEGQG  572



>ref|XP_010420941.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=676

 Score = 94.4 bits (233),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT 
Sbjct  623  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTTK  672


 Score = 46.6 bits (109),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  602  IQPYVSTIDALVAAWLPGTEGQG  624



>ref|XP_006289165.1| hypothetical protein CARUB_v10002603mg [Capsella rubella]
 gb|EOA22063.1| hypothetical protein CARUB_v10002603mg [Capsella rubella]
Length=628

 Score = 96.7 bits (239),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWF+TVDQLPMNVGD HYDPL+PFGFGL TN
Sbjct  577  QGVADVLFGDYGFTGKLARTWFRTVDQLPMNVGDPHYDPLYPFGFGLVTN  626


 Score = 44.3 bits (103),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S++DALVAAWLPGTEGQG
Sbjct  556  MQPYISNMDALVAAWLPGTEGQG  578



>ref|XP_010279030.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=628

 Score = 96.7 bits (239),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGDYGFTGKL++TWF+TVDQLP+NVGD HYDPLFPFGFGLTT  + A+
Sbjct  574  QGVADVLFGDYGFTGKLARTWFRTVDQLPLNVGDPHYDPLFPFGFGLTTKPTHAK  628


 Score = 44.3 bits (103),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ S+DALVAAWLPGTEGQG
Sbjct  553  IQPYIDSMDALVAAWLPGTEGQG  575



>gb|KJB35516.1| hypothetical protein B456_006G118100 [Gossypium raimondii]
Length=623

 Score = 97.8 bits (242),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  569  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDSHYDPLFPFGFGLTTKPT  620


 Score = 43.1 bits (100),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P+VSS+ ALVAAWLPGTEGQG
Sbjct  548  VQPFVSSVHALVAAWLPGTEGQG  570



>ref|XP_009595457.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=630

 Score = 98.2 bits (243),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGL-TTNSSVAR  496
            + +TD+LFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGL T+ S+VAR
Sbjct  575  QGITDLLFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLNTSKSTVAR  630


 Score = 42.4 bits (98),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDALVAAWLPG+EGQG
Sbjct  554  IEPYLPSIDALVAAWLPGSEGQG  576



>ref|XP_011089217.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=628

 Score = 97.4 bits (241),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFGDYGFTGKL++TWF+TVDQLPMNVGD HYDPLFPFG+GLTT     R A 
Sbjct  571  QGVADVLFGDYGFTGKLARTWFRTVDQLPMNVGDPHYDPLFPFGYGLTTKPRELRAAQ  628


 Score = 43.1 bits (100),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  550  IEPYLDQIDALVAAWLPGTEGQG  572



>ref|XP_010679080.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 95.5 bits (236),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + VTD+LFGDY FTG L +TWF+TVDQLPMNVGDLHYDPLFPFGFGL+TN
Sbjct  582  QGVTDMLFGDYEFTGNLPRTWFRTVDQLPMNVGDLHYDPLFPFGFGLSTN  631


 Score = 45.1 bits (105),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++SIDALVAAWLPGTEGQG
Sbjct  561  IEPYMASIDALVAAWLPGTEGQG  583



>ref|XP_007202161.1| hypothetical protein PRUPE_ppa006354mg [Prunus persica]
 gb|EMJ03360.1| hypothetical protein PRUPE_ppa006354mg [Prunus persica]
Length=415

 Score = 95.9 bits (237),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS+TWFKTVDQLPMNVGD  YDPLFPFGFGLTT  +
Sbjct  361  QGVADVLFGDYGFTGKLSRTWFKTVDQLPMNVGDARYDPLFPFGFGLTTTPT  412


 Score = 44.7 bits (104),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PYV+SI+ALVAAWLPGTEGQG
Sbjct  340  VQPYVASINALVAAWLPGTEGQG  362



>ref|XP_004301060.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=496

 Score = 98.6 bits (244),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKLS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  442  QGVADVLFGDYGFTGKLSRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTAPTKA  495


 Score = 41.6 bits (96),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  421  MQPYVSLLDALVAAWLPGSEGQG  443



>ref|XP_010456613.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=675

 Score = 94.0 bits (232),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT
Sbjct  622  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTT  670


 Score = 46.2 bits (108),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  601  IQPYVSTIDALVAAWLPGTEGQG  623



>ref|XP_006286473.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
 gb|EOA19371.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
Length=624

 Score = 94.0 bits (232),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT
Sbjct  571  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTT  619


 Score = 46.2 bits (108),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IQPYVSTIDALVAAWLPGTEGQG  572



>ref|XP_002266675.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + VTDVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFP GFGLTT   VA
Sbjct  574  QGVTDVLFGDYGFTGKLPRTWFKTVDQLPMNSGDPHYDPLFPIGFGLTTQPIVA  627


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI ALVAAWLPGTEGQG
Sbjct  553  IQPYLSSIHALVAAWLPGTEGQG  575



>gb|EEE55456.1| hypothetical protein OsJ_03617 [Oryza sativa Japonica Group]
Length=628

 Score =   101 bits (251),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGDLHYDPLFPFGFGLT NSS
Sbjct  538  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDLHYDPLFPFGFGLTINSS  589


 Score = 38.9 bits (89),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ++ALVAAWLPGTEGQG
Sbjct  517  IEPYLPMMEALVAAWLPGTEGQG  539



>ref|NP_001044387.1| Os01g0771900 [Oryza sativa Japonica Group]
 dbj|BAB56084.2| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAB89846.1| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAF06301.1| Os01g0771900 [Oryza sativa Japonica Group]
Length=663

 Score =   101 bits (251),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGDLHYDPLFPFGFGLT NSS
Sbjct  573  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDLHYDPLFPFGFGLTINSS  624


 Score = 38.9 bits (89),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ++ALVAAWLPGTEGQG
Sbjct  552  IEPYLPMMEALVAAWLPGTEGQG  574



>ref|XP_002266589.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + VTDVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFP GFGLTT   VA
Sbjct  574  QGVTDVLFGDYGFTGKLPRTWFKTVDQLPMNSGDPHYDPLFPIGFGLTTQPIVA  627


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI ALVAAWLPGTEGQG
Sbjct  553  IQPYLSSIHALVAAWLPGTEGQG  575



>ref|XP_007218946.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
 gb|EMJ20145.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
Length=658

 Score = 93.6 bits (231),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + +TDVLFGD+GF+GKL +TWF+TVDQLPMN GD HYDPLFP GFG+ T S    V R  
Sbjct  578  QGITDVLFGDHGFSGKLPRTWFRTVDQLPMNFGDTHYDPLFPLGFGIETESIKELVTRST  637

Query  489  SGGVDKRP  466
            S GV  RP
Sbjct  638  SDGVIGRP  645


 Score = 46.6 bits (109),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  557  IEPYISSIDALVAAWLPGTEGQG  579



>ref|XP_002874025.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50284.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score = 94.0 bits (232),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT
Sbjct  571  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTT  619


 Score = 46.2 bits (108),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IQPYVSTIDALVAAWLPGTEGQG  572



>emb|CDP10537.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 97.4 bits (241),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  S A 
Sbjct  435  QGVADVLFGDYGFSGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPSEAH  489


 Score = 42.7 bits (99),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  414  IQPYLDQIDALVAAWLPGTEGQG  436



>emb|CDP15624.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 96.3 bits (238),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTKPT  627


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+SSI ALVAAWLPGTEGQG
Sbjct  555  VEPYLSSISALVAAWLPGTEGQG  577



>ref|XP_006424024.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 ref|XP_006424025.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37264.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37265.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
Length=628

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMN+GD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNLGDPHYDPLFPFGFGLTTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  553  IQPYLAQIDALVAAWLPGTEGQG  575



>gb|KHG17513.1| gluA [Gossypium arboreum]
Length=624

 Score = 97.8 bits (242),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  571  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  622


 Score = 42.0 bits (97),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI+ALV AWLPGTEGQG
Sbjct  550  MQPYLSSINALVVAWLPGTEGQG  572



>ref|NP_001051275.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|AAL58966.1|AC091811_15 putative exoglucanase precursor [Oryza sativa Japonica Group]
 gb|ABF98882.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98883.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98884.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13189.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|EAY91868.1| hypothetical protein OsI_13515 [Oryza sativa Indica Group]
 gb|EAZ28591.1| hypothetical protein OsJ_12577 [Oryza sativa Japonica Group]
 dbj|BAG89337.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score = 97.8 bits (242),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGFTGKLS+TWFK+VDQLPMNVGD HYDPLFPFG+GLTT +
Sbjct  572  QGVADVLFGDYGFTGKLSRTWFKSVDQLPMNVGDAHYDPLFPFGYGLTTQA  622


 Score = 42.0 bits (97),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  IDA VAAWLPGTEGQG
Sbjct  551  VEPYIGGIDAFVAAWLPGTEGQG  573



>ref|XP_002278363.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651642.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651643.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=628

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTV+QLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVEQLPMNVGDPHYDPLFPFGFGLTTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  553  IQPYLAKIDALVAAWLPGTEGQG  575



>emb|CBI22348.3| unnamed protein product [Vitis vinifera]
Length=534

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + VTDVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFP GFGLTT   VA
Sbjct  479  QGVTDVLFGDYGFTGKLPRTWFKTVDQLPMNSGDPHYDPLFPIGFGLTTQPIVA  532


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI ALVAAWLPGTEGQG
Sbjct  458  IQPYLSSIHALVAAWLPGTEGQG  480



>gb|KHN46760.1| Lysosomal beta glucosidase [Glycine soja]
Length=636

 Score = 96.3 bits (238),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFPFGFGL+T  S A  +S
Sbjct  579  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSKALFSS  636


 Score = 43.9 bits (102),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPG+EGQG
Sbjct  558  IEPYVGSIDALVAAWLPGSEGQG  580



>ref|XP_003548716.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=636

 Score = 95.9 bits (237),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFPFGFGL+T  S A  +S
Sbjct  579  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSKALFSS  636


 Score = 43.9 bits (102),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPG+EGQG
Sbjct  558  IEPYVGSIDALVAAWLPGSEGQG  580



>emb|CBI22347.3| unnamed protein product [Vitis vinifera]
Length=534

 Score = 96.3 bits (238),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + VTDVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFP GFGLTT   VA
Sbjct  479  QGVTDVLFGDYGFTGKLPRTWFKTVDQLPMNSGDPHYDPLFPIGFGLTTQPIVA  532


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI ALVAAWLPGTEGQG
Sbjct  458  IQPYLSSIHALVAAWLPGTEGQG  480



>ref|XP_006598973.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=671

 Score = 95.9 bits (237),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFGDYGFTGKL +TWFKTVDQLPMN GD HYDPLFPFGFGL+T  S A  +S
Sbjct  614  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNAGDPHYDPLFPFGFGLSTKPSKALFSS  671


 Score = 43.9 bits (102),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPG+EGQG
Sbjct  593  IEPYVGSIDALVAAWLPGSEGQG  615



>ref|XP_011094175.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFG+GLTT
Sbjct  578  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVGDQHYDPLFPFGYGLTT  626


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  557  IQPYLTQIDALVAAWLPGTEGQG  579



>ref|XP_009614218.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=639

 Score = 97.1 bits (240),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGDY FTGKLS+TWFKTV+QLPMNVGD HYDPLFPFGFGLTT ++ A+
Sbjct  579  QGVADVLFGDYEFTGKLSRTWFKTVNQLPMNVGDSHYDPLFPFGFGLTTTATKAQ  633


 Score = 42.7 bits (99),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P++S+ID+LVAAWLPGTEGQG
Sbjct  558  VQPHLSNIDSLVAAWLPGTEGQG  580



>ref|XP_008245226.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score = 96.3 bits (238),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V+DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPF FGLTT+S
Sbjct  578  QGVSDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDAHYDPLFPFDFGLTTDS  628


 Score = 43.5 bits (101),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV S+DALVAAWLPGTEGQG
Sbjct  557  IEPYVLSMDALVAAWLPGTEGQG  579



>ref|XP_010558244.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
 ref|XP_010558245.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
Length=664

 Score = 96.3 bits (238),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + VTD +FGD+GF+GKL  TWF+ ++QLPM+ GD HYDPLFP+GFGL T S    VAR  
Sbjct  573  QGVTDAIFGDHGFSGKLPITWFRNIEQLPMSYGDSHYDPLFPYGFGLETESVSSIVARST  632

Query  489  SGGVDKRPYFFAIALSVFIGLYFQVIKRRELR  394
            SG   +RP  F + +SV   L+   + R   R
Sbjct  633  SGSAARRPCLFVVLVSVTFYLFLDGLSRVSQR  664


 Score = 43.5 bits (101),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+SSI+ALVAAWLPGTEGQG
Sbjct  554  PYMSSIEALVAAWLPGTEGQG  574



>ref|XP_011021458.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=626

 Score = 97.4 bits (241),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTG LS+TWFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  572  QGVADVLFGDYGFTGTLSQTWFKTVDQLPMNVGDRHYDPLFPFGFGLTT  620


 Score = 42.4 bits (98),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  551  IQPYVSLMDALVAAWLPGSEGQG  573



>ref|XP_006575592.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=592

 Score = 95.5 bits (236),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN +
Sbjct  539  QGVADLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPT  590


 Score = 44.3 bits (103),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  518  IQPYLSKVDALVAAWLPGTEGQG  540



>ref|XP_010031608.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 ref|XP_010031610.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50976.1| hypothetical protein EUGRSUZ_J00605 [Eucalyptus grandis]
Length=637

 Score = 93.6 bits (231),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWF++VDQLPMNVGD HYDPL+PFGFGLTT  +
Sbjct  578  QGVADLLFGDYGFTGKLARTWFRSVDQLPMNVGDPHYDPLYPFGFGLTTKGT  629


 Score = 46.2 bits (108),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  557  IEPYVSNIDALVAAWLPGTEGQG  579



>ref|XP_006575593.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
Length=531

 Score = 95.5 bits (236),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN +
Sbjct  478  QGVADLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPT  529


 Score = 44.3 bits (103),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  457  IQPYLSKVDALVAAWLPGTEGQG  479



>ref|XP_008344965.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=607

 Score = 97.1 bits (240),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGFTGKL+ TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  554  QGVTDALFGDYGFTGKLAHTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  605


 Score = 42.4 bits (98),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  533  LQPYLAGIDALVAAWLPGTEGQG  555



>ref|XP_006479136.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=635

 Score = 95.9 bits (237),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDY FTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT S
Sbjct  581  QGVADVLFGDYDFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKS  631


 Score = 43.9 bits (102),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  560  IQPYLSYIDALVAAWLPGTEGQG  582



>ref|XP_006443452.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
 gb|ESR56692.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
Length=627

 Score = 95.5 bits (236),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDY FTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT S
Sbjct  573  QGVADVLFGDYDFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKS  623


 Score = 43.9 bits (102),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  552  IQPYLSYIDALVAAWLPGTEGQG  574



>ref|XP_011089010.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011089011.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=636

 Score = 94.4 bits (233),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFG+YGF+GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  583  QGVADVLFGEYGFSGKLPRTWFKTVDQLPMNVGDEHYDPLFPFGFGLTT  631


 Score = 45.1 bits (105),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+SSIDALVAAWLPG+EGQG
Sbjct  562  VQPYLSSIDALVAAWLPGSEGQG  584



>ref|XP_003601350.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES71601.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=627

 Score = 94.7 bits (234),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GD+ FTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTTN
Sbjct  574  QGVADVLYGDFEFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGFGLTTN  623


 Score = 44.7 bits (104),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  553  IQPYLSKIDALVAAWLPGTEGQG  575



>ref|XP_010097917.1| Periplasmic beta-glucosidase [Morus notabilis]
 gb|EXB73273.1| Periplasmic beta-glucosidase [Morus notabilis]
Length=620

 Score = 95.9 bits (237),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTV+QLPMNVGD HYDPLFPFGFGLTT 
Sbjct  568  QGVADVLFGDYGFTGKLARTWFKTVNQLPMNVGDPHYDPLFPFGFGLTTE  617


 Score = 43.9 bits (102),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+++ALVAAWLPGTEGQG
Sbjct  547  IQPYVSTVEALVAAWLPGTEGQG  569



>ref|XP_009120747.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
 ref|XP_009120748.1| PREDICTED: lysosomal beta glucosidase-like [Brassica rapa]
Length=626

 Score = 94.0 bits (232),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFK+V+QLPMNVGD HYDPL+PFGFGLTT  S
Sbjct  573  QGVADALFGDYGFTGKLARTWFKSVEQLPMNVGDQHYDPLYPFGFGLTTQPS  624


 Score = 45.4 bits (106),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  552  MEPYVSTIDALVAAWLPGTEGQG  574



>ref|XP_003519468.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=627

 Score = 95.1 bits (235),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN +
Sbjct  574  QGVADLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPT  625


 Score = 44.3 bits (103),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  553  IQPYLSKVDALVAAWLPGTEGQG  575



>gb|KHN38459.1| Lysosomal beta glucosidase [Glycine soja]
Length=644

 Score = 95.1 bits (235),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWFKTVDQLPMNVGD +YDPLFPFGFGL+TN +
Sbjct  591  QGVADLLFGDYGFTGKLARTWFKTVDQLPMNVGDKYYDPLFPFGFGLSTNPT  642


 Score = 44.3 bits (103),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  570  IQPYLSKVDALVAAWLPGTEGQG  592



>ref|XP_008355265.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score = 97.1 bits (240),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGFTGKL+ TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  579  QGVTDALFGDYGFTGKLAHTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  630


 Score = 42.4 bits (98),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  558  LQPYLAGIDALVAAWLPGTEGQG  580



>ref|XP_006400664.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 ref|XP_006400665.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 ref|XP_006400666.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42117.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42118.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
 gb|ESQ42119.1| hypothetical protein EUTSA_v10012963mg [Eutrema salsugineum]
Length=628

 Score = 94.0 bits (232),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGDLHYDPL+PFGFGLTT
Sbjct  574  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDLHYDPLYPFGFGLTT  622


 Score = 45.4 bits (106),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  553  MQPYVSTIDALVAAWLPGTEGQG  575



>ref|XP_008464960.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score = 95.1 bits (235),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K ++DVLFGDYGFTGKLS+TWFK+VDQLPMN GD HYDPLFP GFGLTT 
Sbjct  575  KGISDVLFGDYGFTGKLSQTWFKSVDQLPMNFGDAHYDPLFPLGFGLTTQ  624


 Score = 43.9 bits (102),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDALVAAWLPGTEG+G
Sbjct  554  IQPYIDSIDALVAAWLPGTEGKG  576



>ref|XP_004241372.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
 ref|XP_004241373.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=624

 Score = 96.7 bits (239),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  571  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDRHYDPLFPFGFGLTT  619


 Score = 42.7 bits (99),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+++IDALVAAWLPG+EGQG
Sbjct  550  IEPYLANIDALVAAWLPGSEGQG  572



>gb|KHG17514.1| gluA [Gossypium arboreum]
Length=343

 Score = 97.1 bits (240),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  290  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  341


 Score = 42.0 bits (97),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSI+ALV AWLPGTEGQG
Sbjct  269  MQPYLSSINALVVAWLPGTEGQG  291



>ref|XP_009342674.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342678.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342686.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score = 97.1 bits (240),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGFTGKL+ TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  579  QGVTDALFGDYGFTGKLAHTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTKPT  630


 Score = 42.4 bits (98),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  558  LQPYLAGIDALVAAWLPGTEGQG  580



>ref|XP_003638320.1| Beta-D-glucosidase [Medicago truncatula]
Length=401

 Score = 94.4 bits (233),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GD+ FTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTTN
Sbjct  348  QGVADVLYGDFEFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGFGLTTN  397


 Score = 44.7 bits (104),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  327  IQPYLSKIDALVAAWLPGTEGQG  349



>ref|XP_009769527.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=627

 Score = 96.7 bits (239),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  623


 Score = 42.4 bits (98),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+++IDALVAAWLPG+EGQG
Sbjct  553  IEPYLANIDALVAAWLPGSEGQG  575



>ref|XP_006347720.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
tuberosum]
Length=630

 Score = 97.4 bits (241),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN-SSVAR  496
            + +TD+LFGDYGFTGKL +TWF+TVDQLPMNVGD HYDPLFPFGFGLTT+ S++AR
Sbjct  575  QGITDLLFGDYGFTGKLPRTWFRTVDQLPMNVGDPHYDPLFPFGFGLTTSKSTIAR  630


 Score = 41.6 bits (96),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            P++ SIDALVAAWLPGTEGQG
Sbjct  556  PFLPSIDALVAAWLPGTEGQG  576



>ref|XP_009760946.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=624

 Score = 95.5 bits (236),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFK VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  570  QGVADVLFGDYGFTGKLARTWFKRVDQLPMNVGDPHYDPLFPFGFGLTTQ  619


 Score = 43.5 bits (101),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPGTEGQG
Sbjct  549  IEPYVEKMDALVAAWLPGTEGQG  571



>gb|KDP39682.1| hypothetical protein JCGZ_02702 [Jatropha curcas]
Length=644

 Score = 95.1 bits (235),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKLS+TWFK+VDQLPMNVGD +YDPLFPFGFGLTT 
Sbjct  591  QGVADVLFGDYGFTGKLSRTWFKSVDQLPMNVGDRNYDPLFPFGFGLTTE  640


 Score = 43.9 bits (102),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+SI+ALVAAWLPGTEGQG
Sbjct  570  MQPYVNSIEALVAAWLPGTEGQG  592



>ref|XP_009610986.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=628

 Score = 98.2 bits (243),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKL++TWFKTVDQLPMN+GD HYDPLFPFGFGLTT  + A
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNIGDPHYDPLFPFGFGLTTEPTKA  627


 Score = 40.8 bits (94),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DALV AWLPGTEGQG
Sbjct  553  IQPYLAQVDALVEAWLPGTEGQG  575



>ref|XP_009609161.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=629

 Score = 95.9 bits (237),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D+LFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  576  QGVADILFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  625


 Score = 43.1 bits (100),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+++IDALVAAWLPG+EGQG
Sbjct  555  VEPYLANIDALVAAWLPGSEGQG  577



>ref|XP_002525724.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF36707.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=625

 Score = 95.5 bits (236),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKLS TWFKTVDQLPMNVGD +YDPLFPFGFGLTT 
Sbjct  572  QGVADVLFGDYGFTGKLSHTWFKTVDQLPMNVGDRYYDPLFPFGFGLTTE  621


 Score = 43.5 bits (101),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+ IDALVAAWLPGTEGQG
Sbjct  551  IQPYVNIIDALVAAWLPGTEGQG  573



>ref|XP_012070424.1| PREDICTED: lysosomal beta glucosidase-like [Jatropha curcas]
Length=627

 Score = 95.1 bits (235),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKLS+TWFK+VDQLPMNVGD +YDPLFPFGFGLTT 
Sbjct  574  QGVADVLFGDYGFTGKLSRTWFKSVDQLPMNVGDRNYDPLFPFGFGLTTE  623


 Score = 43.9 bits (102),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+SI+ALVAAWLPGTEGQG
Sbjct  553  MQPYVNSIEALVAAWLPGTEGQG  575



>ref|XP_009609162.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=550

 Score = 95.9 bits (237),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D+LFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  497  QGVADILFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  546


 Score = 43.1 bits (100),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+++IDALVAAWLPG+EGQG
Sbjct  476  VEPYLANIDALVAAWLPGSEGQG  498



>gb|AFU52664.1| beta-1,3-glucanase 31 [Solanum tuberosum]
Length=251

 Score = 97.4 bits (241),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN-SSVAR  496
            + +TD+LFGDYGFTGKL +TWF+TVDQLPMNVGD HYDPLFPFGFGLTT+ S++AR
Sbjct  196  QGITDLLFGDYGFTGKLPRTWFRTVDQLPMNVGDPHYDPLFPFGFGLTTSKSTIAR  251


 Score = 41.6 bits (96),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P++ SIDALVAAWLPGTEGQG
Sbjct  175  LEPFLPSIDALVAAWLPGTEGQG  197



>ref|XP_011652313.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 ref|XP_011652314.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN59736.1| hypothetical protein Csa_3G842090 [Cucumis sativus]
Length=629

 Score = 97.1 bits (240),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K ++DVLFGDYGFTGKLS+TWFK+VDQLPMN GD HYDPLFPFGFGLTT 
Sbjct  576  KGISDVLFGDYGFTGKLSQTWFKSVDQLPMNFGDAHYDPLFPFGFGLTTQ  625


 Score = 42.0 bits (97),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+ SIDA+VAAWLPGTEG+G
Sbjct  555  LQPYIDSIDAVVAAWLPGTEGKG  577



>ref|XP_006361126.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361127.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006361128.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Solanum 
tuberosum]
Length=624

 Score = 96.3 bits (238),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  571  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTT  619


 Score = 42.7 bits (99),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+++IDALVAAWLPG+EGQG
Sbjct  550  IEPYLANIDALVAAWLPGSEGQG  572



>ref|XP_008385616.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=633

 Score = 97.4 bits (241),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -3

Query  654  VTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            V+DVLFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFG TT+
Sbjct  580  VSDVLFGDYGFTGKLPRTWFKTVDQLPMNVGDAHYDPLFPFGFGJTTD  627


 Score = 41.6 bits (96),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P VSSIDALVAAWLPGTEG G
Sbjct  557  IEPXVSSIDALVAAWLPGTEGXG  579



>ref|XP_006604247.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006604248.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006604249.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
Length=631

 Score = 95.1 bits (235),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNVGD HYDPLFPFGFGL+T  +
Sbjct  574  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLSTKPT  625


 Score = 43.5 bits (101),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV S+DALVAAWLPG+EGQG
Sbjct  553  IEPYVDSVDALVAAWLPGSEGQG  575



>ref|XP_006350208.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=631

 Score = 97.8 bits (242),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  578  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNVGDSHYDPLFPFGFGLTTE  627


 Score = 40.8 bits (94),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ +DA+VAAWLPGTEGQG
Sbjct  557  IQPYLAQMDAVVAAWLPGTEGQG  579



>ref|XP_002451476.1| hypothetical protein SORBIDRAFT_04g002570 [Sorghum bicolor]
 gb|EES04452.1| hypothetical protein SORBIDRAFT_04g002570 [Sorghum bicolor]
Length=662

 Score = 97.1 bits (240),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V+DVLFGDYGFTGKLS+TWF++VDQLPMNVGD HYDPLFPFGFGL T  S
Sbjct  609  QGVSDVLFGDYGFTGKLSRTWFRSVDQLPMNVGDAHYDPLFPFGFGLETQPS  660


 Score = 42.0 bits (97),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P++ ++DALVAAWLPGTEGQG
Sbjct  588  VEPFIDAMDALVAAWLPGTEGQG  610



>ref|XP_002456420.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
 gb|EES01540.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
Length=675

 Score = 99.0 bits (245),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSV---ARVA  490
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPL+PFGFGLT NSS+   + V 
Sbjct  592  QGVADVLFGDYGFTGKLPQTWFKSVDQLPMNVGDPHYDPLYPFGFGLTINSSLPGFSGVD  651

Query  489  SGGVDKRPYFFAIALSVF  436
            + G  K+   F +  S+ 
Sbjct  652  NLGYKKQRVLFVVLCSLL  669


 Score = 39.7 bits (91),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  ++ALVAAWLPGTEGQG
Sbjct  571  IEPYVPLMEALVAAWLPGTEGQG  593



>ref|XP_003569924.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
 ref|XP_010232399.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
Length=661

 Score =   100 bits (248),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS+TWFK+VDQLPMNVGD HYDPLFPFGFGLT NSS
Sbjct  572  QGVADVLFGDYGFTGKLSRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTINSS  623


 Score = 38.5 bits (88),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ++ALVAAWLPGTEGQG
Sbjct  551  IEPYLPLMEALVAAWLPGTEGQG  573



>gb|KJB44572.1| hypothetical protein B456_007G260000 [Gossypium raimondii]
Length=644

 Score = 94.0 bits (232),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DV+FGDYGFTGKL +TWFKTVDQLPMNVGD HYDPL+PFGFG+TT  +
Sbjct  576  QGVADVVFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLYPFGFGITTEPT  627


 Score = 44.7 bits (104),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++SIDALVAAWLPGTEGQG
Sbjct  555  IEPYLASIDALVAAWLPGTEGQG  577



>gb|KHG23007.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=1245

 Score = 94.0 bits (232),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DV+FGDYGFTGKL +TWFKTVDQLPMNVGD HYDPL+PFGFG+TT  +
Sbjct  583  QGVADVVFGDYGFTGKLPRTWFKTVDQLPMNVGDPHYDPLYPFGFGITTEPT  634


 Score = 44.7 bits (104),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++SIDALVAAWLPGTEGQG
Sbjct  562  IEPYLASIDALVAAWLPGTEGQG  584


 Score = 92.0 bits (227),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  660   KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
             + V DVLFGD+GFTGKLS TWFKTVDQLPM+VGD HYDPLFP GFGLTT  + A+
Sbjct  1191  QGVADVLFGDFGFTGKLSFTWFKTVDQLPMHVGDPHYDPLFPLGFGLTTQPAKAQ  1245


 Score = 42.7 bits (99),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724   VXPYVSSIDALVAAWLPGTEGQG  656
             + PYV+SI+ALVAAWLPG+EGQG
Sbjct  1170  IQPYVASIEALVAAWLPGSEGQG  1192



>ref|XP_008777968.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Phoenix 
dactylifera]
Length=660

 Score = 98.6 bits (244),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT     R +S  
Sbjct  574  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMATRSSSSA  633

Query  480  --VDKRPYFFAIALSVFIGL  427
              V K  Y     LS+++ L
Sbjct  634  RVVRKEEYCM---LSLYLSL  650


 Score = 40.0 bits (92),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  553  IEPYVPLMDALVAAWLPGSEGQG  575



>ref|XP_009619848.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=624

 Score = 95.9 bits (237),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWFK VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  570  QGVADVLFGDYGFTGKLARTWFKRVDQLPMNVGDPHYDPLFPFGFGLTTQPT  621


 Score = 42.7 bits (99),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  +DALVAAWLPGTEGQG
Sbjct  549  IEPYIERMDALVAAWLPGTEGQG  571



>ref|XP_010031611.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50980.1| hypothetical protein EUGRSUZ_J00609 [Eucalyptus grandis]
Length=634

 Score = 98.2 bits (243),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -3

Query  654  VTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            +TDVLFGDYGFTGKL++TWF+TVDQLPMNVGD HYDPL+PFGFGLTTN
Sbjct  582  ITDVLFGDYGFTGKLARTWFRTVDQLPMNVGDPHYDPLYPFGFGLTTN  629


 Score = 40.0 bits (92),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+ +DALVAAWLPGTEG G
Sbjct  559  IEPYVAQMDALVAAWLPGTEGLG  581



>ref|XP_008777967.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Phoenix 
dactylifera]
Length=661

 Score = 98.6 bits (244),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT     R +S  
Sbjct  575  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMATRSSSSA  634

Query  480  --VDKRPYFFAIALSVFIGL  427
              V K  Y     LS+++ L
Sbjct  635  RVVRKEEYCM---LSLYLSL  651


 Score = 40.0 bits (92),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  554  IEPYVPLMDALVAAWLPGSEGQG  576



>ref|XP_009801845.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=629

 Score = 96.7 bits (239),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  625


 Score = 42.0 bits (97),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+++IDALVAAWLPG+EGQG
Sbjct  557  PYLANIDALVAAWLPGSEGQG  577



>gb|AIO11756.1| beta-glucosidase [Glycine max]
Length=627

 Score = 95.5 bits (236),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMNVGD HYDPLFPFG+GLTTN
Sbjct  574  QGVADVLYGDYEFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGYGLTTN  623


 Score = 42.7 bits (99),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  553  IKPYLPKIDALVAAWLPGTEGQG  575



>ref|XP_003535890.1| PREDICTED: lysosomal beta glucosidase [Glycine max]
Length=627

 Score = 95.5 bits (236),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMNVGD HYDPLFPFG+GLTTN
Sbjct  574  QGVADVLYGDYEFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGYGLTTN  623


 Score = 42.7 bits (99),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  553  IKPYLPKIDALVAAWLPGTEGQG  575



>ref|XP_008777969.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008777970.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Phoenix 
dactylifera]
Length=564

 Score = 98.2 bits (243),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVASGG  481
            + V DVLFGDYGF+GKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT     R +S  
Sbjct  478  QGVADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKPMATRSSSSA  537

Query  480  --VDKRPYFFAIALSVFIGL  427
              V K  Y     LS+++ L
Sbjct  538  RVVRKEEYCM---LSLYLSL  554


 Score = 40.0 bits (92),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  457  IEPYVPLMDALVAAWLPGSEGQG  479



>gb|KHN45535.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score = 95.5 bits (236),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMNVGD HYDPLFPFG+GLTTN
Sbjct  575  QGVADVLYGDYEFTGKLARTWFKTVDQLPMNVGDKHYDPLFPFGYGLTTN  624


 Score = 42.7 bits (99),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  554  IKPYLPKIDALVAAWLPGTEGQG  576



>ref|XP_011077752.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=633

 Score = 95.1 bits (235),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDYGFTGKLS+TWFK VDQLPMNVGD HYDPLFPFG+GLTT 
Sbjct  579  QGVADVLYGDYGFTGKLSRTWFKNVDQLPMNVGDRHYDPLFPFGYGLTTE  628


 Score = 43.1 bits (100),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  558  IQPYLKQIDALVAAWLPGTEGQG  580



>ref|XP_008443733.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=627

 Score = 94.7 bits (234),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K +TDVLFGDYGFTGKLS+TWFKTVDQLPMN GD HYDPLFP G GLTT 
Sbjct  574  KGITDVLFGDYGFTGKLSQTWFKTVDQLPMNFGDSHYDPLFPLGHGLTTQ  623


 Score = 43.5 bits (101),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV S+DALVAAWLPGTEG+G
Sbjct  553  IQPYVDSVDALVAAWLPGTEGKG  575



>ref|XP_007141605.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
 gb|ESW13599.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
Length=627

 Score = 93.6 bits (231),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D+LFGDYGFTGKL++TWFKTV+QLPMNVGD +YDPLFPFGFGL+TN +
Sbjct  574  QGVADLLFGDYGFTGKLARTWFKTVNQLPMNVGDKYYDPLFPFGFGLSTNPT  625


 Score = 44.7 bits (104),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  553  IQPYLSKIDALVAAWLPGTEGQG  575



>ref|XP_010103976.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB97679.1| Lysosomal beta glucosidase [Morus notabilis]
Length=669

 Score = 95.1 bits (235),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS---VARVA  490
            + + DVLFGDYGFTGKL  TWF+TVDQLPMN GD HYDPLF  GFGL T S    VAR  
Sbjct  576  QGIADVLFGDYGFTGKLPMTWFRTVDQLPMNYGDPHYDPLFTLGFGLKTESVTELVARST  635

Query  489  SGGVDKRPY  463
            S G   RPY
Sbjct  636  SAGCAGRPY  644


 Score = 43.1 bits (100),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  555  IEPYLSPVDALVAAWLPGTEGQG  577



>emb|CDX92422.1| BnaA10g14610D [Brassica napus]
Length=610

 Score = 92.8 bits (229),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFK+VDQLPMNVGD  YDPL+PFGFGLTT  S
Sbjct  557  QGVADALFGDYGFTGKLARTWFKSVDQLPMNVGDQQYDPLYPFGFGLTTQPS  608


 Score = 45.4 bits (106),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  536  MEPYVSTIDALVAAWLPGTEGQG  558



>ref|XP_007145577.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
 gb|ESW17571.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
Length=627

 Score = 95.5 bits (236),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDY FTGKL++TWFK VDQLPMNVGD HYDPLFPFGFGLTTN +
Sbjct  574  QGVADVLFGDYEFTGKLARTWFKRVDQLPMNVGDKHYDPLFPFGFGLTTNPT  625


 Score = 42.7 bits (99),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  553  IQPYLPKIDALVAAWLPGTEGQG  575



>emb|CDY16581.1| BnaC09g36920D [Brassica napus]
Length=615

 Score = 92.8 bits (229),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFK+V+QLPMNVGD HYDPL+PFGFGLTT  +
Sbjct  562  QGVADALFGDYGFTGKLARTWFKSVNQLPMNVGDQHYDPLYPFGFGLTTQPA  613


 Score = 45.4 bits (106),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  541  MEPYVSTIDALVAAWLPGTEGQG  563



>gb|EPS66823.1| hypothetical protein M569_07949, partial [Genlisea aurea]
Length=627

 Score = 95.1 bits (235),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGFTGKLS+TWF++VDQLPMNVGD +YDPLFPFGFGLTT  + A
Sbjct  574  QGVADVLFGDYGFTGKLSRTWFRSVDQLPMNVGDKNYDPLFPFGFGLTTEPAEA  627


 Score = 43.1 bits (100),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPG+EGQG
Sbjct  553  IEPYISQVDALVAAWLPGSEGQG  575



>ref|XP_004228467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
lycopersicum]
Length=634

 Score = 95.5 bits (236),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + + DVLFGDYGFTGKL++TWFK VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  575  QGIADVLFGDYGFTGKLARTWFKRVDQLPMNVGDPHYDPLFPFGFGLTTQA  625


 Score = 42.4 bits (98),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DA+VAAWLPGTEGQG
Sbjct  554  IEPYVEKMDAIVAAWLPGTEGQG  576



>ref|XP_004954724.1| PREDICTED: lysosomal beta glucosidase-like [Setaria italica]
Length=663

 Score = 94.4 bits (233),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + + DVLFGDYGFTGKLS+TWF++V+QLPMNVGD HYDPLFPFGFGL T  S
Sbjct  610  QGIADVLFGDYGFTGKLSRTWFRSVEQLPMNVGDAHYDPLFPFGFGLETQPS  661


 Score = 43.5 bits (101),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ +IDALVAAWLPGTEGQG
Sbjct  589  VEPYLDAIDALVAAWLPGTEGQG  611



>dbj|BAK02950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score = 95.9 bits (237),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  572  QGVADVLFGDYGFSGKLARTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTEA  622


 Score = 41.6 bits (96),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ ++DA VAAWLPGTEGQG
Sbjct  551  VEPYIGAMDAFVAAWLPGTEGQG  573



>gb|EMT13489.1| Lysosomal beta glucosidase [Aegilops tauschii]
Length=642

 Score = 95.9 bits (237),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  590  QGVADVLFGDYGFSGKLARTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTQA  640


 Score = 42.0 bits (97),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ ++DA VAAWLPGTEGQG
Sbjct  569  VEPYIGAMDAFVAAWLPGTEGQG  591



>gb|KJB60361.1| hypothetical protein B456_009G301800 [Gossypium raimondii]
Length=678

 Score = 92.0 bits (227),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVA  490
            + VTDVL+GDY F+GKL +TWFKTVDQLPMNVGD HYDPLFP GFGL T S  + V+
Sbjct  571  QGVTDVLYGDYRFSGKLPRTWFKTVDQLPMNVGDSHYDPLFPLGFGLKTESGASIVS  627


 Score = 45.8 bits (107),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IEPYVSAIDALVAAWLPGTEGQG  572



>ref|XP_006644778.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=663

 Score = 99.0 bits (245),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGDLHYDPLFPF FGLT NSS
Sbjct  573  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDLHYDPLFPFDFGLTINSS  624


 Score = 38.9 bits (89),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ++ALVAAWLPGTEGQG
Sbjct  552  IEPYLPVMEALVAAWLPGTEGQG  574



>ref|NP_197595.2| glycosyl hydrolase family protein [Arabidopsis thaliana]
 ref|NP_851048.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AAL58902.1|AF462808_1 beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana]
 gb|AAM13848.1| putative beta-D-glucan exohydrolase [Arabidopsis thaliana]
 gb|AAN13217.1| putative beta-D-glucan exohydrolase [Arabidopsis thaliana]
 gb|AED92910.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED92911.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=624

 Score = 91.7 bits (226),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTGKL++TWFK+V QLPMNVGD HYDPL+PFGFGLTT
Sbjct  571  QGVADALFGDYGFTGKLARTWFKSVKQLPMNVGDRHYDPLYPFGFGLTT  619


 Score = 46.2 bits (108),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS+IDALVAAWLPGTEGQG
Sbjct  550  IQPYVSTIDALVAAWLPGTEGQG  572



>ref|XP_010917869.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917870.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917871.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917872.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=629

 Score = 95.1 bits (235),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V D+LFGDYGF+GKLS+TWFK VDQLPMNVGD HYDPLFPFGFGLTT  ++A
Sbjct  575  QGVADMLFGDYGFSGKLSRTWFKFVDQLPMNVGDPHYDPLFPFGFGLTTKPAMA  628


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  554  IEPYMHMIDALVAAWLPGTEGQG  576



>ref|XP_009609160.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=658

 Score = 95.5 bits (236),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D LFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  604  QGVADALFGDYGFTGKLARTWFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  653


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPG+EGQG
Sbjct  583  LEPYVEKIDALVAAWLPGSEGQG  605



>ref|XP_010917874.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Elaeis 
guineensis]
Length=589

 Score = 95.1 bits (235),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V D+LFGDYGF+GKLS+TWFK VDQLPMNVGD HYDPLFPFGFGLTT  ++A
Sbjct  535  QGVADMLFGDYGFSGKLSRTWFKFVDQLPMNVGDPHYDPLFPFGFGLTTKPAMA  588


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  514  IEPYMHMIDALVAAWLPGTEGQG  536



>ref|XP_011004424.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=614

 Score = 94.4 bits (233),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFG+TT  +
Sbjct  561  QGVADNLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPA  612


 Score = 43.1 bits (100),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  540  IQPYLEKIDALVAAWLPGTEGQG  562



>ref|XP_009609159.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=659

 Score = 95.5 bits (236),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D LFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  605  QGVADALFGDYGFTGKLARTWFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  654


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDALVAAWLPG+EGQG
Sbjct  584  LEPYVEKIDALVAAWLPGSEGQG  606



>ref|XP_010312450.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
lycopersicum]
Length=538

 Score = 95.1 bits (235),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + + DVLFGDYGFTGKL++TWFK VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  479  QGIADVLFGDYGFTGKLARTWFKRVDQLPMNVGDPHYDPLFPFGFGLTTQA  529


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DA+VAAWLPGTEGQG
Sbjct  458  IEPYVEKMDAIVAAWLPGTEGQG  480



>emb|CDP15627.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 95.9 bits (237),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVARVAS  487
            + V DVLFG YGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFG+GLTT+ +  R + 
Sbjct  573  QGVADVLFGGYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGYGLTTSPTELRASQ  630


 Score = 42.0 bits (97),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ I+ALVAAWLPGTEGQG
Sbjct  552  IEPYLAKIEALVAAWLPGTEGQG  574



>ref|XP_009588263.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=627

 Score = 96.7 bits (239),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  574  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTE  623


 Score = 40.8 bits (94),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+++I+ALVAAWLPG+EGQG
Sbjct  553  IEPYLANIEALVAAWLPGSEGQG  575



>ref|XP_006379343.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
 gb|ERP57140.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
Length=629

 Score = 94.4 bits (233),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFG+TT  +
Sbjct  576  QGVVDNLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPA  627


 Score = 43.1 bits (100),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  555  IQPYLEKIDALVAAWLPGTEGQG  577



>ref|XP_002313632.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE87587.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score = 94.4 bits (233),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFG+TT  +
Sbjct  574  QGVVDNLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPA  625


 Score = 43.1 bits (100),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  553  IQPYLEKIDALVAAWLPGTEGQG  575



>ref|XP_002453253.1| hypothetical protein SORBIDRAFT_04g002560 [Sorghum bicolor]
 gb|EES06229.1| hypothetical protein SORBIDRAFT_04g002560 [Sorghum bicolor]
Length=658

 Score = 96.7 bits (239),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V+DVLFGDYGFTGKLS+TWF++VDQLPMNVGD HYDPLFPFGFGL T  S
Sbjct  605  QGVSDVLFGDYGFTGKLSRTWFRSVDQLPMNVGDAHYDPLFPFGFGLQTQPS  656


 Score = 40.8 bits (94),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V P++  IDALVAAWLPGTEGQG
Sbjct  584  VEPFMDIIDALVAAWLPGTEGQG  606



>gb|KHN03708.1| Lysosomal beta glucosidase [Glycine soja]
Length=641

 Score = 92.4 bits (228),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMN+GD HYDPL+ FGFGLTTN
Sbjct  588  QGVADVLYGDYEFTGKLARTWFKTVDQLPMNIGDKHYDPLYSFGFGLTTN  637


 Score = 45.1 bits (105),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  567  IKPYLSKIDALVAAWLPGTEGQG  589



>emb|CDX70953.1| BnaC03g10370D [Brassica napus]
Length=656

 Score = 91.7 bits (226),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL++TWF+TVDQLPMNVGD  YDPL+PFGFG TT ++
Sbjct  602  QGVADVLFGDYGFTGKLARTWFRTVDQLPMNVGDPRYDPLYPFGFGFTTKAN  653


 Score = 45.4 bits (106),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS IDALVAAWLPGTEGQG
Sbjct  581  MQPYVSEIDALVAAWLPGTEGQG  603



>ref|XP_007151483.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
 gb|ESW23477.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
Length=628

 Score = 95.9 bits (237),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            K VTDVLFGDYGF GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGL T
Sbjct  574  KGVTDVLFGDYGFRGKLPRTWFKTVDQLPMNVGDSHYDPLFPFGFGLKT  622


 Score = 41.2 bits (95),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  I+ALVAAWLPGTEG+G
Sbjct  553  IQPYVDKIEALVAAWLPGTEGKG  575



>gb|EYU18174.1| hypothetical protein MIMGU_mgv1a002879mg [Erythranthe guttata]
Length=628

 Score = 94.4 bits (233),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGF+GKL  TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  574  QGVADVLFGDYGFSGKLPHTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTKGAKA  627


 Score = 43.1 bits (100),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  553  IGPYLAQIDALVAAWLPGTEGQG  575



>ref|XP_003519089.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score = 92.0 bits (227),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVL+GDY FTGKL++TWFKTVDQLPMN+GD HYDPL+ FGFGLTTN
Sbjct  574  QGVADVLYGDYEFTGKLARTWFKTVDQLPMNIGDKHYDPLYSFGFGLTTN  623


 Score = 45.1 bits (105),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S IDALVAAWLPGTEGQG
Sbjct  553  IKPYLSKIDALVAAWLPGTEGQG  575



>ref|NP_001130296.1| exoglucanase1 precursor [Zea mays]
 ref|XP_008664778.1| PREDICTED: exoglucanase1 isoform X1 [Zea mays]
 gb|ACF78471.1| unknown [Zea mays]
 gb|ACF78828.1| unknown [Zea mays]
 gb|ACL53568.1| unknown [Zea mays]
 gb|ACN33321.1| unknown [Zea mays]
 tpg|DAA51349.1| TPA: exoglucanase Precursor isoform 1 [Zea mays]
 tpg|DAA51350.1| TPA: exoglucanase Precursor isoform 2 [Zea mays]
 tpg|DAA51351.1| TPA: exoglucanase Precursor isoform 3 [Zea mays]
Length=622

 Score = 96.7 bits (239),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  570  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDAHYDPLFPFGFGLTTKGT  621


 Score = 40.4 bits (93),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  +DALVAAWLPG+EGQG
Sbjct  549  VEPYLGDMDALVAAWLPGSEGQG  571



>ref|XP_004242118.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=628

 Score = 94.7 bits (234),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFG+YGFTGKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  574  QGVADVLFGNYGFTGKLARTWFKSVDQLPMNVGDPHYDPLFPFGFGLTTQ  623


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PYV  ID LVAAWLPGTEGQG
Sbjct  555  PYVDKIDGLVAAWLPGTEGQG  575



>gb|EYU18175.1| hypothetical protein MIMGU_mgv1a002782mg [Erythranthe guttata]
Length=638

 Score = 96.3 bits (238),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGF+GKLS+TWFK+VDQLPMNVGD HYDPLFPFGFGLTT
Sbjct  585  QGVADVLFGDYGFSGKLSRTWFKSVDQLPMNVGDPHYDPLFPFGFGLTT  633


 Score = 40.8 bits (94),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  ID LVAAWLPGTEGQG
Sbjct  564  IGPYLGQIDGLVAAWLPGTEGQG  586



>ref|XP_010535771.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=633

 Score = 92.4 bits (228),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTGKL++TWFKTVDQLPMN GD +YDPLFPFGFGLTT 
Sbjct  576  QGVADVLFGDYGFTGKLARTWFKTVDQLPMNFGDPNYDPLFPFGFGLTTE  625


 Score = 44.3 bits (103),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PY+S IDALVAAWLPGTEGQG
Sbjct  557  PYISGIDALVAAWLPGTEGQG  577



>ref|XP_008664722.1| PREDICTED: exoglucanase1 isoform X2 [Zea mays]
 tpg|DAA51348.1| TPA: exoglucanase Precursor [Zea mays]
Length=657

 Score = 96.7 bits (239),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  605  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDAHYDPLFPFGFGLTTKGT  656


 Score = 40.4 bits (93),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  +DALVAAWLPG+EGQG
Sbjct  584  VEPYLGDMDALVAAWLPGSEGQG  606



>gb|EMT13488.1| Lysosomal beta glucosidase [Aegilops tauschii]
Length=624

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFG+YGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  572  QGVADVLFGNYGFSGKLARTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTKA  622


 Score = 43.1 bits (100),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ ++DALVAAWLPGTEGQG
Sbjct  551  VEPYIGAMDALVAAWLPGTEGQG  573



>gb|AEP33577.1| b-1,4-glucanase [Gossypium davidsonii]
 gb|AEP33578.1| b-1,4-glucanase [Gossypium klotzschianum]
Length=627

 Score = 98.2 bits (243),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + VTDVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  573  QGVTDVLFGDYGFSGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTKA  626


 Score = 38.9 bits (89),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P + S+DALVAAWLPG+EGQG
Sbjct  552  IEPDIDSMDALVAAWLPGSEGQG  574



>ref|XP_010677827.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677828.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score = 95.1 bits (235),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGK ++TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  S
Sbjct  575  QGVADALFGDYGFTGKSTRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPS  626


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS + ALVAAWLPGTEGQG
Sbjct  554  IEPYVSKMTALVAAWLPGTEGQG  576



>ref|XP_011044008.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=290

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V D LFGDYGFTGKL++TWFKTVDQLPMNVGD HYDPLFPFGFG+TT  +
Sbjct  237  QGVADNLFGDYGFTGKLARTWFKTVDQLPMNVGDPHYDPLFPFGFGITTKPA  288


 Score = 43.1 bits (100),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+  IDALVAAWLPGTEGQG
Sbjct  216  IQPYLEKIDALVAAWLPGTEGQG  238



>ref|XP_010054740.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW89890.1| hypothetical protein EUGRSUZ_A02118 [Eucalyptus grandis]
Length=631

 Score = 95.5 bits (236),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V DVLFGDYGFTGKL +TWFKTVDQLP+NVGD HYDPLFPFGFGLTT
Sbjct  577  QGVADVLFGDYGFTGKLPRTWFKTVDQLPLNVGDPHYDPLFPFGFGLTT  625


 Score = 41.6 bits (96),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+ +DA+VAAWLPGTEGQG
Sbjct  556  IQPYVAVMDAIVAAWLPGTEGQG  578



>ref|XP_002325849.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEF00231.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=621

 Score = 94.4 bits (233),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTG LS+TWFKTVDQLPMN+GD HYDPLFPFGFGL+T
Sbjct  567  QGVADALFGDYGFTGTLSRTWFKTVDQLPMNIGDQHYDPLFPFGFGLST  615


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  546  IQPYVSLMDALVAAWLPGSEGQG  568



>gb|AAC49170.1| beta-D-glucan exohydrolase, isoenzyme ExoII [Hordeum vulgare 
subsp. vulgare]
 prf||2208395A beta-D-glucan exohydrolase
Length=624

 Score = 94.7 bits (234),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGF+GKL++TWFK+ DQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  572  QGVADVLFGDYGFSGKLARTWFKSADQLPMNVGDKHYDPLFPFGFGLTTEA  622


 Score = 42.0 bits (97),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+S++DA VAAWLPG+EGQG
Sbjct  551  VEPYISAMDAFVAAWLPGSEGQG  573



>ref|XP_002319151.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE95074.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNVGD HYD LFPFG+GLTT+ +
Sbjct  573  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVGDRHYDALFPFGYGLTTDPT  624


 Score = 42.7 bits (99),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+S +DALVAAWLPGTEGQG
Sbjct  552  IQPYLSLMDALVAAWLPGTEGQG  574



>gb|AAS97960.1| cell wall beta-glucosidase [Secale cereale]
Length=624

 Score = 96.3 bits (238),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + VTD LFGDYGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT ++
Sbjct  572  QGVTDALFGDYGFSGKLARTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTEAN  623


 Score = 40.4 bits (93),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ ++DA VAAWLPG+EGQG
Sbjct  551  VEPYIGAMDAFVAAWLPGSEGQG  573



>gb|ABK95015.1| unknown [Populus trichocarpa]
Length=626

 Score = 94.4 bits (233),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTG LS+TWFKTVDQLPMN+GD HYDPLFPFGFGL+T
Sbjct  572  QGVADALFGDYGFTGTLSRTWFKTVDQLPMNIGDQHYDPLFPFGFGLST  620


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  551  IQPYVSLMDALVAAWLPGSEGQG  573



>ref|XP_006371173.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
 gb|ERP48970.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
Length=626

 Score = 94.4 bits (233),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT  514
            + V D LFGDYGFTG LS+TWFKTVDQLPMN+GD HYDPLFPFGFGL+T
Sbjct  572  QGVADALFGDYGFTGTLSRTWFKTVDQLPMNIGDQHYDPLFPFGFGLST  620


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYVS +DALVAAWLPG+EGQG
Sbjct  551  IQPYVSLMDALVAAWLPGSEGQG  573



>gb|KHN46759.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score = 92.8 bits (229),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNV D HYDPLFPFGFGL+T  +
Sbjct  574  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVEDPHYDPLFPFGFGLSTKPT  625


 Score = 43.9 bits (102),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPG+EGQG
Sbjct  553  IEPYVGSIDALVAAWLPGSEGQG  575



>ref|XP_003559563.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
 ref|XP_010229910.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
 ref|XP_010229916.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
Length=624

 Score = 94.0 bits (232),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGFTGKL++TWFK+VDQLPMNVGD  YDPLFPFGFGLTT +
Sbjct  572  QGVADVLFGDYGFTGKLARTWFKSVDQLPMNVGDKKYDPLFPFGFGLTTEA  622


 Score = 42.7 bits (99),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ +IDA VAAWLPGTEGQG
Sbjct  551  VEPYIGAIDAFVAAWLPGTEGQG  573



>ref|XP_003548467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006598970.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006598971.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
 ref|XP_006598972.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Glycine 
max]
Length=631

 Score = 92.8 bits (229),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFKTVDQLPMNV D HYDPLFPFGFGL+T  +
Sbjct  574  QGVADVLFGDYGFTGKLPRTWFKTVDQLPMNVEDPHYDPLFPFGFGLSTKPT  625


 Score = 43.9 bits (102),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPG+EGQG
Sbjct  553  IEPYVGSIDALVAAWLPGSEGQG  575



>ref|XP_008385600.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=668

 Score = 90.5 bits (223),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTT----NSSVARV  493
            + + DVL+GDYGFTGKL++TWFK VDQLPMNVGD  YDPLFP+GFGLTT    NS+ A  
Sbjct  579  QGIADVLYGDYGFTGKLARTWFKRVDQLPMNVGDKDYDPLFPYGFGLTTQPNANSTSANS  638

Query  492  ASGGVDK  472
            A     +
Sbjct  639  AGAAAPR  645


 Score = 45.8 bits (107),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY+SSIDALVAAWLPGTEGQG
Sbjct  558  MEPYISSIDALVAAWLPGTEGQG  580



>gb|EMS60525.1| Lysosomal beta glucosidase [Triticum urartu]
Length=549

 Score = 94.0 bits (232),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFG+YGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  497  QGVADVLFGNYGFSGKLARTWFKSVDQLPMNVGDKHYDPLFPFGFGLTTEA  547


 Score = 42.0 bits (97),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ + DALVAAWLPGTEGQG
Sbjct  476  VEPYIGATDALVAAWLPGTEGQG  498



>ref|XP_006367581.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=629

 Score = 95.5 bits (236),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGFTGKL++TWFK VDQLPMNVGD HYDPLFPFGFG+TT +
Sbjct  575  QGVADVLFGDYGFTGKLARTWFKRVDQLPMNVGDPHYDPLFPFGFGITTQA  625


 Score = 40.8 bits (94),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +D +VAAWLPGTEGQG
Sbjct  554  IEPYVEKMDVIVAAWLPGTEGQG  576



>ref|XP_011648555.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN66708.1| hypothetical protein Csa_1G661750 [Cucumis sativus]
Length=627

 Score = 91.7 bits (226),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            K +TDVLFGDYGFTGKLS+TWFKTVDQLPMN G+ +YDPLFPFG GLTT 
Sbjct  574  KGITDVLFGDYGFTGKLSQTWFKTVDQLPMNFGNPNYDPLFPFGHGLTTQ  623


 Score = 44.3 bits (103),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV SIDALVAAWLPGTEG+G
Sbjct  553  IQPYVDSIDALVAAWLPGTEGKG  575



>gb|ACR36695.1| unknown [Zea mays]
Length=367

 Score = 95.9 bits (237),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  315  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDAHYDPLFPFGFGLTTKGT  366


 Score = 40.4 bits (93),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  +DALVAAWLPG+EGQG
Sbjct  294  VEPYLGDMDALVAAWLPGSEGQG  316



>gb|EMT00661.1| Lysosomal beta glucosidase [Aegilops tauschii]
Length=604

 Score = 95.5 bits (236),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNS  508
            + V DVLFGDYGFTGKL +TWF++VDQLPMNVGD HYDPLFPFGFGLTT +
Sbjct  552  QGVADVLFGDYGFTGKLPRTWFRSVDQLPMNVGDEHYDPLFPFGFGLTTEA  602


 Score = 40.4 bits (93),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+ ++DA VAAWLPG+EGQG
Sbjct  531  VEPYIGAMDAFVAAWLPGSEGQG  553



>ref|XP_004970125.1| PREDICTED: lysosomal beta glucosidase-like [Setaria italica]
Length=669

 Score = 96.3 bits (238),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSV  502
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPL+PFGFGL  NSS+
Sbjct  572  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDPHYDPLYPFGFGLAINSSL  624


 Score = 39.7 bits (91),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  ++ALVAAWLPGTEGQG
Sbjct  551  IEPYVPLMEALVAAWLPGTEGQG  573



>ref|XP_006361125.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=628

 Score = 92.0 bits (227),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFG+YGFTGKL++TWF++VDQLPMNVGD HY+PLFPFGFGLTT 
Sbjct  574  QGVADVLFGEYGFTGKLARTWFRSVDQLPMNVGDPHYNPLFPFGFGLTTQ  623


 Score = 43.5 bits (101),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  718  PYVSSIDALVAAWLPGTEGQG  656
            PYV  IDALVAAWLPGTEGQG
Sbjct  555  PYVDKIDALVAAWLPGTEGQG  575



>gb|AEP33582.1| b-1,4-glucanase [Gossypium trilobum]
Length=627

 Score = 96.3 bits (238),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVA  499
            + V DVLFGDYGF+GKL +TWFKTVDQLPMNVGD HYDPLFPFGFGLTT  + A
Sbjct  573  QGVADVLFGDYGFSGKLPRTWFKTVDQLPMNVGDPHYDPLFPFGFGLTTEPTKA  626


 Score = 39.3 bits (90),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P + S+DALVAAWLPG+EGQG
Sbjct  552  IEPDIDSVDALVAAWLPGSEGQG  574



>gb|AAF79936.1| exoglucanase precursor [Zea mays]
Length=622

 Score = 96.7 bits (239),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD HYDPLFPFGFGLTT  +
Sbjct  570  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDAHYDPLFPFGFGLTTKGT  621


 Score = 38.9 bits (89),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            V PY+  +DALVA WLPG+EGQG
Sbjct  549  VEPYLGDMDALVATWLPGSEGQG  571



>ref|XP_009801866.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
sylvestris]
Length=653

 Score = 94.4 bits (233),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D LFGDYGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  599  QGVADALFGDYGFSGKLARTWFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  648


 Score = 41.2 bits (95),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDAL+AAW PGTEGQG
Sbjct  578  LEPYVEKIDALMAAWFPGTEGQG  600



>ref|XP_009801863.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
sylvestris]
Length=654

 Score = 94.0 bits (232),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V D LFGDYGF+GKL++TWFK+VDQLPMNVGD HYDPLFPFGFGLTT 
Sbjct  600  QGVADALFGDYGFSGKLARTWFKSVDQLPMNVGDRHYDPLFPFGFGLTTQ  649


 Score = 41.2 bits (95),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  IDAL+AAW PGTEGQG
Sbjct  579  LEPYVEKIDALMAAWFPGTEGQG  601



>ref|XP_002523937.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF38424.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=625

 Score = 94.0 bits (232),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKL +TWFK VDQLPMNVGD HYDPLFP+GFGLTT  +
Sbjct  571  QGVADVLFGDYGFTGKLPRTWFKYVDQLPMNVGDAHYDPLFPYGFGLTTEPT  622


 Score = 41.6 bits (96),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + P++S IDALVAAWLPG+EGQG
Sbjct  550  IEPHISPIDALVAAWLPGSEGQG  572



>ref|XP_012070425.1| PREDICTED: lysosomal beta glucosidase-like [Jatropha curcas]
 gb|KDP39683.1| hypothetical protein JCGZ_02703 [Jatropha curcas]
Length=625

 Score = 93.6 bits (231),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSS  505
            + V DVLFGDYGFTGKLS TWFKTVDQLPM VGD HYDPLFPFGFGLTT  +
Sbjct  572  QGVADVLFGDYGFTGKLSFTWFKTVDQLPMIVGDQHYDPLFPFGFGLTTEPA  623


 Score = 42.0 bits (97),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  551  MQPYMNLIDALVAAWLPGTEGQG  573



>ref|XP_008791332.1| PREDICTED: uncharacterized protein LOC103708265 [Phoenix dactylifera]
Length=384

 Score = 95.1 bits (235),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGDYGFTGKL +TWFK+VDQLPMNVGD  YDPLFPFGFGLTT    AR
Sbjct  330  QGVADVLFGDYGFTGKLPRTWFKSVDQLPMNVGDKSYDPLFPFGFGLTTKPGAAR  384


 Score = 40.0 bits (92),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV  +DALVAAWLPG+EGQG
Sbjct  309  IEPYVPMMDALVAAWLPGSEGQG  331



>gb|KJB44566.1| hypothetical protein B456_007G260100 [Gossypium raimondii]
 gb|KJB44567.1| hypothetical protein B456_007G260100 [Gossypium raimondii]
Length=632

 Score = 92.4 bits (228),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + V DVLFGD+GFTGKLS TWFKTVDQLPM+VGD HYDPLFP GFGLTT  + A+
Sbjct  578  QGVADVLFGDFGFTGKLSFTWFKTVDQLPMHVGDPHYDPLFPLGFGLTTQPAKAQ  632


 Score = 42.7 bits (99),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+SI+ALVAAWLPG+EGQG
Sbjct  557  IQPYVASIEALVAAWLPGSEGQG  579



>ref|XP_011094172.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Sesamum 
indicum]
Length=627

 Score = 92.4 bits (228),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTN  511
            + V DVLFGDYGFTG L +TWFKTVDQLPMNVGD HYDPLFPFG+GL T 
Sbjct  573  QGVADVLFGDYGFTGTLPRTWFKTVDQLPMNVGDQHYDPLFPFGYGLITE  622


 Score = 43.1 bits (100),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PY++ IDALVAAWLPGTEGQG
Sbjct  552  IQPYLAQIDALVAAWLPGTEGQG  574



>ref|XP_010917875.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917876.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=627

 Score = 93.2 bits (230),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  660  KAVTDVLFGDYGFTGKLSKTWFKTVDQLPMNVGDLHYDPLFPFGFGLTTNSSVAR  496
            + + DVLFGDYGF+GKL +TWFK+VDQLPMNVGD  YDPLFPFGFGLTT    AR
Sbjct  573  QGIADVLFGDYGFSGKLPRTWFKSVDQLPMNVGDKSYDPLFPFGFGLTTKPRAAR  627


 Score = 42.4 bits (98),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  724  VXPYVSSIDALVAAWLPGTEGQG  656
            + PYV+ IDALVAAWLPG+EGQG
Sbjct  552  IEPYVTLIDALVAAWLPGSEGQG  574



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616