BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4366

Length=1406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609950.1|  PREDICTED: secretory carrier-associated memb...    442   2e-150   Nicotiana tomentosiformis
emb|CDP11723.1|  unnamed protein product                                439   1e-149   Coffea canephora [robusta coffee]
ref|XP_009797975.1|  PREDICTED: secretory carrier-associated memb...    438   5e-149   Nicotiana sylvestris
ref|XP_009609041.1|  PREDICTED: secretory carrier-associated memb...    438   6e-149   Nicotiana tomentosiformis
ref|XP_006352923.1|  PREDICTED: secretory carrier-associated memb...    434   1e-147   Solanum tuberosum [potatoes]
ref|XP_010325581.1|  PREDICTED: secretory carrier-associated memb...    431   5e-146   
ref|XP_010276767.1|  PREDICTED: secretory carrier-associated memb...    424   1e-143   Nelumbo nucifera [Indian lotus]
ref|NP_001241252.1|  uncharacterized protein LOC100806586               422   1e-142   Glycine max [soybeans]
ref|NP_001241214.1|  uncharacterized protein LOC100780723               419   1e-141   Glycine max [soybeans]
ref|XP_009609951.1|  PREDICTED: secretory carrier-associated memb...    417   6e-141   
ref|XP_011082326.1|  PREDICTED: secretory carrier-associated memb...    417   7e-141   Sesamum indicum [beniseed]
ref|XP_009766029.1|  PREDICTED: secretory carrier-associated memb...    413   1e-139   Nicotiana sylvestris
ref|XP_008356443.1|  PREDICTED: secretory carrier-associated memb...    414   2e-139   Malus domestica [apple tree]
ref|XP_009797982.1|  PREDICTED: secretory carrier-associated memb...    414   2e-139   Nicotiana sylvestris
ref|XP_010261621.1|  PREDICTED: secretory carrier-associated memb...    413   3e-139   Nelumbo nucifera [Indian lotus]
gb|AFK41920.1|  unknown                                                 412   6e-139   Lotus japonicus
ref|XP_009373510.1|  PREDICTED: secretory carrier-associated memb...    412   8e-139   Pyrus x bretschneideri [bai li]
gb|EYU23286.1|  hypothetical protein MIMGU_mgv1a011911mg                410   3e-138   Erythranthe guttata [common monkey flower]
ref|XP_008448620.1|  PREDICTED: secretory carrier-associated memb...    403   2e-135   Cucumis melo [Oriental melon]
ref|XP_008356444.1|  PREDICTED: secretory carrier-associated memb...    401   1e-134   
ref|XP_003612685.1|  Secretory carrier-associated membrane protein      401   1e-134   Medicago truncatula
ref|XP_004146111.1|  PREDICTED: secretory carrier-associated memb...    401   2e-134   Cucumis sativus [cucumbers]
ref|XP_011074780.1|  PREDICTED: secretory carrier-associated memb...    400   2e-134   Sesamum indicum [beniseed]
ref|XP_004512452.1|  PREDICTED: secretory carrier-associated memb...    399   7e-134   Cicer arietinum [garbanzo]
ref|XP_011465082.1|  PREDICTED: secretory carrier-associated memb...    399   8e-134   Fragaria vesca subsp. vesca
ref|XP_007158207.1|  hypothetical protein PHAVU_002G133200g             398   2e-133   Phaseolus vulgaris [French bean]
ref|XP_011028089.1|  PREDICTED: secretory carrier-associated memb...    397   8e-133   Populus euphratica
ref|XP_008238130.1|  PREDICTED: secretory carrier-associated memb...    397   8e-133   Prunus mume [ume]
ref|XP_012069332.1|  PREDICTED: secretory carrier-associated memb...    396   1e-132   Jatropha curcas
ref|XP_002303454.1|  secretory carrier membrane family protein          395   2e-132   Populus trichocarpa [western balsam poplar]
gb|AFK40014.1|  unknown                                                 395   3e-132   Medicago truncatula
ref|XP_007209463.1|  hypothetical protein PRUPE_ppa009893mg             395   5e-132   Prunus persica
ref|XP_002274060.1|  PREDICTED: secretory carrier-associated memb...    394   1e-131   Vitis vinifera
ref|XP_011018450.1|  PREDICTED: secretory carrier-associated memb...    393   3e-131   Populus euphratica
ref|XP_007040767.1|  SCAMP family protein isoform 1                     391   9e-131   Theobroma cacao [chocolate]
ref|XP_002519001.1|  secretory carrier membrane protein, putative       391   1e-130   Ricinus communis
ref|XP_006368327.1|  hypothetical protein POPTR_0001s01640g             390   3e-130   
ref|XP_006432645.1|  hypothetical protein CICLE_v10002151mg             389   6e-130   Citrus clementina [clementine]
ref|XP_008788581.1|  PREDICTED: LOW QUALITY PROTEIN: secretory ca...    388   2e-129   Phoenix dactylifera
ref|XP_010540734.1|  PREDICTED: secretory carrier-associated memb...    387   7e-129   Tarenaya hassleriana [spider flower]
ref|XP_006368326.1|  secretory carrier membrane family protein          385   2e-128   
ref|XP_009385714.1|  PREDICTED: secretory carrier-associated memb...    385   3e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010054106.1|  PREDICTED: secretory carrier-associated memb...    385   4e-128   Eucalyptus grandis [rose gum]
ref|XP_010054107.1|  PREDICTED: secretory carrier-associated memb...    384   6e-128   Eucalyptus grandis [rose gum]
ref|XP_009408101.1|  PREDICTED: secretory carrier-associated memb...    384   8e-128   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61281.1|  secretory carrier-associated membrane protein 2         383   2e-127   Genlisea aurea
ref|XP_011465083.1|  PREDICTED: secretory carrier-associated memb...    382   2e-127   Fragaria vesca subsp. vesca
ref|XP_007040770.1|  SCAMP family protein isoform 4                     382   7e-127   
ref|XP_007040768.1|  SCAMP family protein isoform 2                     379   6e-126   
ref|XP_011626934.1|  PREDICTED: secretory carrier-associated memb...    379   9e-126   Amborella trichopoda
ref|XP_009347089.1|  PREDICTED: secretory carrier-associated memb...    378   1e-125   
gb|ERN15563.1|  hypothetical protein AMTR_s00048p00135190               379   1e-125   Amborella trichopoda
ref|XP_006415261.1|  hypothetical protein EUTSA_v10008500mg             378   2e-125   Eutrema salsugineum [saltwater cress]
ref|XP_009385715.1|  PREDICTED: secretory carrier-associated memb...    377   3e-125   
ref|XP_009108000.1|  PREDICTED: secretory carrier-associated memb...    375   2e-124   Brassica rapa
emb|CDY41746.1|  BnaA08g07010D                                          374   6e-124   Brassica napus [oilseed rape]
ref|XP_009409813.1|  PREDICTED: secretory carrier-associated memb...    373   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008809221.1|  PREDICTED: secretory carrier-associated memb...    373   2e-123   Phoenix dactylifera
ref|XP_010461024.1|  PREDICTED: secretory carrier-associated memb...    371   5e-123   Camelina sativa [gold-of-pleasure]
ref|XP_002890966.1|  secretory carrier membrane protein family pr...    371   7e-123   
ref|XP_009145216.1|  PREDICTED: secretory carrier-associated memb...    371   8e-123   Brassica rapa
ref|XP_009107999.1|  PREDICTED: secretory carrier-associated memb...    370   1e-122   Brassica rapa
emb|CDY35537.1|  BnaA05g16490D                                          370   1e-122   Brassica napus [oilseed rape]
gb|KHG14384.1|  Secretory carrier-associated membrane 4 -like pro...    370   2e-122   Gossypium arboreum [tree cotton]
ref|XP_010499749.1|  PREDICTED: secretory carrier-associated memb...    369   5e-122   Camelina sativa [gold-of-pleasure]
emb|CDY29930.1|  BnaC05g29060D                                          369   8e-122   Brassica napus [oilseed rape]
ref|XP_006304101.1|  hypothetical protein CARUB_v10010029mg             368   9e-122   Capsella rubella
gb|KFK44964.1|  hypothetical protein AALP_AA1G326500                    368   1e-121   Arabis alpina [alpine rockcress]
ref|XP_010518929.1|  PREDICTED: secretory carrier-associated memb...    367   2e-121   Tarenaya hassleriana [spider flower]
ref|XP_010478622.1|  PREDICTED: secretory carrier-associated memb...    366   9e-121   Camelina sativa [gold-of-pleasure]
ref|NP_174485.1|  secretory carrier-associated membrane protein 5       365   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933401.1|  PREDICTED: secretory carrier-associated memb...    364   3e-120   Elaeis guineensis
dbj|BAH20345.1|  AT1G32050                                              363   6e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943453.1|  PREDICTED: secretory carrier-associated memb...    361   8e-119   Elaeis guineensis
gb|KCW78482.1|  hypothetical protein EUGRSUZ_D02626                     361   1e-118   Eucalyptus grandis [rose gum]
ref|XP_009609952.1|  PREDICTED: secretory carrier-associated memb...    355   3e-117   Nicotiana tomentosiformis
ref|XP_009385716.1|  PREDICTED: secretory carrier-associated memb...    356   4e-117   
ref|XP_009797991.1|  PREDICTED: secretory carrier-associated memb...    353   4e-116   Nicotiana sylvestris
ref|XP_009143658.1|  PREDICTED: secretory carrier-associated memb...    353   4e-116   Brassica rapa
ref|XP_006415260.1|  hypothetical protein EUTSA_v10008500mg             352   9e-116   
emb|CDY31700.1|  BnaA05g08470D                                          355   3e-115   Brassica napus [oilseed rape]
emb|CDY51816.1|  BnaC04g53720D                                          351   4e-115   Brassica napus [oilseed rape]
ref|XP_010677419.1|  PREDICTED: secretory carrier-associated memb...    350   6e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006410715.1|  hypothetical protein EUTSA_v10017084mg             347   3e-113   Eutrema salsugineum [saltwater cress]
gb|KFK36422.1|  hypothetical protein AALP_AA4G122300                    346   4e-113   Arabis alpina [alpine rockcress]
ref|XP_010276769.1|  PREDICTED: secretory carrier-associated memb...    340   1e-111   Nelumbo nucifera [Indian lotus]
ref|XP_010538352.1|  PREDICTED: secretory carrier-associated memb...    342   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_010920031.1|  PREDICTED: secretory carrier-associated memb...    339   5e-111   
gb|KCW78483.1|  hypothetical protein EUGRSUZ_D02626                     337   6e-110   Eucalyptus grandis [rose gum]
ref|NP_001131434.1|  uncharacterized protein LOC100192766               334   2e-108   Zea mays [maize]
dbj|BAH20435.1|  AT1G32050                                              329   5e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70756.1|  BnaCnng69680D                                          325   2e-105   Brassica napus [oilseed rape]
ref|XP_006652741.1|  PREDICTED: secretory carrier-associated memb...    325   7e-105   Oryza brachyantha
ref|NP_001053734.1|  Os04g0595800                                       325   8e-105   
ref|XP_003570157.1|  PREDICTED: secretory carrier-associated memb...    322   2e-103   Brachypodium distachyon [annual false brome]
ref|XP_004976669.1|  PREDICTED: secretory carrier-associated memb...    320   1e-102   Setaria italica
ref|XP_006582947.1|  PREDICTED: uncharacterized protein LOC100815...    319   1e-102   
ref|XP_002448450.1|  hypothetical protein SORBIDRAFT_06g027280          318   5e-102   Sorghum bicolor [broomcorn]
ref|NP_001242258.1|  uncharacterized protein LOC100815455               318   9e-102   Glycine max [soybeans]
ref|XP_002278442.1|  PREDICTED: secretory carrier-associated memb...    318   1e-101   Vitis vinifera
gb|KDO75797.1|  hypothetical protein CISIN_1g019268mg                   317   1e-101   Citrus sinensis [apfelsine]
gb|EMS63153.1|  Secretory carrier-associated membrane protein 6         316   2e-101   Triticum urartu
dbj|BAK03193.1|  predicted protein                                      316   4e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004293544.1|  PREDICTED: secretory carrier-associated memb...    317   4e-101   Fragaria vesca subsp. vesca
ref|XP_002862723.1|  secretory carrier membrane protein family pr...    315   6e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_007159268.1|  hypothetical protein PHAVU_002G223700g             315   8e-101   Phaseolus vulgaris [French bean]
ref|XP_009378157.1|  PREDICTED: secretory carrier-associated memb...    315   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_003593475.1|  Secretory carrier-associated membrane protein      315   1e-100   Medicago truncatula
ref|XP_003527448.1|  PREDICTED: secretory carrier-associated memb...    315   1e-100   Glycine max [soybeans]
ref|XP_008371308.1|  PREDICTED: secretory carrier-associated memb...    315   2e-100   
ref|XP_010547267.1|  PREDICTED: secretory carrier-associated memb...    314   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_003580430.1|  PREDICTED: secretory carrier-associated memb...    313   5e-100   Brachypodium distachyon [annual false brome]
ref|XP_006467870.1|  PREDICTED: putative secretory carrier-associ...    314   8e-100   Citrus sinensis [apfelsine]
ref|XP_008224978.1|  PREDICTED: secretory carrier-associated memb...    313   1e-99    Prunus mume [ume]
gb|ABV68807.1|  putative secretory carrier membrane protein             312   1e-99    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009378095.1|  PREDICTED: secretory carrier-associated memb...    312   2e-99    Pyrus x bretschneideri [bai li]
gb|ACJ84609.1|  unknown                                                 311   2e-99    Medicago truncatula
ref|XP_007211759.1|  hypothetical protein PRUPE_ppa009511mg             311   4e-99    Prunus persica
ref|XP_010646776.1|  PREDICTED: secretory carrier-associated memb...    311   7e-99    Vitis vinifera
ref|NP_001185278.1|  secretory carrier-associated membrane protein 3    309   1e-98    Arabidopsis thaliana [mouse-ear cress]
sp|Q6Z8F5.1|SCAM5_ORYSJ  RecName: Full=Secretory carrier-associat...    308   5e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KHN41148.1|  Putative secretory carrier-associated membrane pr...    308   1e-97    Glycine soja [wild soybean]
ref|XP_008383801.1|  PREDICTED: secretory carrier-associated memb...    307   1e-97    
ref|XP_004970184.1|  PREDICTED: secretory carrier-associated memb...    306   3e-97    Setaria italica
ref|XP_006449256.1|  hypothetical protein CICLE_v10016025mg             307   4e-97    Citrus clementina [clementine]
gb|KJB57596.1|  hypothetical protein B456_009G171800                    306   6e-97    Gossypium raimondii
gb|ACU17661.1|  unknown                                                 306   6e-97    Glycine max [soybeans]
ref|XP_006582946.1|  PREDICTED: uncharacterized protein LOC100815...    306   6e-97    Glycine max [soybeans]
ref|XP_006841748.1|  PREDICTED: secretory carrier-associated memb...    305   6e-97    Amborella trichopoda
ref|XP_006305476.1|  hypothetical protein CARUB_v10009907mg             305   1e-96    Capsella rubella
ref|XP_007040769.1|  Secretory carrier-associated membrane protei...    302   1e-96    
ref|NP_001150198.1|  SC3 protein                                        304   2e-96    Zea mays [maize]
ref|XP_008383800.1|  PREDICTED: secretory carrier-associated memb...    304   2e-96    
gb|KJB21179.1|  hypothetical protein B456_003G186500                    301   4e-96    Gossypium raimondii
ref|NP_176320.1|  secretory carrier-associated membrane protein 3       303   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545859.1|  PREDICTED: secretory carrier-associated memb...    304   6e-96    Glycine max [soybeans]
ref|XP_004953550.1|  PREDICTED: secretory carrier-associated memb...    302   7e-96    Setaria italica
ref|XP_004243323.1|  PREDICTED: secretory carrier-associated memb...    302   9e-96    Solanum lycopersicum
gb|EEC73835.1|  hypothetical protein OsI_08573                          307   9e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_009397788.1|  PREDICTED: secretory carrier-associated memb...    303   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ24280.1|  hypothetical protein OsJ_08031                          306   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809919.1|  PREDICTED: secretory carrier-associated memb...    302   2e-95    Phoenix dactylifera
gb|ABK21450.1|  unknown                                                 302   2e-95    Picea sitchensis
ref|XP_007025745.1|  Secretory carrier 3 isoform 2                      302   3e-95    
ref|XP_006357524.1|  PREDICTED: secretory carrier-associated memb...    301   4e-95    Solanum tuberosum [potatoes]
gb|EYU29071.1|  hypothetical protein MIMGU_mgv1a013821mg                298   5e-95    Erythranthe guttata [common monkey flower]
ref|XP_010905287.1|  PREDICTED: secretory carrier-associated memb...    301   8e-95    Elaeis guineensis
ref|XP_008810165.1|  PREDICTED: secretory carrier-associated memb...    298   8e-95    
ref|XP_007148222.1|  hypothetical protein PHAVU_006G190200g             300   2e-94    Phaseolus vulgaris [French bean]
ref|XP_008672884.1|  PREDICTED: LOC100282807 isoform X1                 299   2e-94    
ref|XP_010492493.1|  PREDICTED: secretory carrier-associated memb...    299   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010458504.1|  PREDICTED: secretory carrier-associated memb...    298   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010476025.1|  PREDICTED: secretory carrier-associated memb...    298   4e-94    Camelina sativa [gold-of-pleasure]
ref|NP_001149185.1|  LOC100282807                                       298   5e-94    
ref|XP_002888095.1|  hypothetical protein ARALYDRAFT_475195             298   5e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_006417383.1|  hypothetical protein EUTSA_v10008358mg             298   6e-94    Eutrema salsugineum [saltwater cress]
ref|XP_002316646.2|  SCAMP37 family protein                             298   9e-94    Populus trichocarpa [western balsam poplar]
ref|XP_012091529.1|  PREDICTED: secretory carrier-associated memb...    298   9e-94    Jatropha curcas
ref|XP_004504993.1|  PREDICTED: secretory carrier-associated memb...    296   2e-93    Cicer arietinum [garbanzo]
ref|XP_009104571.1|  PREDICTED: secretory carrier-associated memb...    296   2e-93    Brassica rapa
ref|XP_010035696.1|  PREDICTED: secretory carrier-associated memb...    297   3e-93    Eucalyptus grandis [rose gum]
ref|XP_002881402.1|  predicted protein                                  296   3e-93    
ref|XP_011622325.1|  PREDICTED: secretory carrier-associated memb...    296   5e-93    Amborella trichopoda
emb|CDY52219.1|  BnaA01g35910D                                          295   5e-93    Brassica napus [oilseed rape]
ref|XP_006392026.1|  hypothetical protein EUTSA_v10023622mg             295   1e-92    Eutrema salsugineum [saltwater cress]
ref|NP_001241001.1|  uncharacterized protein LOC100795535               294   1e-92    Glycine max [soybeans]
gb|KDO75796.1|  hypothetical protein CISIN_1g019268mg                   296   1e-92    Citrus sinensis [apfelsine]
ref|XP_002521417.1|  secretory carrier membrane protein, putative       295   2e-92    Ricinus communis
emb|CDY03815.1|  BnaC01g29320D                                          294   2e-92    
ref|XP_002889854.1|  secretory carrier membrane protein family pr...    293   4e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_003593476.1|  Secretory carrier-associated membrane protein      293   4e-92    
ref|XP_011043254.1|  PREDICTED: secretory carrier-associated memb...    293   5e-92    Populus euphratica
ref|XP_011027922.1|  PREDICTED: secretory carrier-associated memb...    293   6e-92    Populus euphratica
dbj|BAJ86707.1|  predicted protein                                      292   7e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004485722.1|  PREDICTED: secretory carrier-associated memb...    292   9e-92    Cicer arietinum [garbanzo]
ref|XP_010268786.1|  PREDICTED: secretory carrier-associated memb...    292   1e-91    Nelumbo nucifera [Indian lotus]
gb|KHN08571.1|  Secretory carrier-associated membrane protein 1         293   1e-91    Glycine soja [wild soybean]
ref|XP_009416073.1|  PREDICTED: secretory carrier-associated memb...    293   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007132643.1|  hypothetical protein PHAVU_011G112500g             292   2e-91    Phaseolus vulgaris [French bean]
emb|CBI18594.3|  unnamed protein product                                291   2e-91    Vitis vinifera
gb|AFW59324.1|  hypothetical protein ZEAMMB73_850428                    288   3e-91    
gb|EMT26496.1|  Secretory carrier-associated membrane protein 6         288   3e-91    
ref|XP_008455345.1|  PREDICTED: secretory carrier-associated memb...    291   3e-91    Cucumis melo [Oriental melon]
gb|ACU54988.1|  secretory carrier membrane protein                      290   3e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006647732.1|  PREDICTED: secretory carrier-associated memb...    288   4e-91    
ref|XP_004136814.1|  PREDICTED: secretory carrier-associated memb...    290   4e-91    Cucumis sativus [cucumbers]
ref|XP_011086081.1|  PREDICTED: secretory carrier-associated memb...    291   4e-91    Sesamum indicum [beniseed]
ref|XP_007025744.1|  Secretory carrier-associated membrane protei...    293   4e-91    
gb|KDO75798.1|  hypothetical protein CISIN_1g019268mg                   290   6e-91    Citrus sinensis [apfelsine]
ref|NP_172584.1|  secretory carrier-associated membrane protein 5       290   6e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KHN22909.1|  Putative secretory carrier-associated membrane pr...    290   1e-90    Glycine soja [wild soybean]
gb|KJB57603.1|  hypothetical protein B456_009G171800                    290   1e-90    Gossypium raimondii
gb|KJB66654.1|  hypothetical protein B456_010G150400                    290   1e-90    Gossypium raimondii
emb|CDY67793.1|  BnaCnng56430D                                          289   2e-90    Brassica napus [oilseed rape]
ref|XP_012088340.1|  PREDICTED: secretory carrier-associated memb...    290   2e-90    Jatropha curcas
gb|KJB57602.1|  hypothetical protein B456_009G171800                    289   2e-90    Gossypium raimondii
ref|XP_009148449.1|  PREDICTED: secretory carrier-associated memb...    289   2e-90    Brassica rapa
gb|KFK43410.1|  hypothetical protein AALP_AA1G122300                    289   2e-90    Arabis alpina [alpine rockcress]
ref|NP_001158996.1|  SC3 protein                                        289   3e-90    Zea mays [maize]
ref|XP_011096286.1|  PREDICTED: secretory carrier-associated memb...    288   4e-90    Sesamum indicum [beniseed]
gb|AFK40454.1|  unknown                                                 288   5e-90    Lotus japonicus
ref|XP_010905603.1|  PREDICTED: secretory carrier-associated memb...    287   6e-90    
ref|XP_010689702.1|  PREDICTED: secretory carrier-associated memb...    288   8e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010905601.1|  PREDICTED: secretory carrier-associated memb...    288   1e-89    
emb|CDO99609.1|  unnamed protein product                                287   1e-89    Coffea canephora [robusta coffee]
ref|XP_010931924.1|  PREDICTED: secretory carrier-associated memb...    286   1e-89    Elaeis guineensis
ref|XP_010278340.1|  PREDICTED: secretory carrier-associated memb...    287   2e-89    Nelumbo nucifera [Indian lotus]
ref|XP_009416074.1|  PREDICTED: secretory carrier-associated memb...    286   3e-89    
ref|XP_009603718.1|  PREDICTED: secretory carrier-associated memb...    286   3e-89    Nicotiana tomentosiformis
ref|XP_002305668.2|  hypothetical protein POPTR_0004s03680g             285   4e-89    
ref|XP_004232822.1|  PREDICTED: secretory carrier-associated memb...    286   4e-89    Solanum lycopersicum
ref|NP_001184960.1|  secretory carrier-associated membrane protein 5    286   5e-89    
ref|XP_006644801.1|  PREDICTED: secretory carrier-associated memb...    285   6e-89    Oryza brachyantha
emb|CAE05478.1|  OSJNBa0006A01.24                                       283   6e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004504992.1|  PREDICTED: secretory carrier-associated memb...    286   7e-89    Cicer arietinum [garbanzo]
ref|NP_001044437.1|  Os01g0780500                                       285   9e-89    
ref|NP_001242096.1|  uncharacterized protein LOC100796729               285   1e-88    
gb|EYU43399.1|  hypothetical protein MIMGU_mgv1a010567mg                285   2e-88    Erythranthe guttata [common monkey flower]
sp|A2YMP7.1|SCAM1_ORYSI  RecName: Full=Putative secretory carrier...    284   2e-88    Oryza sativa Indica Group [Indian rice]
ref|NP_001060004.1|  Os07g0564600                                       284   3e-88    
ref|XP_009623077.1|  PREDICTED: secretory carrier-associated memb...    283   4e-88    Nicotiana tomentosiformis
gb|KEH29623.1|  secretory carrier-associated membrane protein           283   4e-88    Medicago truncatula
ref|XP_003568158.1|  PREDICTED: secretory carrier-associated memb...    282   5e-88    Brachypodium distachyon [annual false brome]
emb|CDY12892.1|  BnaA09g13820D                                          282   9e-88    Brassica napus [oilseed rape]
ref|XP_010540860.1|  PREDICTED: secretory carrier-associated memb...    281   1e-87    Tarenaya hassleriana [spider flower]
gb|KFK40463.1|  hypothetical protein AALP_AA3G376300                    286   1e-87    Arabis alpina [alpine rockcress]
ref|XP_009113142.1|  PREDICTED: secretory carrier-associated memb...    282   1e-87    Brassica rapa
ref|XP_010657282.1|  PREDICTED: secretory carrier-associated memb...    280   1e-87    Vitis vinifera
emb|CDY40956.1|  BnaCnng09990D                                          281   1e-87    Brassica napus [oilseed rape]
ref|XP_010418095.1|  PREDICTED: secretory carrier-associated memb...    281   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010430139.1|  PREDICTED: secretory carrier-associated memb...    281   2e-87    Camelina sativa [gold-of-pleasure]
sp|Q9ZTX0.1|SCAM_PEA  RecName: Full=Secretory carrier-associated ...    281   3e-87    Pisum sativum [garden pea]
ref|XP_009763334.1|  PREDICTED: secretory carrier-associated memb...    281   3e-87    Nicotiana sylvestris
ref|XP_004251795.1|  PREDICTED: secretory carrier-associated memb...    281   3e-87    Solanum lycopersicum
gb|EMS49280.1|  Secretory carrier-associated membrane protein 3         280   4e-87    Triticum urartu
ref|XP_007043517.1|  Secretory carrier membrane protein (SCAMP) f...    279   6e-87    
ref|XP_009767609.1|  PREDICTED: secretory carrier-associated memb...    280   7e-87    Nicotiana sylvestris
ref|XP_006347094.1|  PREDICTED: putative secretory carrier-associ...    280   7e-87    Solanum tuberosum [potatoes]
ref|XP_004134729.1|  PREDICTED: secretory carrier-associated memb...    280   8e-87    Cucumis sativus [cucumbers]
ref|XP_011039763.1|  PREDICTED: secretory carrier-associated memb...    279   1e-86    Populus euphratica
ref|XP_004507204.1|  PREDICTED: secretory carrier-associated memb...    280   1e-86    Cicer arietinum [garbanzo]
gb|ADE77955.1|  unknown                                                 280   1e-86    Picea sitchensis
ref|XP_008439906.1|  PREDICTED: secretory carrier-associated memb...    279   2e-86    Cucumis melo [Oriental melon]
ref|XP_010057474.1|  PREDICTED: secretory carrier-associated memb...    279   2e-86    Eucalyptus grandis [rose gum]
ref|XP_008800152.1|  PREDICTED: secretory carrier-associated memb...    279   2e-86    Phoenix dactylifera
ref|XP_010931923.1|  PREDICTED: secretory carrier-associated memb...    279   2e-86    Elaeis guineensis
emb|CDY15009.1|  BnaCnng04120D                                          278   2e-86    Brassica napus [oilseed rape]
gb|EYU27957.1|  hypothetical protein MIMGU_mgv1a010497mg                279   3e-86    Erythranthe guttata [common monkey flower]
ref|XP_006371596.1|  secretory carrier membrane family protein          278   3e-86    Populus trichocarpa [western balsam poplar]
ref|XP_006350043.1|  PREDICTED: putative secretory carrier-associ...    278   4e-86    Solanum tuberosum [potatoes]
gb|ACU54987.1|  secretory carrier membrane protein                      277   6e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007043516.1|  Secretory carrier membrane protein (SCAMP) f...    277   6e-86    
ref|XP_010473333.1|  PREDICTED: secretory carrier-associated memb...    277   8e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006409023.1|  hypothetical protein EUTSA_v10002062mg             276   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_003564355.1|  PREDICTED: secretory carrier-associated memb...    276   1e-85    Brachypodium distachyon [annual false brome]
ref|XP_008809920.1|  PREDICTED: secretory carrier-associated memb...    276   1e-85    Phoenix dactylifera
gb|EMT19016.1|  Secretory carrier-associated membrane protein 3         277   1e-85    
ref|XP_007043515.1|  Secretory carrier-associated membrane protei...    276   2e-85    Theobroma cacao [chocolate]
ref|XP_006299951.1|  hypothetical protein CARUB_v10016164mg             276   2e-85    Capsella rubella
gb|EYU29072.1|  hypothetical protein MIMGU_mgv1a013821mg                272   3e-85    Erythranthe guttata [common monkey flower]
ref|XP_009770346.1|  PREDICTED: secretory carrier-associated memb...    275   4e-85    Nicotiana sylvestris
ref|XP_006409022.1|  hypothetical protein EUTSA_v10002062mg             274   5e-85    
ref|XP_009625938.1|  PREDICTED: secretory carrier-associated memb...    275   5e-85    Nicotiana tomentosiformis
ref|XP_006302612.1|  hypothetical protein CARUB_v10020717mg             275   8e-85    
ref|XP_006302611.1|  hypothetical protein CARUB_v10020717mg             274   8e-85    Capsella rubella
ref|XP_010522639.1|  PREDICTED: secretory carrier-associated memb...    274   9e-85    Tarenaya hassleriana [spider flower]
gb|KHN04277.1|  Putative secretory carrier-associated membrane pr...    274   1e-84    Glycine soja [wild soybean]
ref|XP_010556826.1|  PREDICTED: secretory carrier-associated memb...    274   1e-84    Tarenaya hassleriana [spider flower]
gb|KJB12426.1|  hypothetical protein B456_002G017400                    273   1e-84    Gossypium raimondii
ref|XP_008230235.1|  PREDICTED: secretory carrier-associated memb...    273   2e-84    Prunus mume [ume]
emb|CDX84109.1|  BnaC08g07860D                                          270   3e-84    
ref|XP_008356126.1|  PREDICTED: secretory carrier-associated memb...    273   3e-84    Malus domestica [apple tree]
ref|XP_009382520.1|  PREDICTED: secretory carrier-associated memb...    272   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003541920.1|  PREDICTED: secretory carrier-associated memb...    273   4e-84    Glycine max [soybeans]
ref|XP_003562337.1|  PREDICTED: secretory carrier-associated memb...    273   4e-84    Brachypodium distachyon [annual false brome]
ref|XP_006306523.1|  hypothetical protein CARUB_v10012530mg             272   5e-84    Capsella rubella
ref|XP_002517970.1|  secretory carrier membrane protein, putative       273   5e-84    Ricinus communis
gb|AGV54380.1|  secretory carrier-associated membrane protein           274   5e-84    Phaseolus vulgaris [French bean]
ref|XP_003540348.1|  PREDICTED: secretory carrier-associated memb...    272   5e-84    Glycine max [soybeans]
ref|XP_006418225.1|  hypothetical protein EUTSA_v10008409mg             272   5e-84    
ref|NP_001150460.1|  SC3 protein                                        273   6e-84    
ref|XP_002443907.1|  hypothetical protein SORBIDRAFT_07g004140          271   6e-84    
ref|XP_009386891.1|  PREDICTED: secretory carrier-associated memb...    271   6e-84    
ref|XP_002464295.1|  hypothetical protein SORBIDRAFT_01g015740          273   6e-84    
ref|XP_009351450.1|  PREDICTED: secretory carrier-associated memb...    272   6e-84    
gb|AFW72925.1|  hypothetical protein ZEAMMB73_428430                    269   8e-84    
ref|XP_009357086.1|  PREDICTED: secretory carrier-associated memb...    271   8e-84    
ref|XP_009357084.1|  PREDICTED: secretory carrier-associated memb...    271   9e-84    
emb|CDM83144.1|  unnamed protein product                                271   1e-83    
ref|XP_002886310.1|  secretory carrier membrane protein family pr...    271   1e-83    
ref|XP_010095812.1|  Secretory carrier-associated membrane protein 1    270   1e-83    
ref|XP_011100350.1|  PREDICTED: secretory carrier-associated memb...    271   2e-83    
gb|AES90385.2|  secretory carrier-associated membrane protein           272   2e-83    
ref|XP_010040736.1|  PREDICTED: secretory carrier-associated memb...    271   2e-83    
gb|ACN25561.1|  unknown                                                 271   2e-83    
ref|XP_010467760.1|  PREDICTED: secretory carrier-associated memb...    270   2e-83    
ref|XP_007132644.1|  hypothetical protein PHAVU_011G112500g             270   3e-83    
ref|NP_001050560.1|  Os03g0582200                                       271   3e-83    
gb|EYU26117.1|  hypothetical protein MIMGU_mgv1a010775mg                271   3e-83    
ref|XP_009119533.1|  PREDICTED: secretory carrier-associated memb...    270   3e-83    
ref|XP_010482193.1|  PREDICTED: LOW QUALITY PROTEIN: secretory ca...    270   4e-83    
emb|CDX89883.1|  BnaA10g01990D                                          270   4e-83    
ref|XP_006650274.1|  PREDICTED: secretory carrier-associated memb...    271   4e-83    
gb|KHG03403.1|  Secretory carrier-associated membrane 1 -like pro...    270   4e-83    
ref|NP_001151958.1|  LOC100285595                                       271   5e-83    
gb|ACJ84619.1|  unknown                                                 270   5e-83    
ref|XP_009357085.1|  PREDICTED: secretory carrier-associated memb...    269   6e-83    
ref|NP_001150993.1|  LOC100284626                                       269   6e-83    
ref|XP_012091530.1|  PREDICTED: uncharacterized protein LOC105649...    280   7e-83    
ref|XP_002441344.1|  hypothetical protein SORBIDRAFT_09g024810          269   9e-83    
ref|XP_008678255.1|  PREDICTED: secretory carrier-associated memb...    268   1e-82    
ref|XP_004982516.1|  PREDICTED: secretory carrier-associated memb...    270   1e-82    
ref|XP_006657843.1|  PREDICTED: putative secretory carrier-associ...    269   1e-82    
ref|NP_179680.1|  secretory carrier-associated membrane protein 1       268   2e-82    
emb|CDY51097.1|  BnaCnng20000D                                          268   2e-82    
ref|XP_010696587.1|  PREDICTED: secretory carrier-associated memb...    269   2e-82    
ref|XP_010501304.1|  PREDICTED: secretory carrier-associated memb...    268   2e-82    
ref|NP_001055977.1|  Os05g0503000                                       268   3e-82    
ref|XP_011085637.1|  PREDICTED: secretory carrier-associated memb...    268   3e-82    
ref|XP_009101986.1|  PREDICTED: secretory carrier-associated memb...    267   3e-82    
gb|KDO75800.1|  hypothetical protein CISIN_1g019268mg                   266   3e-82    
gb|KJB79956.1|  hypothetical protein B456_013G074400                    267   3e-82    
gb|KJB57598.1|  hypothetical protein B456_009G171800                    266   5e-82    
emb|CDY64131.1|  BnaCnng43200D                                          267   6e-82    
ref|XP_010488983.1|  PREDICTED: secretory carrier-associated memb...    266   6e-82    
ref|XP_008656426.1|  PREDICTED: secretory carrier-associated memb...    266   7e-82    
ref|XP_002319372.1|  secretory carrier membrane family protein          267   8e-82    
ref|XP_006654610.1|  PREDICTED: secretory carrier-associated memb...    266   8e-82    
ref|XP_010526523.1|  PREDICTED: secretory carrier-associated memb...    267   8e-82    
ref|XP_006659859.1|  PREDICTED: secretory carrier-associated memb...    267   8e-82    
ref|XP_002963054.1|  hypothetical protein SELMODRAFT_450782             267   1e-81    
ref|XP_010233085.1|  PREDICTED: secretory carrier-associated memb...    266   1e-81    
gb|KJB79954.1|  hypothetical protein B456_013G074400                    266   2e-81    
ref|XP_011045471.1|  PREDICTED: secretory carrier-associated memb...    266   2e-81    
ref|XP_010057473.1|  PREDICTED: secretory carrier-associated memb...    265   2e-81    
ref|XP_002980280.1|  hypothetical protein SELMODRAFT_153834             266   2e-81    
ref|XP_011039762.1|  PREDICTED: secretory carrier-associated memb...    265   4e-81    
ref|XP_008643824.1|  PREDICTED: LOC100285595 isoform X1                 265   5e-81    
gb|AFK40497.1|  unknown                                                 262   5e-81    
tpg|DAA57363.1|  TPA: hypothetical protein ZEAMMB73_150496              263   7e-81    
gb|KFK42706.1|  hypothetical protein AALP_AA1G029400                    263   9e-81    
ref|XP_006449254.1|  hypothetical protein CICLE_v10016025mg             262   1e-80    
gb|EPS71892.1|  secretory carrier membrane protein                      264   1e-80    
gb|KJB79955.1|  hypothetical protein B456_013G074400                    261   3e-80    
gb|EMS51338.1|  Secretory carrier-associated membrane protein 6         262   5e-80    
ref|XP_007025746.1|  Secretory carrier-associated membrane protei...    262   5e-80    
ref|NP_001152216.1|  SC3 protein                                        262   7e-80    
ref|XP_004961589.1|  PREDICTED: secretory carrier-associated memb...    262   1e-79    
ref|XP_004487318.1|  PREDICTED: secretory carrier-associated memb...    261   2e-79    
ref|XP_001781216.1|  predicted protein                                  261   2e-79    
ref|XP_010110406.1|  Secretory carrier-associated membrane protein 3    261   2e-79    
ref|XP_004958041.1|  PREDICTED: putative secretory carrier-associ...    261   2e-79    
ref|XP_002463029.1|  hypothetical protein SORBIDRAFT_02g036500          261   2e-79    
gb|ACU54986.1|  secretory carrier membrane protein                      261   3e-79    
ref|XP_009118701.1|  PREDICTED: secretory carrier-associated memb...    259   5e-79    
gb|KEH39080.1|  secretory carrier-associated membrane protein           259   6e-79    
ref|XP_009776222.1|  PREDICTED: secretory carrier-associated memb...    259   1e-78    
emb|CDY37420.1|  BnaC08g45580D                                          258   2e-78    
gb|EMS61150.1|  Secretory carrier-associated membrane protein 1         258   2e-78    
ref|XP_003562878.1|  PREDICTED: secretory carrier-associated memb...    258   2e-78    
gb|KDO51550.1|  hypothetical protein CISIN_1g024745mg                   257   2e-78    
ref|XP_008230236.1|  PREDICTED: secretory carrier-associated memb...    256   3e-78    
ref|XP_009101987.1|  PREDICTED: secretory carrier-associated memb...    256   5e-78    
gb|KCW44966.1|  hypothetical protein EUGRSUZ_L01445                     254   8e-78    
ref|NP_563686.1|  secretory carrier-associated membrane protein 2       255   1e-77    
ref|XP_002892168.1|  secretory carrier membrane protein family pr...    255   1e-77    
ref|XP_009112998.1|  PREDICTED: secretory carrier-associated memb...    253   2e-77    
ref|XP_007216076.1|  hypothetical protein PRUPE_ppa018023mg             254   3e-77    
gb|EEC79484.1|  hypothetical protein OsI_20525                          254   4e-77    
ref|XP_004974410.1|  PREDICTED: secretory carrier-associated memb...    252   1e-76    
ref|XP_007025743.1|  Secretory carrier membrane protein (SCAMP) f...    252   3e-76    
ref|XP_006491653.1|  PREDICTED: secretory carrier-associated memb...    252   4e-76    
ref|XP_006361016.1|  PREDICTED: secretory carrier-associated memb...    252   4e-76    
tpg|DAA50132.1|  TPA: hypothetical protein ZEAMMB73_466758              250   7e-76    
ref|XP_004248102.1|  PREDICTED: secretory carrier-associated memb...    251   9e-76    
ref|XP_006449255.1|  hypothetical protein CICLE_v10016025mg             247   1e-74    
gb|KJB79953.1|  hypothetical protein B456_013G074400                    246   2e-74    
gb|AFK38499.1|  unknown                                                 245   3e-74    
ref|XP_009111153.1|  PREDICTED: secretory carrier-associated memb...    246   4e-74    
gb|ACN27763.1|  unknown                                                 243   8e-74    
ref|XP_010092613.1|  Putative secretory carrier-associated membra...    244   3e-73    
ref|XP_007149884.1|  hypothetical protein PHAVU_005G106900g             244   4e-73    
ref|XP_011039764.1|  PREDICTED: secretory carrier-associated memb...    243   4e-73    
ref|XP_004958040.1|  PREDICTED: putative secretory carrier-associ...    245   5e-73    
gb|EMT11461.1|  Secretory carrier-associated membrane protein 2         242   7e-73    
gb|EMT24656.1|  Secretory carrier-associated membrane protein 5         241   1e-72    
emb|CDY51390.1|  BnaC08g46270D                                          241   4e-72    
emb|CAN78859.1|  hypothetical protein VITISV_030326                     238   8e-72    
ref|XP_009399204.1|  PREDICTED: secretory carrier-associated memb...    239   2e-71    
ref|XP_009399203.1|  PREDICTED: secretory carrier-associated memb...    239   2e-71    
ref|XP_001779427.1|  predicted protein                                  239   5e-71    
gb|ACS91930.1|  secretory carrier membrane protein                      238   8e-71    
tpg|DAA41115.1|  TPA: hypothetical protein ZEAMMB73_624994              235   9e-71    
ref|XP_008230237.1|  PREDICTED: secretory carrier-associated memb...    236   1e-70    
ref|XP_009623445.1|  PREDICTED: secretory carrier-associated memb...    237   5e-70    
gb|AAD49997.1|AC007259_10  Hypothetical protein                         234   2e-69    
ref|XP_008644675.1|  PREDICTED: secretory carrier-associated memb...    234   2e-69    
gb|KJB77312.1|  hypothetical protein B456_012G131000                    234   3e-69    
ref|XP_009778192.1|  PREDICTED: secretory carrier-associated memb...    232   6e-69    
ref|XP_006651571.1|  PREDICTED: secretory carrier-associated memb...    232   1e-68    
ref|XP_002464294.1|  hypothetical protein SORBIDRAFT_01g015730          231   2e-68    
ref|XP_004982517.1|  PREDICTED: secretory carrier-associated memb...    230   8e-68    
ref|XP_006366003.1|  PREDICTED: secretory carrier-associated memb...    229   1e-67    
tpg|DAA41114.1|  TPA: hypothetical protein ZEAMMB73_624994              225   3e-67    
emb|CAN75708.1|  hypothetical protein VITISV_031421                     245   3e-67    
gb|KJB34685.1|  hypothetical protein B456_006G085900                    228   7e-67    
ref|XP_002970903.1|  hypothetical protein SELMODRAFT_411581             227   1e-66    
ref|XP_001757960.1|  predicted protein                                  226   3e-66    
ref|XP_001762978.1|  predicted protein                                  224   1e-65    
gb|AAS07187.1|  putative secretory carrier membrane protein             223   5e-65    
ref|XP_001761747.1|  predicted protein                                  223   7e-65    
gb|EEE68088.1|  hypothetical protein OsJ_26134                          219   1e-64    
gb|EEE55491.1|  hypothetical protein OsJ_03676                          221   3e-64    
ref|XP_008342084.1|  PREDICTED: secretory carrier-associated memb...    217   2e-63    
ref|XP_006447318.1|  hypothetical protein CICLE_v10017555mg             217   3e-63    
gb|KHG22651.1|  Secretory carrier-associated membrane 1 -like pro...    214   2e-62    
ref|XP_009382527.1|  PREDICTED: secretory carrier-associated memb...    214   2e-62    
gb|EEC82939.1|  hypothetical protein OsI_27912                          213   3e-62    
gb|KCW74648.1|  hypothetical protein EUGRSUZ_E03370                     213   4e-62    
gb|KJB66656.1|  hypothetical protein B456_010G150500                    211   2e-61    
dbj|BAK02184.1|  predicted protein                                      211   6e-61    
gb|EMT31001.1|  Secretory carrier-associated membrane protein 4         213   8e-61    
gb|KHF98780.1|  Secretory carrier-associated membrane 3 -like pro...    209   1e-59    
gb|AFW59323.1|  hypothetical protein ZEAMMB73_850428                    199   1e-57    
ref|XP_004248150.1|  PREDICTED: secretory carrier-associated memb...    202   1e-57    
ref|XP_002969638.1|  hypothetical protein SELMODRAFT_92029              201   1e-57    
gb|EMS68407.1|  Secretory carrier-associated membrane protein 2         199   1e-56    
gb|KJB34686.1|  hypothetical protein B456_006G085900                    196   1e-55    
gb|AAB71471.1|  Unknown protein                                         191   1e-53    
ref|XP_008373681.1|  PREDICTED: uncharacterized protein LOC103436992    198   2e-53    
gb|KJB57597.1|  hypothetical protein B456_009G171800                    184   3e-51    
gb|ACU18932.1|  unknown                                                 181   3e-50    
ref|XP_004306010.1|  PREDICTED: secretory carrier-associated memb...    182   1e-49    
ref|XP_011467794.1|  PREDICTED: secretory carrier-associated memb...    181   3e-49    
gb|EPS73099.1|  hypothetical protein M569_01654                         188   6e-48    
emb|CAN79282.1|  hypothetical protein VITISV_034554                     171   1e-43    
ref|NP_001289792.1|  uncharacterized LOC100825352                       169   1e-42    
gb|KJB34797.1|  hypothetical protein B456_006G085800                    158   4e-42    
gb|KJB66655.1|  hypothetical protein B456_010G150500                    155   6e-41    
dbj|BAK04053.1|  predicted protein                                      150   2e-39    
ref|XP_007025742.1|  Uncharacterized protein TCM_029952                 159   3e-39    
ref|XP_002456445.1|  hypothetical protein SORBIDRAFT_03g036410          150   5e-39    
gb|ACR35494.1|  unknown                                                 148   2e-38    
ref|XP_010236440.1|  PREDICTED: secretory carrier-associated memb...    147   3e-38    
gb|AFK48287.1|  unknown                                                 145   3e-37    
ref|XP_003637771.1|  Secretory carrier-associated membrane protein      138   3e-35    
gb|AFN53704.1|  putative secretory carrier membrane protein             145   4e-35    
ref|XP_009766486.1|  PREDICTED: secretory carrier-associated memb...    139   7e-35    
gb|KDD76807.1|  secretory carrier membrane protein                      138   2e-33    
pir||T00903  hypothetical protein F21B7.17 - Arabidopsis thaliana       135   4e-33 
ref|XP_011402301.1|  Secretory carrier-associated membrane protein 1    127   6e-30    
emb|CAN78854.1|  hypothetical protein VITISV_018472                     128   8e-29    
ref|XP_009609813.1|  PREDICTED: secretory carrier-associated memb...    122   9e-29    
ref|XP_010236439.1|  PREDICTED: secretory carrier-associated memb...    120   9e-29    
gb|ACU24457.1|  unknown                                                 118   1e-28    
ref|XP_005850324.1|  hypothetical protein CHLNCDRAFT_142100             122   6e-28    
ref|XP_010501426.1|  PREDICTED: secretory carrier-associated memb...    116   2e-27    
gb|ACU18292.1|  unknown                                                 114   3e-27    
ref|XP_005649761.1|  scamp-domain-containing protein                    115   2e-25    
ref|XP_007512568.1|  predicted protein                                  114   1e-24    
ref|XP_002305669.2|  hypothetical protein POPTR_0004s03690g             108   4e-24    
ref|XP_003608188.1|  Secretory carrier-associated membrane protein      104   1e-22    
ref|XP_009594081.1|  PREDICTED: secretory carrier-associated memb...    101   1e-21    
ref|XP_011027942.1|  PREDICTED: secretory carrier-associated memb...    101   2e-21    
ref|XP_001701965.1|  secretory carrier membrane protein, SCAMP          103   2e-21    
ref|XP_003083977.1|  putative secretory carrier membrane protein ...    103   2e-21    
emb|CDI54050.1|  related to Secretory carrier-associated membrane...    103   3e-21    
ref|XP_002949346.1|  hypothetical protein VOLCADRAFT_80622              103   4e-21    
emb|CEG00627.1|  SCAMP                                                  103   4e-21    
gb|AFA36611.1|  secretory carrier membrane protein                    96.3    2e-20    
gb|KIO13731.1|  hypothetical protein M404DRAFT_594339                 98.6    8e-20    
ref|XP_007846181.1|  secretory carrier membrane protein 2             97.8    2e-19    
gb|KIK19347.1|  hypothetical protein PISMIDRAFT_156105                96.7    3e-19    
ref|XP_007005927.1|  hypothetical protein TREMEDRAFT_74264            96.3    1e-18    
gb|KIM29052.1|  hypothetical protein M408DRAFT_329076                 95.1    2e-18    
gb|AFK37877.1|  unknown                                               88.6    1e-17    
ref|XP_006682283.1|  hypothetical protein BATDEDRAFT_91951            92.8    2e-17    
gb|KIJ16933.1|  hypothetical protein PAXINDRAFT_162530                91.7    3e-17    
emb|CCF51928.1|  related to Secretory carrier-associated membrane...  91.7    4e-17    
ref|XP_003064282.1|  predicted protein                                92.0    4e-17    
gb|KIO28172.1|  hypothetical protein M407DRAFT_184171                 90.5    6e-17    
gb|AFK41295.1|  unknown                                               86.7    6e-17    
emb|CDR43029.1|  RHTO0S07e06876g1_1                                   90.5    9e-17    
gb|KFD69617.1|  hypothetical protein M514_01981                       90.9    1e-16    
ref|XP_003331185.2|  hypothetical protein PGTG_13148                  90.5    1e-16    
ref|XP_003144349.1|  hypothetical protein LOAG_08771                  90.5    1e-16    
gb|KIY72155.1|  scamp-domain-containing protein                       89.4    2e-16    
emb|CEL51807.1|  Secretory carrier-associated membrane protein 2 ...  89.0    2e-16    
gb|KDE06972.1|  hypothetical protein MVLG_02710                       89.4    2e-16    
gb|KIK57763.1|  hypothetical protein GYMLUDRAFT_45946                 88.6    2e-16    
gb|KEP55310.1|  secretory carrier-associated membrane-like protein    88.6    2e-16    
gb|KHN71748.1|  Secretory carrier-associated membrane protein 1       89.4    3e-16    
gb|AAX26147.2|  SJCHGC06276 protein                                   88.2    4e-16    
gb|KII88427.1|  hypothetical protein PLICRDRAFT_41589                 88.2    4e-16    
emb|CAX73062.1|  Secretory carrier-associated membrane protein 2      88.6    5e-16    
gb|KDQ33148.1|  hypothetical protein PLEOSDRAFT_1060816               86.7    1e-15    
gb|KDN51664.1|  hypothetical protein RSAG8_00210                      86.3    1e-15    
ref|XP_005651738.1|  hypothetical protein COCSUDRAFT_55217            86.7    2e-15    
gb|KIK96229.1|  hypothetical protein PAXRUDRAFT_826172                86.3    2e-15    
ref|XP_008045286.1|  scamp-domain-containing protein                  85.9    2e-15    



>ref|XP_009609950.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=271

 Score =   442 bits (1136),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/294 (77%), Positives = 244/294 (83%), Gaps = 24/294 (8%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFSNGG+AP SKSR PQM+A+TLGFGQKHD TVDIPLDS+N 
Sbjct  1     MSRGNDPNPFDEEEPEVNPFSNGGSAPASKSRFPQMIASTLGFGQKHDVTVDIPLDSMNG  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  61    SNKKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIV CLV+N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  121   QKLQYLAFASWLGIVFCLVFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  181   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  239

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GF  FCLEALLSLWVLQ V  +  GH 
Sbjct  240   ----------------------IFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK  271



>emb|CDP11723.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/294 (76%), Positives = 246/294 (84%), Gaps = 24/294 (8%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EEQEVNPFS G  APGSKSR+PQ V+NTLGFGQKHDATVDIPLDS+ND
Sbjct  1     MNRSSDPNPFDEEEQEVNPFSKGNAAPGSKSRVPQFVSNTLGFGQKHDATVDIPLDSMND  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKKQKELA WEAD+KRRE DIKRREDAVA AGVP  D+NWPPFFPIIHHDI NEIPV +
Sbjct  61    SKKKQKELADWEADIKRRERDIKRREDAVASAGVPADDRNWPPFFPIIHHDIANEIPVHA  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF L+IIYAL+GCPLSYVLWYRPL
Sbjct  121   QRLQYLAFASWLGIVLCLVFNVIAVTVCWIRGGGVKIFFLSIIYALLGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SA KFGWFF+ YL+HIGFCI AAIAPPI+FHG+SLTGILAAIDVFSDHVLVG 
Sbjct  181   YRAMRTDSAFKFGWFFLCYLIHIGFCILAAIAPPIVFHGRSLTGILAAIDVFSDHVLVG-  239

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYLVGFGLFCLE+LLSLWV+Q V  Y  GH 
Sbjct  240   ----------------------IFYLVGFGLFCLESLLSLWVVQKVYMYFRGHK  271



>ref|XP_009797975.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X1 [Nicotiana sylvestris]
 dbj|BAH03477.1| secretory carrier-associated membrane protein 2 [Nicotiana tabacum]
Length=271

 Score =   438 bits (1127),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/293 (76%), Positives = 243/293 (83%), Gaps = 24/293 (8%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFSNGG+AP SKSR PQM+A++LGFGQKHDAT+DIPLDS N 
Sbjct  1     MSRGNDPNPFDEEEPEVNPFSNGGSAPASKSRFPQMIASSLGFGQKHDATIDIPLDSTNG  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  61    SNKKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             +K+QYLAFASWLGIV CL +N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  121   RKLQYLAFASWLGIVFCLAFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  181   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  239

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                   IFYL+GF  FCLEALLSLWVLQ V  +  GH
Sbjct  240   ----------------------IFYLIGFAFFCLEALLSLWVLQKVYMFFRGH  270



>ref|XP_009609041.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Nicotiana tomentosiformis]
Length=271

 Score =   438 bits (1126),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 220/294 (75%), Positives = 247/294 (84%), Gaps = 24/294 (8%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE ++NPFSNGG+A  +KSR PQM+A+TLGFGQK+DATVDIPLDS+ D
Sbjct  1     MSRGNDPNPFDEEEPQINPFSNGGSASATKSRFPQMIASTLGFGQKNDATVDIPLDSMKD  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKKQKELAAW  DL+RRE +IKRREDAVA AGVP++DKNWPPFFPIIHHDI NEIPV +
Sbjct  61    PKKKQKELAAWAVDLERRETEIKRREDAVASAGVPINDKNWPPFFPIIHHDIANEIPVHA  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             ++MQYLAFASWLGIVLCLV+N++AVTVCWI+  GVKIFLLA+IYAL+GCPLSYVLWYRPL
Sbjct  121   RRMQYLAFASWLGIVLCLVFNVIAVTVCWIRDGGVKIFLLAVIYALLGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFFMFY+LHIGFCI AAIAPPI FHG+SLTGILAAIDVFSDH+LVG 
Sbjct  181   YNAMRTESALKFGWFFMFYMLHIGFCILAAIAPPIFFHGRSLTGILAAIDVFSDHLLVG-  239

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GFGLFCLE LLSLWVLQ V  Y  GH 
Sbjct  240   ----------------------IFYLIGFGLFCLEVLLSLWVLQKVYLYFRGHK  271



>ref|XP_006352923.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Solanum tuberosum]
Length=270

 Score =   434 bits (1117),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 236/282 (84%), Gaps = 23/282 (8%)
 Frame = -2

Query  1279  RRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPK  1100
             R NDPNPFD+EE EVNPFS GG+AP SKSR PQM+A+TLGFGQKHDATVD+PLDS+N   
Sbjct  2     RGNDPNPFDEEEPEVNPFSKGGSAPASKSRFPQMIASTLGFGQKHDATVDVPLDSMNGSN  61

Query  1099  KKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQK  920
             KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  SQ+
Sbjct  62    KKQKELATWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHSQR  121

Query  919   MQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYN  740
             +QYLAFASWLGIV CL +N++AVT+CWIKG GVKIF LAIIYALMGCPLSY+LWYRPLYN
Sbjct  122   LQYLAFASWLGIVFCLAFNVLAVTICWIKGGGVKIFFLAIIYALMGCPLSYILWYRPLYN  181

Query  739   AMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSC  560
             AMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+F GKSLTGIL+AIDVFSDHVLVG   
Sbjct  182   AMRTDSALKFGWFFMFYLVHIGFCILAAIAPPIVFQGKSLTGILSAIDVFSDHVLVG---  238

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                 IFYL+GFG FCLE LLSLWVLQ
Sbjct  239   --------------------IFYLIGFGFFCLEGLLSLWVLQ  260



>ref|XP_010325581.1| PREDICTED: secretory carrier-associated membrane protein 4 [Solanum 
lycopersicum]
 ref|XP_010325582.1| PREDICTED: secretory carrier-associated membrane protein 4 [Solanum 
lycopersicum]
Length=270

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 218/292 (75%), Positives = 237/292 (81%), Gaps = 24/292 (8%)
 Frame = -2

Query  1279  RRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPK  1100
             R NDPNPFD+EE EVNPFS GG+AP SKSR PQM+A+TLGFGQKHDAT D+PLDS+N   
Sbjct  2     RGNDPNPFDEEEPEVNPFSKGGSAPASKSRFPQMIASTLGFGQKHDATDDVPLDSMNGSN  61

Query  1099  KKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQK  920
             KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  SQ+
Sbjct  62    KKQKELATWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHSQR  121

Query  919   MQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYN  740
             +QYLAFASWLGIV CL +N++AVT+CWIKG GVKIF LA+IYALMGCPLSY+LWYRPLYN
Sbjct  122   LQYLAFASWLGIVFCLAFNVLAVTICWIKGGGVKIFFLAVIYALMGCPLSYILWYRPLYN  181

Query  739   AMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSC  560
             AMRT+SALKFGWFFMFYL HIGFCI AAIAPPI+F G SLTGILAAIDVFSDHVLVG   
Sbjct  182   AMRTDSALKFGWFFMFYLFHIGFCILAAIAPPIVFQGLSLTGILAAIDVFSDHVLVG---  238

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                 IFYL+GFG FCLE LLSLWVLQ V  Y  GH 
Sbjct  239   --------------------IFYLIGFGFFCLEVLLSLWVLQKVYMYFRGHK  270



>ref|XP_010276767.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=268

 Score =   424 bits (1091),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 240/284 (85%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNRR+DPNPF  EE+EVNPF+NG +AP SKSRIP  +  +LGFG KHDATVDIPLD++ND
Sbjct  1     MNRRDDPNPF--EEEEVNPFANG-SAPASKSRIPSFLPQSLGFGHKHDATVDIPLDTMND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKK++KELAAWEADLKRRE DIKRREDAVA  G+P  DKNWPPFFPIIHHDI NEIP+ +
Sbjct  58    PKKREKELAAWEADLKRREQDIKRREDAVARVGIPTDDKNWPPFFPIIHHDIANEIPIHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+NI+AV VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLVFNILAVVVCWIKGGGVKIFFLATIYALLGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+FYLLHIGFCIF+AIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  178   YRAMRTDSALKFGWFFLFYLLHIGFCIFSAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GFGLFCLE+LLSLWVLQ
Sbjct  237   ----------------------IFYLIGFGLFCLESLLSLWVLQ  258



>ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycine max]
 gb|ACU19390.1| unknown [Glycine max]
Length=269

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/294 (74%), Positives = 242/294 (82%), Gaps = 26/294 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR NDPNPF  EE+EVNPFSNGG AP SKSRIP + +  LGFGQ+HDATVDIPLD+ ND
Sbjct  1     MNRHNDPNPF--EEEEVNPFSNGGAAPASKSRIPPLASQPLGFGQRHDATVDIPLDTTND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KK+ +ELAAWEADLKR+E +IKRRE+AV+ AGVPV DKNWPP FPIIHHDI NEIPV +
Sbjct  59    SKKRGQELAAWEADLKRKEKEIKRREEAVSRAGVPVDDKNWPPIFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N+VAVTVCWI+G GVKIF LA+IY L+G PLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLVFNVVAVTVCWIRGGGVKIFFLAVIYGLLGVPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFYLLHIGFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  179   YRAMRTDSALKFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GFG+FCLEALLSLWVLQ +  Y  GH 
Sbjct  238   ----------------------IFYLIGFGMFCLEALLSLWVLQKIYMYFRGHK  269



>ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycine max]
 gb|ACU20966.1| unknown [Glycine max]
 gb|KHN40405.1| Secretory carrier-associated membrane protein 4 [Glycine soja]
Length=269

 Score =   419 bits (1077),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/294 (74%), Positives = 241/294 (82%), Gaps = 26/294 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPF  EE+EVNPFSNG  AP SKSRIP + + +LGFGQ+HDATVDIPLD+ ND
Sbjct  1     MNRHHDPNPF--EEEEVNPFSNGTTAPASKSRIPPLASESLGFGQRHDATVDIPLDTTND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK +ELAAWEADLKRRE +IKRRE+AV+ AGVPV DKNWPPFFPIIHHDI NEIPV +
Sbjct  59    SKKKGQELAAWEADLKRREKEIKRREEAVSRAGVPVDDKNWPPFFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +N+VAVTVCWI+G GVKIF LA+IYAL+G PLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLGFNVVAVTVCWIRGGGVKIFFLAVIYALLGVPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFM YLLHIGFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  179   YRAMRTDSALKFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GFG+FCLEALLS WVLQ +  Y  GH 
Sbjct  238   ----------------------IFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK  269



>ref|XP_009609951.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=255

 Score =   417 bits (1072),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/241 (84%), Positives = 221/241 (92%), Gaps = 0/241 (0%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFSNGG+AP SKSR PQM+A+TLGFGQKHD TVDIPLDS+N 
Sbjct  1     MSRGNDPNPFDEEEPEVNPFSNGGSAPASKSRFPQMIASTLGFGQKHDVTVDIPLDSMNG  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  61    SNKKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIV CLV+N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  121   QKLQYLAFASWLGIVFCLVFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG+
Sbjct  181   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVGI  240

Query  565   S  563
              
Sbjct  241   G  241



>ref|XP_011082326.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Sesamum indicum]
Length=268

 Score =   417 bits (1072),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 222/284 (78%), Positives = 243/284 (86%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFSNGG   GSKSRIP++VANTLGFGQKHDATVDIPLD++ND
Sbjct  1     MSRGNDPNPFDEEEPEVNPFSNGG---GSKSRIPKVVANTLGFGQKHDATVDIPLDAMND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKKQKELAAWEADL RRE +IKRREDAV  AGVPV D+NWPPFFPIIHHDI NEIPV +
Sbjct  58    PKKKQKELAAWEADLNRREREIKRREDAVVSAGVPVDDRNWPPFFPIIHHDIANEIPVHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A+TVCWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  118   QKLQYLAFASWLGIVLCLVFNVIAITVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+FY+LHIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  178   YRAMRTDSALKFGWFFLFYMLHIGFCIVAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GF  FCLE+LLSLWVLQ
Sbjct  237   ----------------------IFYLIGFAFFCLESLLSLWVLQ  258



>ref|XP_009766029.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009766030.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X2 [Nicotiana sylvestris]
Length=252

 Score =   413 bits (1062),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 226/241 (94%), Gaps = 0/241 (0%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M++ NDPNPFD+EE ++NPFSNGG+AP +KSR PQM+A+TLGFGQK+DATVDIPLDS+ND
Sbjct  1     MSKGNDPNPFDEEEPQINPFSNGGSAPATKSRFPQMIASTLGFGQKNDATVDIPLDSMND  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKK+QKELAAW  DL+R+E +IKRREDAVA AGVP +DKNWPPFFPIIHHDI NEIPV +
Sbjct  61    PKKRQKELAAWAEDLERKEREIKRREDAVASAGVPTNDKNWPPFFPIIHHDIANEIPVHA  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAFASWLGIVLCLV+N++AVTVCWI+  GVKIFLLA+IYAL+GCPLSYVLWYRPL
Sbjct  121   QRMQYLAFASWLGIVLCLVFNVIAVTVCWIRDGGVKIFLLAVIYALLGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFFMFY+LHIGFCI AAIAPPIIFHG+SLTGILAAIDVFSDH+LVGV
Sbjct  181   YNAMRTESALKFGWFFMFYMLHIGFCILAAIAPPIIFHGRSLTGILAAIDVFSDHLLVGV  240

Query  565   S  563
             S
Sbjct  241   S  241



>ref|XP_008356443.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X1 [Malus domestica]
Length=273

 Score =   414 bits (1064),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 236/286 (83%), Gaps = 25/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQ--EVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             MNR +DPNPFD+EE   EVNPFSNG  AP SKSR+P + +  LGFGQKHDATVDIPLD++
Sbjct  1     MNRHHDPNPFDEEEVQVEVNPFSNGAAAPMSKSRVPPVSSEHLGFGQKHDATVDIPLDTM  60

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND K+K KELA WEADLK+RE DIKRRED+VA AGVPV D+NWPPFFPIIHHDI NEIP+
Sbjct  61    NDSKQKAKELATWEADLKKREKDIKRREDSVAKAGVPVDDRNWPPFFPIIHHDIANEIPI  120

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +Q++QY+AFASWLGIVLCL +N++A+ VCWI+G GVKIFLLA IYALMGCPLSYVLWYR
Sbjct  121   HAQRLQYMAFASWLGIVLCLFFNVIAIIVCWIRGGGVKIFLLATIYALMGCPLSYVLWYR  180

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SALKFGWFFMFY+LHIGFCI AAIAPPI+F+GKSLTGIL+AIDVFSDHV+V
Sbjct  181   PLYRAMRTDSALKFGWFFMFYMLHIGFCIVAAIAPPIVFNGKSLTGILSAIDVFSDHVVV  240

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFYL GF LFCLE+LLSLWVLQ
Sbjct  241   G-----------------------IFYLTGFALFCLESLLSLWVLQ  263



>ref|XP_009797982.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 220/241 (91%), Gaps = 0/241 (0%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFSNGG+AP SKSR PQM+A++LGFGQKHDAT+DIPLDS N 
Sbjct  1     MSRGNDPNPFDEEEPEVNPFSNGGSAPASKSRFPQMIASSLGFGQKHDATIDIPLDSTNG  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  61    SNKKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             +K+QYLAFASWLGIV CL +N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  121   RKLQYLAFASWLGIVFCLAFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG+
Sbjct  181   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVGI  240

Query  565   S  563
              
Sbjct  241   G  241



>ref|XP_010261621.1| PREDICTED: secretory carrier-associated membrane protein 4 [Nelumbo 
nucifera]
Length=268

 Score =   413 bits (1061),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 238/294 (81%), Gaps = 27/294 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNRR+DPNPFD  E+EVNPF+ G  AP SKSR+  ++  +LGFG KHDATVDIPLD+ ND
Sbjct  1     MNRRDDPNPFD--EEEVNPFAKGA-APASKSRLTSLIPESLGFGHKHDATVDIPLDTTND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KK+QKE+AAWEADLKRRE DIKRREDAVA AGVP  D+NWPPFFPIIHHDI NEIP+ +
Sbjct  58    IKKRQKEIAAWEADLKRREQDIKRREDAVARAGVPTDDRNWPPFFPIIHHDIANEIPIHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N++A+ VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLVFNVLAIVVCWIKGGGVKIFFLATIYALLGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKF WFF+FYLLHIGFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHV VG 
Sbjct  178   YRAMRTDSALKFSWFFLFYLLHIGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVFVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GFG FCLE+LLSLWVLQ V  Y  GH 
Sbjct  237   ----------------------IFYLIGFGFFCLESLLSLWVLQKVYMYFRGHK  268



>gb|AFK41920.1| unknown [Lotus japonicus]
Length=268

 Score =   412 bits (1059),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 236/284 (83%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E EVNPFSNG  APGSKSRIP + +  LGFGQ+HDATVDIPLD+ N+
Sbjct  1     MNRHHDPNPFD--EDEVNPFSNGA-APGSKSRIPPLASEPLGFGQRHDATVDIPLDTTNE  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK +ELAAWEADLKRRE D+KRREDAV+ AGVPV DKNWPP FPIIHHDI NEIPV +
Sbjct  58    PKKKGQELAAWEADLKRREKDLKRREDAVSRAGVPVDDKNWPPIFPIIHHDIANEIPVHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N+VAV VCWI+G GVKIF LA+IYAL+G PLS+VLWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLVFNVVAVMVCWIRGGGVKIFFLAVIYALLGVPLSHVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFYLLHI FCIFAAIAPP++FHGKSLTGILAA DVFSDHVLVG 
Sbjct  178   YRAMRTDSALKFGWFFMFYLLHIAFCIFAAIAPPVVFHGKSLTGILAATDVFSDHVLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYLVGFGLFCLE+LLSLWV+Q
Sbjct  237   ----------------------IFYLVGFGLFCLESLLSLWVIQ  258



>ref|XP_009373510.1| PREDICTED: secretory carrier-associated membrane protein 4 [Pyrus 
x bretschneideri]
Length=273

 Score =   412 bits (1059),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 235/286 (82%), Gaps = 25/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQ--EVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             MN  +DPNPFD+EE   EVNPFSNG  AP SKSR+P + +  LGFGQKHDATVDIPLD++
Sbjct  1     MNHHHDPNPFDEEEVQVEVNPFSNGAAAPKSKSRVPPVSSEHLGFGQKHDATVDIPLDTM  60

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND K+K KELA WEADLK+RE DIKRRED+VA AGVPV D+NWPPFFPIIHHDI NEIP+
Sbjct  61    NDSKQKAKELATWEADLKKREKDIKRREDSVAKAGVPVDDRNWPPFFPIIHHDIANEIPI  120

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +Q++QY+AFASWLGIVLCL +N++A+ VCWI+G GVKIFLLA IYALMGCPLSYVLWYR
Sbjct  121   HAQRLQYMAFASWLGIVLCLFFNVIAIIVCWIRGGGVKIFLLATIYALMGCPLSYVLWYR  180

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SALKFGWFFMFY+LHIGFCI AAIAPPI+F+GKSLTGIL+AIDVFSDHV+V
Sbjct  181   PLYRAMRTDSALKFGWFFMFYMLHIGFCIVAAIAPPIVFNGKSLTGILSAIDVFSDHVVV  240

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFYL GF LFCLE+LLSLWVLQ
Sbjct  241   G-----------------------IFYLTGFALFCLESLLSLWVLQ  263



>gb|EYU23286.1| hypothetical protein MIMGU_mgv1a011911mg [Erythranthe guttata]
Length=267

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 234/284 (82%), Gaps = 27/284 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR NDPNPFDDEE EVNPFS G      KSR+P +VA+TLGFG+KHDATVDIPLD++ND
Sbjct  1     MNRGNDPNPFDDEEPEVNPFSQGA----GKSRMPNVVASTLGFGRKHDATVDIPLDNMND  56

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              +KK+KEL+ WEADL RRE DIKRRE AVA AGVPV DKNWPPFFP+IHHDI NEIPV +
Sbjct  57    SRKKEKELSTWEADLDRRERDIKRREAAVASAGVPVDDKNWPPFFPLIHHDIANEIPVHA  116

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY AFASWLGIVLCLV+N++AVT+CWI+G GVKIF LAIIYALMG PLSYVLWYRPL
Sbjct  117   QRLQYFAFASWLGIVLCLVFNVIAVTICWIRGGGVKIFFLAIIYALMGVPLSYVLWYRPL  176

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y A+RT+SALKFGWFF+FYL+HIGFCI AAIAPPI+F G+SLTGILAAIDVFSDHVLVG 
Sbjct  177   YRAVRTDSALKFGWFFLFYLIHIGFCILAAIAPPIVFQGRSLTGILAAIDVFSDHVLVG-  235

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GFG FCLE+LLSLWVLQ
Sbjct  236   ----------------------IFYLLGFGFFCLESLLSLWVLQ  257



>ref|XP_008448620.1| PREDICTED: secretory carrier-associated membrane protein 4 [Cucumis 
melo]
Length=269

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 241/284 (85%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR NDPNPFD  E+EVNPFS GG APGSK RIPQMV++TLGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHNDPNPFD--EEEVNPFSKGGGAPGSKFRIPQMVSDTLGFGQKHDATVDIPLDTMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK++ELAAWEA+L R+E +IK+RE+AV+ AGVP  D+NWPPFFPIIHHDI NEIPV +
Sbjct  59    PKKKERELAAWEAELNRKEKEIKKREEAVSKAGVPADDRNWPPFFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCL +N++A+TVCWI+G GVKIF LA+IYA++G PLSYVLWYRPL
Sbjct  119   QKLQYLAFASWLGIVLCLFFNVIAITVCWIRGGGVKIFFLAVIYAILGIPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFYLLHI FCIFAAIAPP++FHG+SLTGILAAIDVFSDHVLVG 
Sbjct  179   YRAMRTDSALKFGWFFMFYLLHIAFCIFAAIAPPVVFHGQSLTGILAAIDVFSDHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GFG FCLE+LLSLWVLQ
Sbjct  238   ----------------------IFYLIGFGFFCLESLLSLWVLQ  259



>ref|XP_008356444.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X2 [Malus domestica]
Length=266

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 231/284 (81%), Gaps = 28/284 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EE +     NG  AP SKSR+P + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEEEVQ-----NGAAAPMSKSRVPPVSSEHLGFGQKHDATVDIPLDTMND  55

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K KELA WEADLK+RE DIKRRED+VA AGVPV D+NWPPFFPIIHHDI NEIP+ +
Sbjct  56    SKQKAKELATWEADLKKREKDIKRREDSVAKAGVPVDDRNWPPFFPIIHHDIANEIPIHA  115

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFASWLGIVLCL +N++A+ VCWI+G GVKIFLLA IYALMGCPLSYVLWYRPL
Sbjct  116   QRLQYMAFASWLGIVLCLFFNVIAIIVCWIRGGGVKIFLLATIYALMGCPLSYVLWYRPL  175

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFY+LHIGFCI AAIAPPI+F+GKSLTGIL+AIDVFSDHV+VG 
Sbjct  176   YRAMRTDSALKFGWFFMFYMLHIGFCIVAAIAPPIVFNGKSLTGILSAIDVFSDHVVVG-  234

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL GF LFCLE+LLSLWVLQ
Sbjct  235   ----------------------IFYLTGFALFCLESLLSLWVLQ  256



>ref|XP_003612685.1| Secretory carrier-associated membrane protein [Medicago truncatula]
 gb|AES95643.1| secretory carrier-associated membrane protein [Medicago truncatula]
Length=267

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 233/285 (82%), Gaps = 29/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN-  1109
             MNR +DPNPF  EE+EVNPFSNG    GSKSR+P + +  LGFGQ+HDATVDIPL++ N 
Sbjct  1     MNRNHDPNPF--EEEEVNPFSNGT---GSKSRVPSVASEPLGFGQRHDATVDIPLETSNG  55

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK +ELA WEADLKRRE DIKRRED+VA AGVPV DKNWPPFFPIIHHDI NEIPV 
Sbjct  56    DSKKKSQELAVWEADLKRREKDIKRREDSVAKAGVPVDDKNWPPFFPIIHHDIANEIPVH  115

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QY AFASWLGIVLCLV+N+VAV VCWI+G GVKIF LA+IYAL+G PLSYVLWYRP
Sbjct  116   AQRLQYSAFASWLGIVLCLVFNVVAVIVCWIRGGGVKIFFLAVIYALLGIPLSYVLWYRP  175

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFFMFYLLHI FCIFAAIAPP++FHGKSLTGILAAIDVFSDHVLVG
Sbjct  176   LYRAMRTDSALKFSWFFMFYLLHIAFCIFAAIAPPVVFHGKSLTGILAAIDVFSDHVLVG  235

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYL+GFGLFCLEALLSLWV+Q
Sbjct  236   -----------------------IFYLIGFGLFCLEALLSLWVIQ  257



>ref|XP_004146111.1| PREDICTED: secretory carrier-associated membrane protein 4 [Cucumis 
sativus]
 gb|KGN55709.1| hypothetical protein Csa_3G006700 [Cucumis sativus]
Length=269

 Score =   401 bits (1030),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 240/284 (85%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR NDPNPFD  E+ VNPFS GG APGSK RIPQMV+ TLGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHNDPNPFD--EEGVNPFSKGGGAPGSKFRIPQMVSETLGFGQKHDATVDIPLDTMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK++ELAAWEA+L R+E +IK+RE+AV+ AGVP  D+NWPPFFPIIHHDI NEIPV +
Sbjct  59    PKKKERELAAWEAELSRKEKEIKKREEAVSKAGVPADDRNWPPFFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A+TVCWI+G GVKIF LA+IYA++G PLSYVLWYRPL
Sbjct  119   QKLQYLAFASWLGIVLCLVFNVIAITVCWIRGGGVKIFFLAVIYAILGIPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFYLLHI FCIFAAIAPP++FHG+SLTGILAAIDVFS+HVLVG 
Sbjct  179   YRAMRTDSALKFGWFFMFYLLHIAFCIFAAIAPPVVFHGQSLTGILAAIDVFSEHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GFG FCLE+LLSLWVLQ
Sbjct  238   ----------------------IFYLIGFGFFCLESLLSLWVLQ  259



>ref|XP_011074780.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Sesamum indicum]
Length=271

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/294 (74%), Positives = 243/294 (83%), Gaps = 24/294 (8%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M RRNDPNPFD+ E E+NPFSN   A GSKSRIP++VA+TLGFGQK+DA VDIPLD++ND
Sbjct  1     MGRRNDPNPFDEGEPEINPFSNDTAAAGSKSRIPKVVASTLGFGQKNDANVDIPLDTMND  60

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             P+KK+KELA WE+DL RRE +IKRREDAVA AGVPV DKNWPP FPIIHHDI NEIPV +
Sbjct  61    PRKKEKELATWESDLNRREREIKRREDAVARAGVPVDDKNWPPCFPIIHHDIANEIPVPA  120

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGI+LCLV+N++A+TVCWI+G GVKIF LAIIYAL+GCPLSYVLWYRPL
Sbjct  121   QRLQYLAFASWLGILLCLVFNVIAITVCWIRGGGVKIFFLAIIYALLGCPLSYVLWYRPL  180

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKF WFFMFYLLHI FCIFAAIAPPIIFHGKSLTGILAAIDVFSDHVLVG 
Sbjct  181   YRAMRTDSALKFSWFFMFYLLHIAFCIFAAIAPPIIFHGKSLTGILAAIDVFSDHVLVG-  239

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GF LFCLE+LLSLWVLQ +  Y  GH 
Sbjct  240   ----------------------IFYLIGFALFCLESLLSLWVLQKIYFYFRGHK  271



>ref|XP_004512452.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Cicer arietinum]
Length=267

 Score =   399 bits (1026),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 234/285 (82%), Gaps = 29/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN-  1109
             MN  +DPNPF  EE+EVNPFSNG    GSKSR+P + +  +GFGQ+HDATVDIPLD+ N 
Sbjct  1     MNHHHDPNPF--EEEEVNPFSNGA---GSKSRVPPLTSEPVGFGQRHDATVDIPLDTSNG  55

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK +ELAAWEADLKR+E +IKRRED+VA AGVP+ DKNWPPFFPIIHHDI NEIPV 
Sbjct  56    DSKKKAQELAAWEADLKRKEKEIKRREDSVAKAGVPIDDKNWPPFFPIIHHDIANEIPVH  115

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N+VAVTVCW++G GVKIF LA+IYAL+G PLSYVLWYRP
Sbjct  116   AQRLQYLAFASWLGIVLCLVFNLVAVTVCWVRGGGVKIFFLAVIYALLGVPLSYVLWYRP  175

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFFM YLLHI FCIFAAIAPP++FHGKSLTGILAAIDVFSDHVLVG
Sbjct  176   LYRAMRTDSALKFSWFFMLYLLHIAFCIFAAIAPPVVFHGKSLTGILAAIDVFSDHVLVG  235

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYL+GFGLFCLEALLSLWV+Q
Sbjct  236   -----------------------IFYLIGFGLFCLEALLSLWVIQ  257



>ref|XP_011465082.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=265

 Score =   399 bits (1025),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 229/284 (81%), Gaps = 29/284 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPF++EE EVNPFSNG      KSRIP + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFEEEEVEVNPFSNG------KSRIPPLSSEPLGFGQKHDATVDIPLDTMND  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +K KELAAWEADLKRRE DIKRRED+VA AGVP   KNWPPFFPIIHHDI NEIPV +
Sbjct  55    SNQKAKELAAWEADLKRREKDIKRREDSVAKAGVPDDGKNWPPFFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFASWLGIVLCLV+N++AV VCW++G G KIF LAIIYAL+G PLSYVLWYRPL
Sbjct  115   QRLQYMAFASWLGIVLCLVFNVIAVIVCWVRGGGSKIFFLAIIYALLGVPLSYVLWYRPL  174

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFY+LHIGFCI AAIAPPI+F GKSLTGILAAIDVFSDHV+VG 
Sbjct  175   YRAMRTDSALKFGWFFMFYMLHIGFCIIAAIAPPIVFQGKSLTGILAAIDVFSDHVIVG-  233

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GF LFCLE+LLS WVLQ
Sbjct  234   ----------------------IFYLIGFALFCLESLLSFWVLQ  255



>ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris]
 gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris]
Length=262

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 236/294 (80%), Gaps = 33/294 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPF  EE+EVNPFSNG       +R P + +  LG+GQ+HDATVDIPLD+ ND
Sbjct  1     MNRHHDPNPF--EEEEVNPFSNG-------ARSPPVASEPLGYGQRHDATVDIPLDTTND  51

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK +ELAAWEADLKRRE +IK+RE+AV+ AGVP+ DKNWPPFFPIIHHDI NEIPV +
Sbjct  52    SKKKGQELAAWEADLKRREKEIKKREEAVSRAGVPLDDKNWPPFFPIIHHDIANEIPVHA  111

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N+VAVTVCWI+G GVKIF LA+IYAL+G PLSYVLWYRPL
Sbjct  112   QRLQYLAFASWLGIVLCLVFNVVAVTVCWIRGGGVKIFFLAVIYALLGVPLSYVLWYRPL  171

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFM YLLHI FCIFAAIAPP++FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  172   YRAMRTDSALKFGWFFMLYLLHIAFCIFAAIAPPVVFHGKSLTGILAAIDVFSDHVLVG-  230

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GFGLFCLEALLSLWVLQ +  Y  GH 
Sbjct  231   ----------------------IFYLIGFGLFCLEALLSLWVLQKIYMYFRGHK  262



>ref|XP_011028089.1| PREDICTED: secretory carrier-associated membrane protein 4 [Populus 
euphratica]
Length=270

 Score =   397 bits (1019),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 234/285 (82%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRN-DPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R N DPNPFD EE+EVNPFS G  AP SK+RIP +    +GFG  +DATVDIPLD++N
Sbjct  1     MSRYNSDPNPFD-EEEEVNPFSKGAGAPASKARIPPLGHEAMGFGH-NDATVDIPLDTMN  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+K+L +WEADLKRRE +IKRREDAVA  G+  +DKNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DSKKKEKDLTSWEADLKRREKEIKRREDAVAKTGITPNDKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRP
Sbjct  119   AQRIQYLAFASWLGIVLCLVFNVIAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFF+FYL+HIGFCIFAAIAPPI+FHGKSLTGIL A+DVFSDHVLVG
Sbjct  179   LYRAMRTDSALKFSWFFVFYLIHIGFCIFAAIAPPIVFHGKSLTGILPAVDVFSDHVLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYLVGFGLFCLE+LLSLWVLQ
Sbjct  239   -----------------------IFYLVGFGLFCLESLLSLWVLQ  260



>ref|XP_008238130.1| PREDICTED: secretory carrier-associated membrane protein 4 [Prunus 
mume]
Length=273

 Score =   397 bits (1019),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 230/286 (80%), Gaps = 25/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEV--NPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             MNR +DPNPFD+E  EV  NPFSNG  AP SKSR+P + +  LGFGQKHDATVDIPLD++
Sbjct  1     MNRHHDPNPFDEEVVEVEVNPFSNGAGAPKSKSRVPPLASEPLGFGQKHDATVDIPLDTM  60

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND K+K KELA WEADLKRRE DIKRRED+VA AGVP  D+NWPPFFPIIHHDI NEIPV
Sbjct  61    NDSKQKAKELATWEADLKRREKDIKRREDSVAKAGVPADDRNWPPFFPIIHHDIANEIPV  120

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +Q++QYLAFASWLGIVLCL +N +A+ VCWI+G GVKIFLLA IYAL+GCPLSYVLWYR
Sbjct  121   HAQRLQYLAFASWLGIVLCLSFNAIAIIVCWIRGGGVKIFLLATIYALLGCPLSYVLWYR  180

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SA KFGWFF+FY+LHIGFCIFAAIAPPI+F+G+SLTGIL AIDVFSDHV+V
Sbjct  181   PLYRAMRTDSAFKFGWFFLFYMLHIGFCIFAAIAPPIVFNGRSLTGILPAIDVFSDHVVV  240

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFYL GF LFCLE LLS WVLQ
Sbjct  241   G-----------------------IFYLTGFALFCLETLLSFWVLQ  263



>ref|XP_012069332.1| PREDICTED: secretory carrier-associated membrane protein 4 [Jatropha 
curcas]
 gb|KDP40432.1| hypothetical protein JCGZ_03847 [Jatropha curcas]
Length=269

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 238/295 (81%), Gaps = 28/295 (9%)
 Frame = -2

Query  1285  MNR-RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R  +DPNPFD  E+EVNPFSNG  APGSK+R+P + A   GFG  +DATVDIPLD++N
Sbjct  1     MSRYHSDPNPFD--EEEVNPFSNGATAPGSKTRVPPVGAQPAGFGH-NDATVDIPLDTMN  57

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             DPKKK+KELAAWEADLKRRE DIKRREDAVA AGVP  DKNWPPFFPIIHHDI NEIP+ 
Sbjct  58    DPKKKEKELAAWEADLKRREKDIKRREDAVANAGVPADDKNWPPFFPIIHHDIANEIPIH  117

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AV V WI+G GVKIFLLA IYAL G P+SYVLWYRP
Sbjct  118   AQRLQYLAFASWLGIVLCLVFNVIAVLVNWIRGGGVKIFLLASIYALSGIPMSYVLWYRP  177

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYLLH+GFCIFAAIAPPI+FHGKSLTGIL A+DV SD++LVG
Sbjct  178   LYRAMRTDSALKFGWFFLFYLLHVGFCIFAAIAPPIVFHGKSLTGILPAVDVISDNLLVG  237

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                    IFYLVGFGLFCLE+LLSLWVLQ V  Y  GH 
Sbjct  238   -----------------------IFYLVGFGLFCLESLLSLWVLQKVYMYFRGHK  269



>ref|XP_002303454.1| secretory carrier membrane family protein [Populus trichocarpa]
 gb|ABK94959.1| unknown [Populus trichocarpa]
 gb|EEE78433.1| secretory carrier membrane family protein [Populus trichocarpa]
Length=270

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 234/285 (82%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRN-DPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R N DPNPFD EE+EVNPFS G  AP SK+RIP +    +GFG  +DATVDIPLD++N
Sbjct  1     MSRYNSDPNPFD-EEEEVNPFSKGAVAPASKARIPPLGHEAMGFGH-NDATVDIPLDTMN  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK K+LA+WEADLKRRE +IKRREDAVA  G+  +DKNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DSKKKGKDLASWEADLKRREKEIKRREDAVAKTGITPNDKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRP
Sbjct  119   AQRIQYLAFASWLGIVLCLVFNVIAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFF+FYL+HIGFCIFAAIAPPI+FHGKSLTGIL A+DVFSDHVLVG
Sbjct  179   LYRAMRTDSALKFSWFFVFYLIHIGFCIFAAIAPPIVFHGKSLTGILPAVDVFSDHVLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYLVGFGLFCLE+LLSLWVLQ
Sbjct  239   -----------------------IFYLVGFGLFCLESLLSLWVLQ  260



>gb|AFK40014.1| unknown [Medicago truncatula]
Length=267

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 230/285 (81%), Gaps = 29/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN-  1109
             MNR +DPNPF  EE+EVNPFSNG    GSKSR+P + +  LGFGQ+HDATVDIPL++ N 
Sbjct  1     MNRDHDPNPF--EEEEVNPFSNGT---GSKSRVPSVASEPLGFGQRHDATVDIPLETSNG  55

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK +ELA WEADLKRRE DIKRRED+VA AGVPV DKNWPPFFPIIHHDI NEIPV 
Sbjct  56    DSKKKSQELAVWEADLKRREKDIKRREDSVAKAGVPVDDKNWPPFFPIIHHDIANEIPVH  115

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QY AFASWLGIVLCLV+N+VAV VCWI+G GVKIF LA+IYAL+G PLSYVLWYRP
Sbjct  116   AQRLQYSAFASWLGIVLCLVFNVVAVIVCWIRGGGVKIFFLAVIYALLGIPLSYVLWYRP  175

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFFMFYLLHI FCIFAAIAPP++FHGKSL GILAAIDVFSDHVLVG
Sbjct  176   LYRAMRTDSALKFSWFFMFYLLHIAFCIFAAIAPPVVFHGKSLMGILAAIDVFSDHVLVG  235

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYL+GFGLFCLE  LSLWV+Q
Sbjct  236   -----------------------IFYLIGFGLFCLEVFLSLWVIQ  257



>ref|XP_007209463.1| hypothetical protein PRUPE_ppa009893mg [Prunus persica]
 gb|EMJ10662.1| hypothetical protein PRUPE_ppa009893mg [Prunus persica]
Length=273

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 229/286 (80%), Gaps = 25/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEV--NPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             MNR +DPNPFD+E  EV  NPFSNG  AP SKSR+P + +  LGFG KHDATVDIPLD++
Sbjct  1     MNRHHDPNPFDEEVVEVEVNPFSNGAGAPKSKSRVPPLASEPLGFGHKHDATVDIPLDTM  60

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND K+K KELA WEADLKRRE DIKRRED+VA AGVP  D+NWPPFFPIIHHDI NEIPV
Sbjct  61    NDSKQKAKELATWEADLKRREKDIKRREDSVAKAGVPADDRNWPPFFPIIHHDIANEIPV  120

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +Q++QYLAFASWLGIVLCL +N +A+ VCWI+G GVKIFLLA IYAL+GCPLSYVLWYR
Sbjct  121   HAQRLQYLAFASWLGIVLCLSFNAIAIIVCWIRGGGVKIFLLATIYALLGCPLSYVLWYR  180

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SA KFGWFF+FY+LHIGFCIFAAIAPPI+F+G+SLTGIL AIDVFSDHV+V
Sbjct  181   PLYRAMRTDSAFKFGWFFLFYMLHIGFCIFAAIAPPIVFNGRSLTGILPAIDVFSDHVVV  240

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFYL GF LFCLE LLS WVLQ
Sbjct  241   G-----------------------IFYLTGFALFCLETLLSFWVLQ  263



>ref|XP_002274060.1| PREDICTED: secretory carrier-associated membrane protein 4 [Vitis 
vinifera]
 emb|CBI33788.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 227/284 (80%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M R+NDPNPFD  E+EVNPFS    APGS+SR+P   +  LGF  K+DATVDIPLD+LND
Sbjct  1     MIRQNDPNPFD--EEEVNPFSKVATAPGSRSRVPPAASANLGFNDKYDATVDIPLDTLND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KK+KELAAWEADLKR+E DIKRREDAV+  G+P  DKNWP FFPIIH+DI NEIPV++
Sbjct  59    SNKKEKELAAWEADLKRKEKDIKRREDAVSKKGIPTEDKNWPSFFPIIHNDIANEIPVDA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+NI+AVTVCWIKG G KIFLLAIIYAL+GCPLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLVFNIIAVTVCWIKGGGAKIFLLAIIYALVGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRTNSAL FGWFF+ Y +HI FCI AAIAPPI+F GKSLTGIL+AID+FSDHVLVG 
Sbjct  179   YRAMRTNSALNFGWFFLVYAIHICFCIVAAIAPPIVFEGKSLTGILSAIDLFSDHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GF LFCLE LLSLWV+Q
Sbjct  238   ----------------------IFYLIGFALFCLEMLLSLWVIQ  259



>ref|XP_011018450.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Populus euphratica]
Length=270

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 237/295 (80%), Gaps = 27/295 (9%)
 Frame = -2

Query  1285  MNRRN-DPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R N DPNPFD EE+EVNPFS G + P SK+RIP +    +GFG  +DATVDIPLD++N
Sbjct  1     MSRFNSDPNPFD-EEEEVNPFSKGSSVPASKARIPPLGHEPMGFGH-NDATVDIPLDTMN  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+K+LA+WEADLKRRE +IKRREDAVA  G+   DKNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DSKKKEKDLASWEADLKRREKEIKRREDAVAKTGITPDDKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF LA+IY LMGCPLSYVLWYRP
Sbjct  119   AQRLQYLAFASWLGIVLCLVFNLIAVTVCWIRGGGVKIFFLAVIYVLMGCPLSYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYL+HIGFCIFAAIAPPI+FHGKSLTGIL A+DV SDH+LVG
Sbjct  179   LYRAMRTDSALKFGWFFLFYLIHIGFCIFAAIAPPIVFHGKSLTGILPAVDVISDHLLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                    IFYLVGFGLFCLE+LLSLWVLQ +  Y  GH 
Sbjct  239   -----------------------IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK  270



>ref|XP_007040767.1| SCAMP family protein isoform 1 [Theobroma cacao]
 gb|EOY25268.1| SCAMP family protein isoform 1 [Theobroma cacao]
Length=265

 Score =   391 bits (1005),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 203/294 (69%), Positives = 233/294 (79%), Gaps = 30/294 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNGG    ++     + +  LGFGQKHDATVDIPLD++N+
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGGAVAPARP----LASEPLGFGQKHDATVDIPLDTMNE  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KELAAWEADLKRRE DIKRREDA++ AGV V +KNWPP FPIIHHDI NEIPV +
Sbjct  55    PKKKEKELAAWEADLKRREKDIKRREDAISQAGVTVDNKNWPPIFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLVYN++AV VCWI+G GVKIF LAIIY L+GCPLSYVLWYRPL
Sbjct  115   QRLQYLAFASWLGIVLCLVYNVIAVIVCWIQGGGVKIFFLAIIYMLLGCPLSYVLWYRPL  174

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL FGWFFMFYLLH+GFCIFAAIAPP++FHGKSLTG+LAA DV S+H++ G 
Sbjct  175   YRAMRTDSALNFGWFFMFYLLHLGFCIFAAIAPPVVFHGKSLTGVLAAFDVISNHLVAG-  233

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFY VGFGLFCLE+LLSLWVLQ +  Y  GH 
Sbjct  234   ----------------------IFYFVGFGLFCLESLLSLWVLQKIYLYFRGHK  265



>ref|XP_002519001.1| secretory carrier membrane protein, putative [Ricinus communis]
 gb|EEF43534.1| secretory carrier membrane protein, putative [Ricinus communis]
Length=272

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 235/295 (80%), Gaps = 28/295 (9%)
 Frame = -2

Query  1285  MNR-RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R  NDPNPFD  E+EVNPFSNG  AP SK+RIP +     GFG  +DATVDIPLD++N
Sbjct  1     MSRFHNDPNPFD--EEEVNPFSNGSTAPASKTRIPPLGPEPAGFGH-NDATVDIPLDTMN  57

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             DPKKK+KELA+WEADLKRRE +IKRREDAVA AGVPV DKNWPPFFPIIHHDI NEIP+ 
Sbjct  58    DPKKKEKELASWEADLKRREKEIKRREDAVAKAGVPVDDKNWPPFFPIIHHDIANEIPIH  117

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AV V WI+G GVKIFLLA IYAL G P+SYVLWYRP
Sbjct  118   AQRLQYLAFASWLGIVLCLVFNVIAVLVNWIRGGGVKIFLLASIYALSGIPMSYVLWYRP  177

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKF WFF+FYLLHIGFCIFAAIAPPI+FHGKSLTGIL A+DV S H+LVG
Sbjct  178   LYRAMRTDSALKFSWFFLFYLLHIGFCIFAAIAPPIVFHGKSLTGILPAVDVISHHLLVG  237

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                    IFYLVGFGLFCLE+LLSLWVLQ V  Y  GH 
Sbjct  238   -----------------------IFYLVGFGLFCLESLLSLWVLQKVYMYFRGHK  269



>ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa]
 gb|ABK93338.1| unknown [Populus trichocarpa]
 gb|ERP64896.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa]
Length=270

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 236/295 (80%), Gaps = 27/295 (9%)
 Frame = -2

Query  1285  MNRRN-DPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R N DPNPFD EE+EVNPFS G + P  K+RIP +    +GFG  +DATVDIPLD++N
Sbjct  1     MSRFNSDPNPFD-EEEEVNPFSKGSSVPAVKARIPPLGHEPMGFGH-NDATVDIPLDTMN  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+K+LA+WEADLKRRE +IKRREDAVA  G+   DKNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DSKKKEKDLASWEADLKRREKEIKRREDAVAKTGITPDDKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF LA+IY LMGCPLSY+LWYRP
Sbjct  119   AQRLQYLAFASWLGIVLCLVFNLIAVTVCWIRGGGVKIFFLAVIYVLMGCPLSYILWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYL+HIGFCIFAAIAPPI+FHGKSLTGIL A+DV SDH+LVG
Sbjct  179   LYRAMRTDSALKFGWFFLFYLIHIGFCIFAAIAPPIVFHGKSLTGILPAVDVISDHLLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                    IFYLVGFGLFCLE+LLSLWVLQ +  Y  GH 
Sbjct  239   -----------------------IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK  270



>ref|XP_006432645.1| hypothetical protein CICLE_v10002151mg [Citrus clementina]
 ref|XP_006471452.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Citrus sinensis]
 gb|ESR45885.1| hypothetical protein CICLE_v10002151mg [Citrus clementina]
 gb|KDO58811.1| hypothetical protein CISIN_1g047188mg [Citrus sinensis]
Length=271

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 235/296 (79%), Gaps = 26/296 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNG  AP S+S++P + +  +GFGQK+ ATVDIPLD++N+
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGPAAPASRSQVPSVTSEPIGFGQKYGATVDIPLDNMNE  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK++ELA+WEADLKRRE +IKRRE+A+  AGVP  D+NWPPFFPIIHHDI  EIP+ +
Sbjct  59    PKKKERELASWEADLKRREKEIKRREEAIVKAGVPTDDRNWPPFFPIIHHDISKEIPIHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASW GIVLCLV+N++AV VCWIKG GVKIF LA IYAL+G P+SYVLWYRPL
Sbjct  119   QRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKF WFF+FYL+HIGFCIFAAIAPP++FHGKSLTGILAAIDV SD +L G 
Sbjct  179   YRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHSHT  401
                                   IFY++GFGLF LE+LLSLWV+Q +  +  G S T
Sbjct  238   ----------------------IFYMIGFGLFVLESLLSLWVIQKIYMFFRGTSET  271



>ref|XP_008788581.1| PREDICTED: LOW QUALITY PROTEIN: secretory carrier-associated 
membrane protein 4 [Phoenix dactylifera]
Length=268

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 226/284 (80%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M RR+DPNPFD  E+EVNPFS G   PGSK   P + +  LGFG KHDATVDIPL+++ND
Sbjct  1     MPRRDDPNPFD--EEEVNPFSKGA-GPGSKLHFPSLSSLHLGFGNKHDATVDIPLETMND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK KELAAWE DL+RREMDIKRREDA++ +GV + +KNWPPFFPIIHHDI  EIP+ +
Sbjct  58    SKKKAKELAAWETDLRRREMDIKRREDALSNSGVSMDEKNWPPFFPIIHHDIAKEIPIHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++AVTVCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  118   QKLQYLAFASWLGIVLCLVWNVIAVTVCWIKGGGVKIFFLATIYALLGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SA+KFGWF   YL HIGFCIFAAIAPPI+FHGKSLTGILAA+D  SDH+LVG 
Sbjct  178   YRAMRTDSAVKFGWFSFXYLFHIGFCIFAAIAPPIVFHGKSLTGILAAVDTISDHLLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYLVGFGLFCLE L+SLWVLQ
Sbjct  237   ----------------------IFYLVGFGLFCLETLISLWVLQ  258



>ref|XP_010540734.1| PREDICTED: secretory carrier-associated membrane protein 4 [Tarenaya 
hassleriana]
Length=269

 Score =   387 bits (993),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 229/286 (80%), Gaps = 29/286 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDD--EEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             MNR +DPNPFD+  EE+ VNPFS G  A G   R+P   +  +GFG+ HDATVDIPLD++
Sbjct  1     MNRHHDPNPFDEGEEEETVNPFSKGAGATG---RVPA-ASRPVGFGKSHDATVDIPLDTM  56

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND  KKQ+ELA WEADL+R+EMDIKRRE+A+A +GV V DKNWPPFFPIIHHDI NEIP+
Sbjct  57    NDSSKKQRELADWEADLRRKEMDIKRREEAIAKSGVQVDDKNWPPFFPIIHHDIANEIPI  116

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +QK+QYLAFASWLGIVLCLV+N++AV VCWIKG GVKIF LA IYAL+GCP+SYVLWYR
Sbjct  117   HAQKLQYLAFASWLGIVLCLVFNVIAVIVCWIKGGGVKIFFLAAIYALLGCPISYVLWYR  176

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SALKFGWFF+FYL+HIGFCIFAAIAPPI+FHGKSLTG+LAAIDV SD +L 
Sbjct  177   PLYRAMRTDSALKFGWFFLFYLIHIGFCIFAAIAPPIVFHGKSLTGVLAAIDVISDSLLA  236

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFY VGFGLFCLE+LLSLWVLQ
Sbjct  237   G-----------------------IFYFVGFGLFCLESLLSLWVLQ  259



>ref|XP_006368326.1| secretory carrier membrane family protein [Populus trichocarpa]
 gb|ERP64895.1| secretory carrier membrane family protein [Populus trichocarpa]
Length=269

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 236/295 (80%), Gaps = 28/295 (9%)
 Frame = -2

Query  1285  MNRRN-DPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M+R N DPNPFD EE+EVNPFS G + P  K+RIP +    +GFG  +DATVDIPLD++N
Sbjct  1     MSRFNSDPNPFD-EEEEVNPFS-GSSVPAVKARIPPLGHEPMGFGH-NDATVDIPLDTMN  57

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+K+LA+WEADLKRRE +IKRREDAVA  G+   DKNWPPFFPIIHHDI NEIP+ 
Sbjct  58    DSKKKEKDLASWEADLKRREKEIKRREDAVAKTGITPDDKNWPPFFPIIHHDIANEIPIH  117

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +Q++QYLAFASWLGIVLCLV+N++AVTVCWI+G GVKIF LA+IY LMGCPLSY+LWYRP
Sbjct  118   AQRLQYLAFASWLGIVLCLVFNLIAVTVCWIRGGGVKIFFLAVIYVLMGCPLSYILWYRP  177

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYL+HIGFCIFAAIAPPI+FHGKSLTGIL A+DV SDH+LVG
Sbjct  178   LYRAMRTDSALKFGWFFLFYLIHIGFCIFAAIAPPIVFHGKSLTGILPAVDVISDHLLVG  237

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                    IFYLVGFGLFCLE+LLSLWVLQ +  Y  GH 
Sbjct  238   -----------------------IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK  269



>ref|XP_009385714.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=266

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 226/290 (78%), Gaps = 27/290 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKK  1094
              DPNPFD  E +VNPF+    A GS SR+P + +   GFG K+DATVDIPLD++ND KK+
Sbjct  3     RDPNPFD--EMDVNPFATSA-ASGSNSRLPTLASKAFGFGNKNDATVDIPLDTVNDAKKR  59

Query  1093  QKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQ  914
             +KELA WE +LKRREMDIKRREDA+  AGV + +KNWPPFFPIIHHDI  EIPV +Q++Q
Sbjct  60    EKELATWEENLKRREMDIKRREDALTRAGVTIEEKNWPPFFPIIHHDIAKEIPVHAQRLQ  119

Query  913   YLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAM  734
             YLAFASWLGI+LCL +N++AV VCWIKG GVKIF LAIIYAL+GCPLSYVLWYRPLY AM
Sbjct  120   YLAFASWLGILLCLSWNVIAVIVCWIKGGGVKIFFLAIIYALLGCPLSYVLWYRPLYRAM  179

Query  733   RTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN  554
             RT+SALKFGWFF+FYL+H+GFCI AAIAPPI+FHGKSLTGILAAID FSDH LVG     
Sbjct  180   RTDSALKFGWFFLFYLIHVGFCILAAIAPPIVFHGKSLTGILAAIDTFSDHALVG-----  234

Query  553   *HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                               IFYLVGFGLFCLE L+SLWVLQ V  Y  GH 
Sbjct  235   ------------------IFYLVGFGLFCLETLISLWVLQRVYMYFRGHE  266



>ref|XP_010054106.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X1 [Eucalyptus grandis]
 gb|KCW78484.1| hypothetical protein EUGRSUZ_D02626 [Eucalyptus grandis]
Length=269

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 238/293 (81%), Gaps = 26/293 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD EE+EVNPFS G  AP SKSR+P + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFD-EEEEVNPFSKG-TAPASKSRLPPLASEPLGFGQKHDATVDIPLDTMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K KELA+WEADLKRRE +IKRREDAV+ A VP+ DKNWPP FPIIHHDI NEIPV +
Sbjct  59    SKEKVKELASWEADLKRREREIKRREDAVSKANVPLDDKNWPPCFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLTFNVLAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL F WFF+FYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  179   YRAMRTDSALNFSWFFLFYLLHVGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                   IFYLVGF LFCLE+LLS+WVLQ    Y  GH
Sbjct  238   ----------------------IFYLVGFALFCLESLLSMWVLQKTYMYFRGH  268



>ref|XP_010054107.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X2 [Eucalyptus grandis]
Length=268

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 238/293 (81%), Gaps = 27/293 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD EE+EVNPFS  G AP SKSR+P + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFD-EEEEVNPFS--GTAPASKSRLPPLASEPLGFGQKHDATVDIPLDTMND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K KELA+WEADLKRRE +IKRREDAV+ A VP+ DKNWPP FPIIHHDI NEIPV +
Sbjct  58    SKEKVKELASWEADLKRREREIKRREDAVSKANVPLDDKNWPPCFPIIHHDIANEIPVHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLTFNVLAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL F WFF+FYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  178   YRAMRTDSALNFSWFFLFYLLHVGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                   IFYLVGF LFCLE+LLS+WVLQ    Y  GH
Sbjct  237   ----------------------IFYLVGFALFCLESLLSMWVLQKTYMYFRGH  267



>ref|XP_009408101.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 223/280 (80%), Gaps = 26/280 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKK  1094
              DPNPFD  E++VNPF++G +APGS SR+  + +   GFG K+DATVDIPLD++ND KK 
Sbjct  3     RDPNPFD--EEDVNPFASG-SAPGSNSRLSTLASKAFGFGNKNDATVDIPLDTVNDAKKS  59

Query  1093  QKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQ  914
             + ELAAWE +LKRREMDIKRRED++  AGV V DKNWP FFPIIHHDI  EIPV +Q++Q
Sbjct  60    ETELAAWEENLKRREMDIKRREDSLTRAGVTVEDKNWPSFFPIIHHDIAKEIPVHAQRLQ  119

Query  913   YLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAM  734
             YLAFASWLGIVLCL +N++AV VCWI+G GVKIF LAIIYAL+GCPLSYVLWYRPLY AM
Sbjct  120   YLAFASWLGIVLCLSWNVIAVIVCWIRGGGVKIFFLAIIYALLGCPLSYVLWYRPLYRAM  179

Query  733   RTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN  554
             RTNSA KFGWFF+FYL+HIGFCI AAIAPPI+FHGKSLTGILAAID FSDH LVG     
Sbjct  180   RTNSAFKFGWFFLFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDTFSDHALVG-----  234

Query  553   *HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                               IFYLVGFGLFCLE L+SLWVLQ
Sbjct  235   ------------------IFYLVGFGLFCLEILISLWVLQ  256



>gb|EPS61281.1| secretory carrier-associated membrane protein 2 [Genlisea aurea]
Length=266

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 226/293 (77%), Gaps = 29/293 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R  DPNPFD+ E EVNPF+N      SKSRIP++VA+T GFGQKHDATVDIPLDS  D
Sbjct  1     MSRTGDPNPFDEGEPEVNPFANNS---ASKSRIPKVVASTFGFGQKHDATVDIPLDS--D  55

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             P  K K+LA WEADLK+RE DIKRREDAV  AGVPV D+NWPPFFPIIHHDI NEIPV +
Sbjct  56    PNMKAKQLATWEADLKQRERDIKRREDAVLNAGVPVDDRNWPPFFPIIHHDIANEIPVHA  115

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAFASWLG+V CL++N++A+TV WI+G GV IF LA+IY L GCPLSYVLWYRPL
Sbjct  116   QRMQYLAFASWLGLVFCLLFNVLAITVAWIRGGGVMIFFLAVIYVLSGCPLSYVLWYRPL  175

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNA+R +SA+KFGWFF+FYL+H+ FCIFA+IAPP  FHGKS TGILAAID FS +VLVGV
Sbjct  176   YNAVRNDSAVKFGWFFLFYLIHVAFCIFASIAPPFAFHGKSFTGILAAIDGFSSNVLVGV  235

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                    FYL+GFG FCLEALLSLWVLQ V  Y  G 
Sbjct  236   -----------------------FYLIGFGFFCLEALLSLWVLQKVYSYFRGQ  265



>ref|XP_011465083.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=260

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 224/284 (79%), Gaps = 34/284 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPF++EE E     NG      KSRIP + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFEEEEVE-----NG------KSRIPPLSSEPLGFGQKHDATVDIPLDTMND  49

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +K KELAAWEADLKRRE DIKRRED+VA AGVP   KNWPPFFPIIHHDI NEIPV +
Sbjct  50    SNQKAKELAAWEADLKRREKDIKRREDSVAKAGVPDDGKNWPPFFPIIHHDIANEIPVHA  109

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFASWLGIVLCLV+N++AV VCW++G G KIF LAIIYAL+G PLSYVLWYRPL
Sbjct  110   QRLQYMAFASWLGIVLCLVFNVIAVIVCWVRGGGSKIFFLAIIYALLGVPLSYVLWYRPL  169

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFFMFY+LHIGFCI AAIAPPI+F GKSLTGILAAIDVFSDHV+VG 
Sbjct  170   YRAMRTDSALKFGWFFMFYMLHIGFCIIAAIAPPIVFQGKSLTGILAAIDVFSDHVIVG-  228

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GF LFCLE+LLS WVLQ
Sbjct  229   ----------------------IFYLIGFALFCLESLLSFWVLQ  250



>ref|XP_007040770.1| SCAMP family protein isoform 4 [Theobroma cacao]
 gb|EOY25271.1| SCAMP family protein isoform 4 [Theobroma cacao]
Length=273

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 230/295 (78%), Gaps = 37/295 (13%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNGG    ++     + +  LGFGQKHDATVDIPLD++N+
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGGAVAPARP----LASEPLGFGQKHDATVDIPLDTMNE  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KELAAWEADLKRRE DIKRREDA++ AGV V +KNWPP FPIIHHDI NEIPV +
Sbjct  55    PKKKEKELAAWEADLKRREKDIKRREDAISQAGVTVDNKNWPPIFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLVYN++AV VCWI+G GVKIF LAIIY L+GCPLSYVLWYRPL
Sbjct  115   QRLQYLAFASWLGIVLCLVYNVIAVIVCWIQGGGVKIFFLAIIYMLLGCPLSYVLWYRPL  174

Query  745   Y--------NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVF  590
             Y        +  RT+SAL FGWFFMFYLLH+GFCIFAAIAPP++FHGKSLTG+LAA DV 
Sbjct  175   YRCSAVYFVSPCRTDSALNFGWFFMFYLLHLGFCIFAAIAPPVVFHGKSLTGVLAAFDVI  234

Query  589   SDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQVCD  425
             S+H++ G                       IFY VGFGLFCLE+LLSLWVLQV D
Sbjct  235   SNHLVAG-----------------------IFYFVGFGLFCLESLLSLWVLQVRD  266



>ref|XP_007040768.1| SCAMP family protein isoform 2 [Theobroma cacao]
 gb|EOY25269.1| SCAMP family protein isoform 2 [Theobroma cacao]
Length=273

 Score =   379 bits (974),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 232/302 (77%), Gaps = 38/302 (13%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNGG    ++     + +  LGFGQKHDATVDIPLD++N+
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGGAVAPARP----LASEPLGFGQKHDATVDIPLDTMNE  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KELAAWEADLKRRE DIKRREDA++ AGV V +KNWPP FPIIHHDI NEIPV +
Sbjct  55    PKKKEKELAAWEADLKRREKDIKRREDAISQAGVTVDNKNWPPIFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLVYN++AV VCWI+G GVKIF LAIIY L+GCPLSYVLWYRPL
Sbjct  115   QRLQYLAFASWLGIVLCLVYNVIAVIVCWIQGGGVKIFFLAIIYMLLGCPLSYVLWYRPL  174

Query  745   Y--------NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVF  590
             Y        +  RT+SAL FGWFFMFYLLH+GFCIFAAIAPP++FHGKSLTG+LAA DV 
Sbjct  175   YRCSAVYFVSPCRTDSALNFGWFFMFYLLHLGFCIFAAIAPPVVFHGKSLTGVLAAFDVI  234

Query  589   SDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNG  413
             S+H++ G                       IFY VGFGLFCLE+LLSLWVLQ +  Y  G
Sbjct  235   SNHLVAG-----------------------IFYFVGFGLFCLESLLSLWVLQKIYLYFRG  271

Query  412   HS  407
             H 
Sbjct  272   HK  273



>ref|XP_011626934.1| PREDICTED: secretory carrier-associated membrane protein 4 [Amborella 
trichopoda]
Length=271

 Score =   379 bits (973),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 226/296 (76%), Gaps = 26/296 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD  E+EVNPFS+    PGS+SR+  +    +GFG   DATVDIPLD++ND
Sbjct  1     MHRHNDPNPFD--EEEVNPFSHASAPPGSRSRLSPLAHEPVGFGYNQDATVDIPLDTIND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KEL AWE DLKRRE DIKRRE+AVA AGV  ++KNWPP FPIIHHDI NEIP  +
Sbjct  59    PKKKEKELKAWEIDLKRREQDIKRREEAVARAGVVTNEKNWPPLFPIIHHDIANEIPPHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFASWLGIVLCLV+N++AVT+ WIKG GVKI+ LA+IYAL+GCPLSYVLWYRPL
Sbjct  119   QRLQYVAFASWLGIVLCLVFNVLAVTINWIKGAGVKIWFLAVIYALLGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SA KFGWFFM YL HIGFCIFAAIAPP+ F GKSLTGIL AIDVFSD V VG 
Sbjct  179   YRAMRTDSAFKFGWFFMLYLFHIGFCIFAAIAPPLFFKGKSLTGILPAIDVFSDSVFVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHSHT  401
                                   IFYLVGFGLFC EALLS+WVL QV  Y  G   T
Sbjct  238   ----------------------IFYLVGFGLFCCEALLSIWVLQQVYTYFRGAHRT  271



>ref|XP_009347089.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Pyrus x bretschneideri]
Length=263

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/263 (72%), Positives = 218/263 (83%), Gaps = 23/263 (9%)
 Frame = -2

Query  1222  NGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMD  1043
             NG  AP SKSR+P + ++ LGFGQKHDATVDIPLD++ND K+K KELA WEADL +RE D
Sbjct  14    NGAAAPKSKSRVPPVSSDHLGFGQKHDATVDIPLDTMNDSKQKAKELATWEADLNKREKD  73

Query  1042  IKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYN  863
             IKRRED+VA AGVPV D+NWPPFFPIIHHDI NEIP+ +Q++QYLAFASWLGIVLCL +N
Sbjct  74    IKRREDSVAKAGVPVDDRNWPPFFPIIHHDIANEIPIHAQRLQYLAFASWLGIVLCLFFN  133

Query  862   IVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLL  683
             ++A+ VCWI+G GVKIFLLA IYALMGCPLSYVLWYRPLY AMRT+SALKFGWFF+FY+L
Sbjct  134   VIAIIVCWIRGGGVKIFLLATIYALMGCPLSYVLWYRPLYRAMRTDSALKFGWFFLFYML  193

Query  682   HIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYL  503
             HIGFCIFAAIAPPI+F+GKSLTGIL+A+DVFSDHV+VG                      
Sbjct  194   HIGFCIFAAIAPPIVFNGKSLTGILSAVDVFSDHVVVG----------------------  231

Query  502   QIFYLVGFGLFCLEALLSLWVLQ  434
              IFYL GF LFCLE+LLSLWVLQ
Sbjct  232   -IFYLTGFALFCLESLLSLWVLQ  253



>gb|ERN15563.1| hypothetical protein AMTR_s00048p00135190 [Amborella trichopoda]
Length=289

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 228/298 (77%), Gaps = 30/298 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD  E+EVNPFS+    PGS+SR+  +    +GFG   DATVDIPLD++ND
Sbjct  1     MHRHNDPNPFD--EEEVNPFSHASAPPGSRSRLSPLAHEPVGFGYNQDATVDIPLDTIND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KEL AWE DLKRRE DIKRRE+AVA AGV  ++KNWPP FPIIHHDI NEIP  +
Sbjct  59    PKKKEKELKAWEIDLKRREQDIKRREEAVARAGVVTNEKNWPPLFPIIHHDIANEIPPHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFASWLGIVLCLV+N++AVT+ WIKG GVKI+ LA+IYAL+GCPLSYVLWYRPL
Sbjct  119   QRLQYVAFASWLGIVLCLVFNVLAVTINWIKGAGVKIWFLAVIYALLGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SA KFGWFFM YL HIGFCIFAAIAPP+ F GKSLTGIL AIDVFSD V VG 
Sbjct  179   YRAMRTDSAFKFGWFFMLYLFHIGFCIFAAIAPPLFFKGKSLTGILPAIDVFSDSVFVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQVCDYKNGHSHTVMF  392
                                   IFYLVGFGLFC EALLS+WVLQ+      HSH + +
Sbjct  238   ----------------------IFYLVGFGLFCCEALLSIWVLQLL-----HSHPLTW  268



>ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
 ref|XP_006415262.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
 gb|ESQ33614.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
 gb|ESQ33615.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
Length=264

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 222/284 (78%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EE+ VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDTMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+L+++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV +
Sbjct  54    SSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD VL G 
Sbjct  174   YRAMRTDSALKFGWFFFSYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSVLAG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLSLWVLQ
Sbjct  233   ----------------------IFYFIGFGLFCLESLLSLWVLQ  254



>ref|XP_009385715.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=264

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 224/290 (77%), Gaps = 29/290 (10%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKK  1094
              DPNPFD  E +VNPF+    A GS SR+P + +   GFG K+DATVDIPLD+  D KK+
Sbjct  3     RDPNPFD--EMDVNPFATSA-ASGSNSRLPTLASKAFGFGNKNDATVDIPLDT--DAKKR  57

Query  1093  QKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQ  914
             +KELA WE +LKRREMDIKRREDA+  AGV + +KNWPPFFPIIHHDI  EIPV +Q++Q
Sbjct  58    EKELATWEENLKRREMDIKRREDALTRAGVTIEEKNWPPFFPIIHHDIAKEIPVHAQRLQ  117

Query  913   YLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAM  734
             YLAFASWLGI+LCL +N++AV VCWIKG GVKIF LAIIYAL+GCPLSYVLWYRPLY AM
Sbjct  118   YLAFASWLGILLCLSWNVIAVIVCWIKGGGVKIFFLAIIYALLGCPLSYVLWYRPLYRAM  177

Query  733   RTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN  554
             RT+SALKFGWFF+FYL+H+GFCI AAIAPPI+FHGKSLTGILAAID FSDH LVG     
Sbjct  178   RTDSALKFGWFFLFYLIHVGFCILAAIAPPIVFHGKSLTGILAAIDTFSDHALVG-----  232

Query  553   *HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                               IFYLVGFGLFCLE L+SLWVLQ V  Y  GH 
Sbjct  233   ------------------IFYLVGFGLFCLETLISLWVLQRVYMYFRGHE  264



>ref|XP_009108000.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X2 [Brassica rapa]
Length=265

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 223/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + +KNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDEKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD VL G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSVLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>emb|CDY41746.1| BnaA08g07010D [Brassica napus]
Length=265

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 223/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + +KNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDEKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|XP_009409813.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=268

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 224/293 (76%), Gaps = 27/293 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M R  DPNPFD  E  V+PFSNG  +   KS+ P + + TLGFG KHDA VD+PL++ ND
Sbjct  1     MQRHGDPNPFD--EDAVSPFSNGAGS-DKKSKFPSLSSVTLGFGNKHDAVVDVPLETTND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              +KK +ELAAWEA+LKRRE +IKRREDA++ AGV   DKNWPP FPIIHHDI  EIP+ +
Sbjct  58    SRKKAQELAAWEAELKRRETEIKRREDALSNAGVTTEDKNWPPVFPIIHHDIAKEIPIHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +NI+AVTVCWIKG GVK+F LAIIYA +GCPLSY+LWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLSWNILAVTVCWIKGCGVKVFFLAIIYAFLGCPLSYLLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT SA++FGWFF+ YL+HIGFCI AAIAPPI+F GKSLTGILAAID FSDH++VG 
Sbjct  178   YRAMRTESAVRFGWFFLLYLIHIGFCIIAAIAPPIVFDGKSLTGILAAIDTFSDHMVVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                   IFYL+GFGLFCLE LLSLWVLQ +  Y  GH
Sbjct  237   ----------------------IFYLIGFGLFCLETLLSLWVLQKIYMYFRGH  267



>ref|XP_008809221.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Phoenix dactylifera]
Length=269

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 217/284 (76%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M RR+D NPFD EE+EVNPFS G   PGSK R P + +  LGFG KHDATVDIPL+++ND
Sbjct  1     MARRDDTNPFD-EEEEVNPFSKGAG-PGSKLRFPSLSSLPLGFGNKHDATVDIPLETMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK KELA  EADLKRRE  IKRREDA++  GV   +KNWPPFFPIIHHDI  EIPV +
Sbjct  59    TKKKAKELATLEADLKRRETAIKRREDALSSGGVSTEEKNWPPFFPIIHHDIAKEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N+ AV VCWI+G G+ IF LA IYA +GCPLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLVWNVTAVIVCWIRGGGIIIFFLATIYASLGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+ YL HIGFCIFAAIAPPI+F GKSLTGILA ID  SD VLVGV
Sbjct  179   YRAMRTDSALKFGWFFLVYLFHIGFCIFAAIAPPILFQGKSLTGILAVIDAISDQVLVGV  238

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    FYLVGFGLFCLE L+SLWVLQ
Sbjct  239   -----------------------FYLVGFGLFCLETLISLWVLQ  259



>ref|XP_010461024.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Camelina sativa]
Length=265

 Score =   371 bits (953),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 223/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WE++L+++EMDIKRRE+A+A +GV + DKNWPPFFPI+HHDI NEIPV 
Sbjct  54    DSSQKQRKLADWESELRKKEMDIKRREEAIAKSGVQIDDKNWPPFFPIMHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVMSDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|XP_002890966.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67225.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=264

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 220/284 (77%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EE+ VNPFS GG       R+P   +  + FGQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEEEEIVNPFSKGGG------RVPA-ASRPVEFGQSLDATVDIPLDNMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+L+++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI  EIPV +
Sbjct  54    SSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIAKEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G 
Sbjct  174   YRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLSLWVLQ
Sbjct  233   ----------------------IFYFIGFGLFCLESLLSLWVLQ  254



>ref|XP_009145216.1| PREDICTED: secretory carrier-associated membrane protein 4 [Brassica 
rapa]
Length=265

 Score =   371 bits (952),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 222/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+E++E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEDEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDTIN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIV+CLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVMCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI F GKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFQGKSLTGVLAAIDVISDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|XP_009107999.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X1 [Brassica rapa]
Length=266

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 223/286 (78%), Gaps = 32/286 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDNMN  53

Query  1108  -DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
              D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + +KNWPPFFPIIHHDI NEIPV
Sbjct  54    VDSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDEKNWPPFFPIIHHDIANEIPV  113

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYR
Sbjct  114   HAQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYR  173

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD VL 
Sbjct  174   PLYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSVLA  233

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   G-----------------------IFYFIGFGLFCLESLLSLWVLQ  256



>emb|CDY35537.1| BnaA05g16490D [Brassica napus]
Length=265

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 221/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+E++E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEDEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDTIN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L ++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELSKKEMDIKRREDAIANSGVQIDDKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIV+CLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVMCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI F GKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFQGKSLTGVLAAIDVISDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>gb|KHG14384.1| Secretory carrier-associated membrane 4 -like protein [Gossypium 
arboreum]
 gb|KJB21178.1| hypothetical protein B456_003G186500 [Gossypium raimondii]
Length=265

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 233/294 (79%), Gaps = 30/294 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNGG+   ++     + +  LGFGQKHDATVDIPLDS+ND
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGGSVAPARP----LASEPLGFGQKHDATVDIPLDSMND  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KK++KELAAWEADLKRRE DIKRREDAV+ AGV V DKNWPP FPIIHHDI NEIPV +
Sbjct  55    SKKREKELAAWEADLKRREKDIKRREDAVSQAGVSVDDKNWPPIFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N++AV VCWI+G GVKIF LA+IY L+GCPLSYVLWYRPL
Sbjct  115   QRLQYLAFASWLGIVLCLVFNVIAVIVCWIQGGGVKIFFLAVIYMLLGCPLSYVLWYRPL  174

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL FGWFFMFYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDV SDH+L GV
Sbjct  175   YRAMRTDSALNFGWFFMFYLLHLGFCIFAAIAPPIVFHGKSLTGILAAIDVISDHMLAGV  234

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                     + VGFGLFCLE+LLSLWV+Q +  Y  GH 
Sbjct  235   F-----------------------FFVGFGLFCLESLLSLWVIQKIYLYFRGHK  265



>ref|XP_010499749.1| PREDICTED: secretory carrier-associated membrane protein 4 [Camelina 
sativa]
Length=265

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 222/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  + FGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVEFGQSMDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WE++L+++EMDIKRRE+A+A +GV + DKNWPPFFPI+HHDI NEIPV 
Sbjct  54    DSSQKQRKLADWESELRKKEMDIKRREEAIAKSGVQIDDKNWPPFFPIMHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVMSDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>emb|CDY29930.1| BnaC05g29060D [Brassica napus]
Length=265

 Score =   369 bits (946),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 221/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+E++E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++ 
Sbjct  1     MNRHHDPNPFDEEDEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDTMT  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVY  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI F GKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFQGKSLTGVLAAIDVISDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|XP_006304101.1| hypothetical protein CARUB_v10010029mg [Capsella rubella]
 gb|EOA36999.1| hypothetical protein CARUB_v10010029mg [Capsella rubella]
Length=265

 Score =   368 bits (945),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 222/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  + +GQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVEYGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WE++L+++EMDIKRRE+A+A +GV + DKNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWESELRKKEMDIKRREEAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVMSDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>gb|KFK44964.1| hypothetical protein AALP_AA1G326500 [Arabis alpina]
Length=264

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 219/284 (77%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EE+ VNPFS GG       R+P   +  + FGQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEEEEIVNPFSKGGG------RVPA-ASRPVEFGQSLDATVDIPLDNMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+LK++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV +
Sbjct  54    SSQKQRKLADWEAELKKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  V WIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVFWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G 
Sbjct  174   YRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GF LFCLE+LLSLWVLQ
Sbjct  233   ----------------------IFYFIGFALFCLESLLSLWVLQ  254



>ref|XP_010518929.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Tarenaya hassleriana]
 ref|XP_010518930.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Tarenaya hassleriana]
 ref|XP_010518931.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Tarenaya hassleriana]
Length=268

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 224/285 (79%), Gaps = 28/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQ-EVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR NDPNPF++EE+  VNPFS G     + +      +  +GFG+ HDAT+DIPLD++N
Sbjct  1     MNRHNDPNPFEEEEEEAVNPFSKGA----AAAGRVPAASRPVGFGKGHDATIDIPLDTMN  56

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+ELA WEADL+RREMDIKRRE+AVA +GV + DKNWPPFFPIIHHDI NEIPV 
Sbjct  57    DSSKKQRELADWEADLRRREMDIKRREEAVAKSGVQIDDKNWPPFFPIIHHDIANEIPVH  116

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYALMGCP+SYVLWYRP
Sbjct  117   AQKLQYLAFASWLGIVLCLVFNLIATIVCWIKGGGVKIFFLATIYALMGCPISYVLWYRP  176

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYL+HIGFCI AAIAPPI+FHG+SLTG+LAAIDV SD +L G
Sbjct  177   LYRAMRTDSALKFGWFFLFYLIHIGFCILAAIAPPIVFHGRSLTGVLAAIDVISDSLLAG  236

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE++LSLWVLQ
Sbjct  237   -----------------------IFYFIGFGLFCLESVLSLWVLQ  258



>ref|XP_010478622.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Camelina sativa]
Length=265

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 188/285 (66%), Positives = 221/285 (78%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  + FGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSKGGG------RVPA-ASRPVEFGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WE++L+++EMDIKRRE+A+A +GV + DKNWPPFFPI+HHDI NEIPV 
Sbjct  54    DSSQKQRKLADWESELRKKEMDIKRREEAIAKSGVQIDDKNWPPFFPIMHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI F GKSLTG+LAAIDV SD +L G
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFQGKSLTGVLAAIDVMSDSLLAG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|NP_174485.1| secretory carrier-associated membrane protein 5 [Arabidopsis 
thaliana]
 sp|Q9C6X2.1|SCAM4_ARATH RecName: Full=Secretory carrier-associated membrane protein 4; 
Short=Secretory carrier membrane protein 4 [Arabidopsis thaliana]
 gb|AAG50798.1|AC074309_15 secretory carrier membrane protein, putative [Arabidopsis thaliana]
 gb|AAM64938.1| secretory carrier membrane protein, putative [Arabidopsis thaliana]
 gb|ABF83683.1| At1g32050 [Arabidopsis thaliana]
 dbj|BAE98709.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31429.1| secretory carrier-associated membrane protein 4 [Arabidopsis 
thaliana]
Length=264

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 219/284 (77%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD++E+ VNPFS GG       R+P   +  + +GQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEDEEIVNPFSKGGG------RVPA-ASRPVEYGQSLDATVDIPLDNMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+L+++EMDIKRRE+A+A  GV + DKNWPPFFPIIHHDI  EIPV +
Sbjct  54    SSQKQRKLADWEAELRKKEMDIKRREEAIAKFGVQIDDKNWPPFFPIIHHDIAKEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G 
Sbjct  174   YRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLSLWVLQ
Sbjct  233   ----------------------IFYFIGFGLFCLESLLSLWVLQ  254



>ref|XP_010933401.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Elaeis guineensis]
Length=268

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 215/284 (76%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R+DPNPFD  E+EVNPFS     PGSK   P + +  LGFG KHDATVD+PL+++ND
Sbjct  1     MAHRDDPNPFD--EEEVNPFSKRA-GPGSKLHFPSLSSLPLGFGNKHDATVDMPLETMND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK KELA  E DL+RRE DIKRREDA++  GV + +KNWPPFFPIIHHDI  EIP  +
Sbjct  58    KKKKAKELATLEEDLRRRETDIKRREDALSRGGVSMEEKNWPPFFPIIHHDIAKEIPTHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLV+N++AV VCWI+  GV IF LAIIYAL+GCPLSYVLWYRPL
Sbjct  118   QRLQYLAFASWLGIVLCLVWNVIAVIVCWIRDGGVIIFFLAIIYALLGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+ YL HIGFCIFAAIAPPI F GKSLTGILA ID  SD VLVG 
Sbjct  178   YRAMRTDSALKFGWFFLVYLFHIGFCIFAAIAPPIAFQGKSLTGILAVIDALSDQVLVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYLVGFGLFCLE L+SLWVLQ
Sbjct  237   ----------------------IFYLVGFGLFCLETLVSLWVLQ  258



>dbj|BAH20345.1| AT1G32050 [Arabidopsis thaliana]
Length=264

 Score =   363 bits (933),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 186/284 (65%), Positives = 219/284 (77%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPF+++E+ VNPFS GG       R+P   +  + +GQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFNEDEEIVNPFSKGGG------RVPA-ASRPVEYGQSLDATVDIPLDNMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+L+++EMDIKRRE+A+A  GV + DKNWPPFFPIIHHDI  EIPV +
Sbjct  54    SSQKQRKLADWEAELRKKEMDIKRREEAIAKFGVQIDDKNWPPFFPIIHHDIAKEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD +L G 
Sbjct  174   YRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLSLWVLQ
Sbjct  233   ----------------------IFYFIGFGLFCLESLLSLWVLQ  254



>ref|XP_010943453.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Elaeis guineensis]
Length=267

 Score =   361 bits (926),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 220/288 (76%), Gaps = 26/288 (9%)
 Frame = -2

Query  1267  PNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQK  1088
             P+PFDDEE +VNPF+       SK R+P + +  LGFG KHDATV++PLD+ ND KK ++
Sbjct  5     PDPFDDEE-DVNPFATAAGT-DSKPRLPTLPSQPLGFGNKHDATVNVPLDARNDIKKTER  62

Query  1087  ELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYL  908
             ELAAWE +LK+RE DI+RRED +  AGV + +KNWPPFFPIIHHDIV EIP+ +Q++QYL
Sbjct  63    ELAAWEEELKKREKDIQRREDVMTRAGVMIEEKNWPPFFPIIHHDIVKEIPIHAQRLQYL  122

Query  907   AFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRT  728
             AFASWLGIVLCL++N++AV VCWIKG GVKIF LA IYA++GCPLSYVLWY+PLYNAMRT
Sbjct  123   AFASWLGIVLCLLWNVIAVFVCWIKGGGVKIFFLATIYAMLGCPLSYVLWYKPLYNAMRT  182

Query  727   NSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*H  548
             +SA+KFGWFF+ YL+H GFC  AAIAPPI+F GKSLTGILAAID FSDHVLVG       
Sbjct  183   DSAVKFGWFFLCYLIHTGFCTLAAIAPPIVFQGKSLTGILAAIDTFSDHVLVG-------  235

Query  547   LPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                             IFYL+G G FCLE L+SLWVLQ V  Y  GH 
Sbjct  236   ----------------IFYLIGSGFFCLETLISLWVLQKVYMYFRGHK  267



>gb|KCW78482.1| hypothetical protein EUGRSUZ_D02626 [Eucalyptus grandis]
Length=278

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 2/240 (1%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD EE+EVNPFS G  AP SKSR+P + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFD-EEEEVNPFSKG-TAPASKSRLPPLASEPLGFGQKHDATVDIPLDTMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K KELA+WEADLKRRE +IKRREDAV+ A VP+ DKNWPP FPIIHHDI NEIPV +
Sbjct  59    SKEKVKELASWEADLKRREREIKRREDAVSKANVPLDDKNWPPCFPIIHHDIANEIPVHA  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  119   QRLQYLAFASWLGIVLCLTFNVLAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL F WFF+FYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVGV
Sbjct  179   YRAMRTDSALNFSWFFLFYLLHVGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVGV  238



>ref|XP_009609952.1| PREDICTED: secretory carrier-associated membrane protein 4 isoform 
X3 [Nicotiana tomentosiformis]
Length=233

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/294 (67%), Positives = 211/294 (72%), Gaps = 62/294 (21%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFS G N                                   
Sbjct  1     MSRGNDPNPFDEEEPEVNPFS-GSN-----------------------------------  24

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  25    --KKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  82

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIV CLV+N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  83    QKLQYLAFASWLGIVFCLVFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  142

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  143   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  201

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GF  FCLEALLSLWVLQ V  +  GH 
Sbjct  202   ----------------------IFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK  233



>ref|XP_009385716.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=244

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 201/235 (86%), Gaps = 3/235 (1%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKK  1094
              DPNPFD  E +VNPF+    A GS SR+P + +   GFG K+DATVDIPLD++ND KK+
Sbjct  3     RDPNPFD--EMDVNPFATSA-ASGSNSRLPTLASKAFGFGNKNDATVDIPLDTVNDAKKR  59

Query  1093  QKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQ  914
             +KELA WE +LKRREMDIKRREDA+  AGV + +KNWPPFFPIIHHDI  EIPV +Q++Q
Sbjct  60    EKELATWEENLKRREMDIKRREDALTRAGVTIEEKNWPPFFPIIHHDIAKEIPVHAQRLQ  119

Query  913   YLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAM  734
             YLAFASWLGI+LCL +N++AV VCWIKG GVKIF LAIIYAL+GCPLSYVLWYRPLY AM
Sbjct  120   YLAFASWLGILLCLSWNVIAVIVCWIKGGGVKIFFLAIIYALLGCPLSYVLWYRPLYRAM  179

Query  733   RTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             RT+SALKFGWFF+FYL+H+GFCI AAIAPPI+FHGKSLTGILAAID FSDH LVG
Sbjct  180   RTDSALKFGWFFLFYLIHVGFCILAAIAPPIVFHGKSLTGILAAIDTFSDHALVG  234



>ref|XP_009797991.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X3 [Nicotiana sylvestris]
Length=233

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 210/294 (71%), Gaps = 62/294 (21%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M+R NDPNPFD+EE EVNPFS G N                                   
Sbjct  1     MSRGNDPNPFDEEEPEVNPFS-GSN-----------------------------------  24

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KKQKELA WEADL+RRE DIKRREDAVAGAGVP  D+NWPPFFPIIHHDI NEIP  S
Sbjct  25    --KKQKELANWEADLQRRERDIKRREDAVAGAGVPTDDRNWPPFFPIIHHDIANEIPAHS  82

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             +K+QYLAFASWLGIV CL +N++AVT+CWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  83    RKLQYLAFASWLGIVFCLAFNVLAVTICWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  142

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT+SALKFGWFFMFYL+HIGFCI AAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  143   YNAMRTDSALKFGWFFMFYLIHIGFCILAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  201

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                   IFYL+GF  FCLEALLSLWVLQ V  +  GH 
Sbjct  202   ----------------------IFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK  233



>ref|XP_009143658.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Brassica rapa]
Length=263

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 216/285 (76%), Gaps = 33/285 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE E VNPFS G  A G+   +     N        DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEDEIVNPFSKG--AGGAGRPVASRPFNV-------DATVDIPLDTVN  51

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+EL+ WE++LK+RE DIKRREDAVA +GV  SDKNWPPFFPIIHHDI NEIPV 
Sbjct  52    DSSKKQRELSDWESELKKRETDIKRREDAVAKSGVKTSDKNWPPFFPIIHHDIANEIPVH  111

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++AV VCWIKG GVKIF LA IYAL+GCP+SY+LWYRP
Sbjct  112   AQKLQYLAFASWLGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGCPISYLLWYRP  171

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF FYL+HIGFCIFAAIAPPIIF G+S TG+LAAIDV  D +L G
Sbjct  172   LYRAMRTDSALKFGWFFFFYLIHIGFCIFAAIAPPIIFRGQSFTGVLAAIDVIRDSLLAG  231

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VG GLFCLE+LLSLWVLQ
Sbjct  232   -----------------------IFYFVGCGLFCLESLLSLWVLQ  253



>ref|XP_006415260.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
 gb|ESQ33613.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum]
Length=253

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 202/240 (84%), Gaps = 7/240 (3%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD+EE+ VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++ND
Sbjct  1     MNRHHDPNPFDEEEEIVNPFSKGGG------RVPA-ASRPVGFGQSLDATVDIPLDTMND  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               +KQ++LA WEA+L+++EMDIKRREDA+A +GV + DKNWPPFFPIIHHDI NEIPV +
Sbjct  54    SSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDDKNWPPFFPIIHHDIANEIPVHA  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  114   QKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLTG+LAAIDV SD VL GV
Sbjct  174   YRAMRTDSALKFGWFFFSYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSVLAGV  233



>emb|CDY31700.1| BnaA05g08470D [Brassica napus]
Length=361

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 216/285 (76%), Gaps = 33/285 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE E VNPFS G  A G+   +     N        DATVDIPLD++N
Sbjct  99    MNRHHDPNPFDEEEDEIVNPFSKG--AGGAGRPVASRPFNV-------DATVDIPLDTVN  149

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+EL+ WE++LK+RE DIKRREDAVA +GV  SDKNWPPFFPIIHHDI NEIPV 
Sbjct  150   DSSKKQRELSDWESELKKRETDIKRREDAVAKSGVKTSDKNWPPFFPIIHHDIANEIPVH  209

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++AV VCWIKG GVKIF LA IYAL+GCP+SY+LWYRP
Sbjct  210   AQKLQYLAFASWLGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGCPISYLLWYRP  269

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF FYL+HIGFCIFAAIAPPIIF G+S TG+LAAIDV  D +L G
Sbjct  270   LYRAMRTDSALKFGWFFFFYLIHIGFCIFAAIAPPIIFRGQSFTGVLAAIDVIRDSLLAG  329

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VG GLFCLE+LLSLWVLQ
Sbjct  330   -----------------------IFYFVGCGLFCLESLLSLWVLQ  351



>emb|CDY51816.1| BnaC04g53720D [Brassica napus]
Length=263

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 215/285 (75%), Gaps = 33/285 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE E VNPFS G  A G+   +     N        DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEDEIVNPFSKG--AGGAGRPVASRPFNV-------DATVDIPLDTVN  51

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+EL+ WE++LK+RE DIKRREDAVA +GV  SDKNWPPFFPIIHHDI NEIPV 
Sbjct  52    DSSKKQRELSDWESELKKRETDIKRREDAVAKSGVKTSDKNWPPFFPIIHHDIANEIPVH  111

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++AV VCWIKG GVKIF LA IYAL+GCP+SY+LWYRP
Sbjct  112   AQKLQYLAFASWLGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGCPISYLLWYRP  171

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF FYL+HIGFCIFAAIAPPIIF G+S TG+LAAIDV    +L G
Sbjct  172   LYRAMRTDSALKFGWFFFFYLIHIGFCIFAAIAPPIIFRGQSFTGVLAAIDVIRGSLLAG  231

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VG GLFCLE+LLSLWVLQ
Sbjct  232   -----------------------IFYFVGCGLFCLESLLSLWVLQ  253



>ref|XP_010677419.1| PREDICTED: secretory carrier-associated membrane protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=256

 Score =   350 bits (899),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 186/284 (65%), Positives = 214/284 (75%), Gaps = 30/284 (11%)
 Frame = -2

Query  1255  DDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKELAA  1076
               + + +NPF+NG +A GSK R+P       GFGQKHDAT D+ LD+ NDP + +KELA 
Sbjct  2     SSQPENINPFANGSSAAGSKFRLP-----NFGFGQKHDATDDVSLDARNDPNR-EKELAD  55

Query  1075  WEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFAS  896
             WE DLKRRE+DIKRRE+AV+ AGVP  D+NWPPFFP+IHHDI NEIPV +QK+QY+AFAS
Sbjct  56    WEVDLKRRELDIKRREEAVSAAGVPADDRNWPPFFPLIHHDIANEIPVHAQKLQYMAFAS  115

Query  895   WLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSAL  716
             WLG+VLCLVYNI+AV VCWIKG G KIF LA IYAL+G PLSYVLWYRPLY AMRT+SA 
Sbjct  116   WLGLVLCLVYNIIAVIVCWIKGGGAKIFFLASIYALLGVPLSYVLWYRPLYRAMRTDSAF  175

Query  715   KFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSS  536
             KFGWFF+ YLLH+ FCIFAAIAPPI+FHG+SLTGILAAIDVF   VLVG           
Sbjct  176   KFGWFFLTYLLHMLFCIFAAIAPPIVFHGQSLTGILAAIDVFPHSVLVG-----------  224

Query  535   IYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                         IFYL+GF  FCLE+LLSLWVLQ V  Y  GH 
Sbjct  225   ------------IFYLIGFAFFCLESLLSLWVLQKVYMYFRGHK  256



>ref|XP_006410715.1| hypothetical protein EUTSA_v10017084mg [Eutrema salsugineum]
 dbj|BAJ33899.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52168.1| hypothetical protein EUTSA_v10017084mg [Eutrema salsugineum]
Length=268

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 224/285 (79%), Gaps = 28/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR++DPNPFD+EE+E VNPFS G    G   R+P + +  +GFG   DATVDIPLD++N
Sbjct  1     MNRQHDPNPFDEEEEEIVNPFSKGA---GGAGRVP-VASRPVGFGNNLDATVDIPLDTVN  56

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             +  KKQ+EL+ WEA+L+ RE DIKRREDA+A +GV +++KNWPPFFPIIHHDI NEIPV 
Sbjct  57    ESSKKQRELSDWEAELRNRERDIKRREDAIAKSGVQINNKNWPPFFPIIHHDIANEIPVH  116

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++AV VCWIKG GVKIF LA IYAL+GCP+SYVLWYRP
Sbjct  117   AQKLQYLAFASWLGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGCPISYVLWYRP  176

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SA KFGWFF FYL+HIGFCIFAAIAPPIIF G+SLTG+LAAIDV S  +L G
Sbjct  177   LYRAMRTDSAFKFGWFFFFYLIHIGFCIFAAIAPPIIFRGQSLTGVLAAIDVISASLLAG  236

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VGFGLFCLE+LLSLWVLQ
Sbjct  237   -----------------------IFYFVGFGLFCLESLLSLWVLQ  258



>gb|KFK36422.1| hypothetical protein AALP_AA4G122300 [Arabis alpina]
Length=268

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 220/285 (77%), Gaps = 28/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+E++E VNPFS G    G   R+P   + T GFG   DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEDEEIVNPFSKGAGGAG---RVPAS-SKTAGFGNNFDATVDIPLDNVN  56

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+EL+ WEA LK+REMDIKRRE+A+A +GV +S+KNWPPFFPIIHHDI NEIPV 
Sbjct  57    DSSKKQRELSDWEAQLKKREMDIKRREEAIAKSGVKISNKNWPPFFPIIHHDIANEIPVH  116

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAF SWLGIVLCLV+N++AVTVCWIKG GVKIF LA IYAL+GCP+SYVLWYRP
Sbjct  117   AQKLQYLAFLSWLGIVLCLVFNVIAVTVCWIKGGGVKIFFLATIYALLGCPISYVLWYRP  176

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AM T+SA KFGWFF FYL+HIGFCIFAAIAPPIIF G+S TG+LAAIDV S  +LVG
Sbjct  177   LYRAMSTDSAFKFGWFFFFYLIHIGFCIFAAIAPPIIFQGQSFTGVLAAIDVISSSLLVG  236

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VGF LFCLE+LLS WVLQ
Sbjct  237   -----------------------IFYFVGFALFCLESLLSFWVLQ  258



>ref|XP_010276769.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=214

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 192/227 (85%), Gaps = 23/227 (10%)
 Frame = -2

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             +NDPKK++KELAAWEADLKRRE DIKRREDAVA  G+P  DKNWPPFFPIIHHDI NEIP
Sbjct  1     MNDPKKREKELAAWEADLKRREQDIKRREDAVARVGIPTDDKNWPPFFPIIHHDIANEIP  60

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             + +Q++QYLAFASWLGIVLCLV+NI+AV VCWIKG GVKIF LA IYAL+GCPLSYVLWY
Sbjct  61    IHAQRLQYLAFASWLGIVLCLVFNILAVVVCWIKGGGVKIFFLATIYALLGCPLSYVLWY  120

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRT+SALKFGWFF+FYLLHIGFCIF+AIAPPI+FHGKSLTGILAAIDVFSDHVL
Sbjct  121   RPLYRAMRTDSALKFGWFFLFYLLHIGFCIFSAIAPPIVFHGKSLTGILAAIDVFSDHVL  180

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             VG                       IFYL+GFGLFCLE+LLSLWVLQ
Sbjct  181   VG-----------------------IFYLIGFGLFCLESLLSLWVLQ  204



>ref|XP_010538352.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Tarenaya hassleriana]
Length=265

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 220/285 (77%), Gaps = 31/285 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQ-EVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +D NPF++EE+  VNPFS GG A G   R+P   +  +GFG+ +D   DIPLD++N
Sbjct  1     MNRHHDSNPFEEEEEEAVNPFSKGGGAAG---RVPA-ASRPVGFGKTND---DIPLDTMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  KKQ+E+A WEADL+RREMDIK+RE+A+  +GV   DKNWP FFPIIHHDI NEIP+ 
Sbjct  54    DSSKKQREVADWEADLRRREMDIKQREEAITKSGVQTDDKNWPQFFPIIHHDIANEIPIH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCL++NI+AV VCWI+G GVKIF LA IYA++GCPLSYVLWYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLMFNIIAVIVCWIEGGGVKIFFLATIYAMLGCPLSYVLWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+ YL+HIGFCIFAAIAPPI+F+GKSL G+LAAI+V S  +L G
Sbjct  174   LYRAMRTDSALKFGWFFLVYLIHIGFCIFAAIAPPIVFNGKSLAGVLAAINVISGSLLTG  233

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+LLSLWVLQ
Sbjct  234   -----------------------IFYFIGFGLFCLESLLSLWVLQ  255



>ref|XP_010920031.1| PREDICTED: secretory carrier-associated membrane protein 4 [Elaeis 
guineensis]
Length=220

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M RR+DPNPFD  E+EVNPFS G   PGSK  +P + +  LGFG KHDATVDIPL++ ND
Sbjct  1     MPRRDDPNPFD--EEEVNPFSKGA-GPGSKLHLPSLSSLHLGFGNKHDATVDIPLETTND  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK KELA WEADLKRREMDI+RREDA++ AGV   +KNWPPFFPIIHHDI  EIP+ +
Sbjct  58    SKKKAKELAGWEADLKRREMDIQRREDALSNAGVSTEEKNWPPFFPIIHHDISKEIPIHA  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCLV+N++AVTVCWIKG GVKIF LA IYAL+GCPLSYVLWYRPL
Sbjct  118   QKLQYLAFASWLGIVLCLVWNVIAVTVCWIKGGGVKIFFLATIYALLGCPLSYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLT  617
             Y AMRT+SA+KFGWFF+ YL HIGFCIFAAIAPPI+FHGKSLT
Sbjct  178   YRAMRTDSAVKFGWFFLLYLFHIGFCIFAAIAPPIVFHGKSLT  220



>gb|KCW78483.1| hypothetical protein EUGRSUZ_D02626 [Eucalyptus grandis]
Length=248

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 197/293 (67%), Positives = 221/293 (75%), Gaps = 47/293 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD EE+EVNPFS G  AP SKSR+P + +  LGFGQKHDATVDIPLD++ND
Sbjct  1     MNRHHDPNPFD-EEEEVNPFSKG-TAPASKSRLPPLASEPLGFGQKHDATVDIPLDTMND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K KELA+WEADLKRRE +IKRREDAV+ A                     NEIPV +
Sbjct  59    SKEKVKELASWEADLKRREREIKRREDAVSKA---------------------NEIPVHA  97

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCL +N++AVTVCWI+G GVKIF LAIIYALMGCPLSYVLWYRPL
Sbjct  98    QRLQYLAFASWLGIVLCLTFNVLAVTVCWIRGGGVKIFFLAIIYALMGCPLSYVLWYRPL  157

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL F WFF+FYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDVFSDHVLVG 
Sbjct  158   YRAMRTDSALNFSWFFLFYLLHVGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVG-  216

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                   IFYLVGF LFCLE+LLS+WVLQ    Y  GH
Sbjct  217   ----------------------IFYLVGFALFCLESLLSMWVLQKTYMYFRGH  247



>ref|NP_001131434.1| uncharacterized protein LOC100192766 [Zea mays]
 gb|ACF79839.1| unknown [Zea mays]
 gb|ACF88265.1| unknown [Zea mays]
 gb|ACG34015.1| SC3 protein [Zea mays]
Length=270

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 206/282 (73%), Gaps = 26/282 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFG--QKHDATVDIPLDSLNDPK  1100
             +DPNPFD+   E NPFSNGG A G K +        +GFG   + DA VD+PL+++ D +
Sbjct  3     HDPNPFDEGSAEDNPFSNGG-AGGGKQQYGFRPTEPVGFGGASRGDAVVDVPLETMGDSR  61

Query  1099  KKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQK  920
              K KEL++WE+DLKRRE DIKRRE+A+  AGVP+ +KNWPPFFPIIHHDI NEIP   QK
Sbjct  62    SKVKELSSWESDLKRREADIKRREEALKNAGVPMEEKNWPPFFPIIHHDIANEIPANVQK  121

Query  919   MQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYN  740
             +QYLAFASWLGIVLCL +N VAV VCWIK    K+F LA IYAL+G PLSY++WYRPLY 
Sbjct  122   LQYLAFASWLGIVLCLSWNFVAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRPLYR  181

Query  739   AMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSC  560
             AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV++G   
Sbjct  182   AMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVIIG---  238

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                 IFY VGF LFCLE LLS+ VLQ
Sbjct  239   --------------------IFYFVGFALFCLETLLSIGVLQ  260



>dbj|BAH20435.1| AT1G32050 [Arabidopsis thaliana]
Length=230

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 193/242 (80%), Gaps = 23/242 (10%)
 Frame = -2

Query  1159  FGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWP  980
             +GQ  DATVDIPLD++ND  +KQ++LA WEA+L+++E+DIKRRE+A+A  GV + DKNWP
Sbjct  2     YGQSLDATVDIPLDNMNDSSQKQRKLADWEAELRKKEVDIKRREEAIAKFGVQIDDKNWP  61

Query  979   PFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAI  800
             PFFPIIHHDI  EIPV +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA 
Sbjct  62    PFFPIIHHDIAKEIPVHAQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLAT  121

Query  799   IYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSL  620
             IYAL+GCPLSYVLWYRPLY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSL
Sbjct  122   IYALIGCPLSYVLWYRPLYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSL  181

Query  619   TGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWV  440
             TG+LAAIDV SD +L G                       IFY +GFGLFCLE+LLSLWV
Sbjct  182   TGVLAAIDVISDSLLAG-----------------------IFYFIGFGLFCLESLLSLWV  218

Query  439   LQ  434
             LQ
Sbjct  219   LQ  220



>emb|CDY70756.1| BnaCnng69680D [Brassica napus]
Length=217

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 189/224 (84%), Gaps = 8/224 (4%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE-VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             MNR +DPNPFD+EE+E VNPFS GG       R+P   +  +GFGQ  DATVDIPLD++N
Sbjct  1     MNRHHDPNPFDEEEEEIVNPFSRGGG------RVPA-ASRPVGFGQSLDATVDIPLDNMN  53

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D  +KQ++LA WEA+L+++EMDIKRREDA+A +GV + +KNWPPFFPIIHHDI NEIPV 
Sbjct  54    DSSQKQRKLADWEAELRKKEMDIKRREDAIAKSGVQIDEKNWPPFFPIIHHDIANEIPVH  113

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCLV+N++A  VCWIKG GVKIF LA IYALMGCPLSYV+WYRP
Sbjct  114   AQKLQYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALMGCPLSYVVWYRP  173

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLT  617
             LY AMRT+SALKFGWFF  YL+HIGFCI AAIAPPI FHGKSLT
Sbjct  174   LYRAMRTDSALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT  217



>ref|XP_006652741.1| PREDICTED: secretory carrier-associated membrane protein 6-like 
[Oryza brachyantha]
Length=270

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 174/281 (62%), Positives = 205/281 (73%), Gaps = 24/281 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQ-KHDATVDIPLDSLNDPKK  1097
             +DPNPFD+   + NPFSNGG   G + +         GFG  + DATVD+PLD++ D K 
Sbjct  3     HDPNPFDEGNADDNPFSNGGGGRGGRQQYGFRPTEPAGFGAGRGDATVDVPLDTMGDSKS  62

Query  1096  KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKM  917
             K +EL++WE+DLKRRE DIKRRE+A+  AGVP+ +KNWPPFFPIIHHDI NEIP   QK+
Sbjct  63    KARELSSWESDLKRREADIKRREEALKNAGVPMEEKNWPPFFPIIHHDIANEIPANLQKL  122

Query  916   QYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNA  737
             QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPLY A
Sbjct  123   QYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRPLYRA  182

Query  736   MRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             MRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV++G    
Sbjct  183   MRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVIIG----  238

Query  556   N*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                IFY VGF LFCLE LLS+ VLQ
Sbjct  239   -------------------IFYFVGFALFCLETLLSIGVLQ  260



>ref|NP_001053734.1| Os04g0595800 [Oryza sativa Japonica Group]
 sp|Q0JAI9.1|SCAM6_ORYSJ RecName: Full=Secretory carrier-associated membrane protein 6; 
Short=Secretory carrier membrane protein 6 [Oryza sativa Japonica 
Group]
 dbj|BAF15648.1| Os04g0595800 [Oryza sativa Japonica Group]
 dbj|BAG86761.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77905.1| hypothetical protein OsI_17228 [Oryza sativa Indica Group]
 gb|EEE61598.1| hypothetical protein OsJ_16007 [Oryza sativa Japonica Group]
Length=273

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 176/284 (62%), Positives = 205/284 (72%), Gaps = 27/284 (10%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPG---SKSRIPQMVANTLGFGQ-KHDATVDIPLDSLND  1106
             +DPNPFD+   + NPFSNGG   G   S+ +         GFG  + DATVD+PLD++ D
Sbjct  3     HDPNPFDEGNADDNPFSNGGGGGGGGGSRQQYGFRPTEPAGFGAGRGDATVDVPLDTMGD  62

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K K +EL++WE DLKRRE DIKRRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP   
Sbjct  63    SKSKARELSSWETDLKRREADIKRREEALRNAGVPMEDKNWPPFFPIIHHDIANEIPANL  122

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPL
Sbjct  123   QKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRPL  182

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV++G 
Sbjct  183   YRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVIIG-  241

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY VGF LFCLE LLS+ VLQ
Sbjct  242   ----------------------IFYFVGFALFCLETLLSIGVLQ  263



>ref|XP_003570157.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Brachypodium distachyon]
Length=274

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 206/295 (70%), Gaps = 31/295 (11%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGS----KSRIPQMVANTLGFGQ--KHDATVDIPLDSL  1112
              DPNPFD+   E NPFSNGG    +    KS+     A   GFG     DA VDIPLD++
Sbjct  3     RDPNPFDEGADE-NPFSNGGGRGAAAAGGKSKFQFRPAEPAGFGGGGNSDAAVDIPLDNM  61

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
             ND   K  EL+ W+ADLKRRE DIKRRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP 
Sbjct  62    NDSNGKAGELSQWQADLKRREADIKRREEALKSAGVPMEDKNWPPFFPIIHHDIANEIPA  121

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +Q++QYLAFASWLGIVLCL +N +AVTVCWI+G   K+F LA IY ++G PLSY++WYR
Sbjct  122   NAQRLQYLAFASWLGIVLCLFWNFIAVTVCWIRGGDSKLFFLATIYGMLGIPLSYLMWYR  181

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SA  FGWFF+ Y+LHIGFCI AAIAPPI+F GKSLTGILAAID FSDH LV
Sbjct  182   PLYRAMRTDSAFSFGWFFLCYMLHIGFCIIAAIAPPIVFRGKSLTGILAAIDTFSDHALV  241

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
             G                       IFY VGF LF LE ++S+WVLQ V  Y  GH
Sbjct  242   G-----------------------IFYFVGFALFSLETVVSIWVLQRVYMYFRGH  273



>ref|XP_004976669.1| PREDICTED: secretory carrier-associated membrane protein 6-like 
[Setaria italica]
Length=270

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/282 (60%), Positives = 206/282 (73%), Gaps = 26/282 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQ--KHDATVDIPLDSLNDPK  1100
             +DPNPFD+   + NP+SNGG   G K +        +GFG   + DA VD+PLD++ D K
Sbjct  3     HDPNPFDEGAADDNPYSNGGGG-GGKQQYGFRPTEPIGFGGAGRGDAVVDVPLDTMGDSK  61

Query  1099  KKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQK  920
              K +EL++WE+DLKRRE DIKRRE+++  AGVP+ +KNWPPFFP+IHHDI NEIP   Q+
Sbjct  62    GKARELSSWESDLKRREADIKRREESLKNAGVPMEEKNWPPFFPLIHHDIANEIPANVQR  121

Query  919   MQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYN  740
             +QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPLY 
Sbjct  122   LQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRPLYR  181

Query  739   AMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSC  560
             AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+H+++G   
Sbjct  182   AMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHIVIG---  238

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                 IFY VGFGLFCLE LLS+ VLQ
Sbjct  239   --------------------IFYFVGFGLFCLETLLSIAVLQ  260



>ref|XP_006582947.1| PREDICTED: uncharacterized protein LOC100815455 isoform X2 [Glycine 
max]
Length=261

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 206/286 (72%), Gaps = 26/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD  E+EVNPFSN G+ P  + SR+P +    + +     ATVDIPLDS  
Sbjct  1     MAGRYDSNPFD--EEEVNPFSNPGSVPAATNSRLPPLKPEPVDYNYGFGATVDIPLDSSM  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+KEL A E +L++RE +++R+E+A + AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DLKKKEKELQAKETELRKREQEVRRKEEAASRAGIVLEEKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI+ LAIIY + G P +YVLWYRP
Sbjct  119   LQKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A R  SALKFGWFF+FYLLHIGFCI AA+APPI+F GKSLTGILAAIDV  DH L+G
Sbjct  179   LYRAFRNESALKFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLTGILAAIDVLGDHALIG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQV  431
                                    IFY VGFGLFC+E L+S+WV+QV
Sbjct  239   -----------------------IFYFVGFGLFCIETLISIWVIQV  261



>ref|XP_002448450.1| hypothetical protein SORBIDRAFT_06g027280 [Sorghum bicolor]
 gb|EES12778.1| hypothetical protein SORBIDRAFT_06g027280 [Sorghum bicolor]
Length=271

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 173/282 (61%), Positives = 203/282 (72%), Gaps = 25/282 (9%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSR--IPQMVANTLGFGQKHDATVDIPLDSLNDPK  1100
             +DPNPFD+   E NPFSNGG   G +     P       G G+  DA VD+PL+++ D K
Sbjct  3     HDPNPFDEGGAEDNPFSNGGGGGGKQQYGFRPTEPVGFGGAGRGGDAVVDVPLETMGDSK  62

Query  1099  KKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQK  920
              K +EL++WE+DLKRRE DIKRRE+A+  AGVP+ +KNWPPFFPIIHHDI NEIP   QK
Sbjct  63    SKSRELSSWESDLKRREADIKRREEALKNAGVPMEEKNWPPFFPIIHHDIANEIPANVQK  122

Query  919   MQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYN  740
             +QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPLY 
Sbjct  123   LQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRPLYR  182

Query  739   AMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSC  560
             AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV++G   
Sbjct  183   AMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVIIG---  239

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                 IFY VGF LFCLE LLS+ VLQ
Sbjct  240   --------------------IFYFVGFALFCLETLLSIGVLQ  261



>ref|NP_001242258.1| uncharacterized protein LOC100815455 [Glycine max]
 gb|ACU20876.1| unknown [Glycine max]
Length=298

 Score =   318 bits (815),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 205/285 (72%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R   NPFD+EE  VNPFSN G+ P  + SR+P +    + +    DATVDIPLDS  
Sbjct  1     MAGRYGSNPFDEEE--VNPFSNPGSVPAATNSRLPPLKPEPVDYNYGFDATVDIPLDSSM  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+KEL A E +L++RE +++R+E+A + AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DLKKKEKELQAKETELRKREQEVRRKEEAASRAGIVLEEKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI+ LAIIY + G P +YVLWYRP
Sbjct  119   LQKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A R  SALKFGWFF+FYLLHIGFCI AA+APPI+F GKSLTGILAAIDV  DH L+G
Sbjct  179   LYRAFRNESALKFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLTGILAAIDVLGDHALIG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY VGFGLFC+E L+S+WV+Q
Sbjct  239   -----------------------IFYFVGFGLFCIETLISIWVIQ  260



>ref|XP_002278442.1| PREDICTED: secretory carrier-associated membrane protein 1 isoform 
X1 [Vitis vinifera]
 emb|CBI28914.3| unnamed protein product [Vitis vinifera]
Length=285

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 207/285 (73%), Gaps = 29/285 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R + NPFD+E+  VNPF+N G+ P  + SR+  +     G+     ATVDIPLD   
Sbjct  1     MAGRYESNPFDEED--VNPFANPGSVPPAANSRLSPLPPEPAGY---RGATVDIPLDGAK  55

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D K K++EL A EA+LK+RE ++KRREDAVA AG+ + +KNWPPFFP+IHHDI NEIP+ 
Sbjct  56    DTKAKERELQAKEAELKKREQELKRREDAVARAGIVIEEKNWPPFFPLIHHDIANEIPIH  115

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QY+AF ++LG+VLCL +NIVAVT  WIKG+G  I+ LAIIY L G P +YVLWYRP
Sbjct  116   QQKLQYVAFTTYLGLVLCLTWNIVAVTTAWIKGEGPTIWFLAIIYFLSGVPGAYVLWYRP  175

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYLLHI FCIFA++APPI+F GKSLTGIL A+D+ S H LVG
Sbjct  176   LYRAMRTDSALKFGWFFLFYLLHIAFCIFASVAPPIVFKGKSLTGILPAVDLLSKHALVG  235

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYL+GFGLFCLE+LLS+WV+Q
Sbjct  236   -----------------------IFYLIGFGLFCLESLLSIWVVQ  257



>gb|KDO75797.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
Length=287

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 212/309 (69%), Gaps = 48/309 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA----------PGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS+             GG            P + SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPAVRGKSSGQSRFGGGGFFTTNSASVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                 GF  + DA +DIPLD+  D KKK+KEL A EA+L+RRE D++R+E+A A AG+ + 
Sbjct  59    HEPAGFNFERDAPIDIPLDTAADLKKKEKELQAKEAELRRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AFA++LG+ LCL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFATYLGLFLCLLWNIVAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A RT SA+KFGWFF+FYLLHIGFCIFA++APPIIF
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFRTESAMKFGWFFLFYLLHIGFCIFASVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTG+L A+DV  DH LVG                       IFY +GFGLFCLE+L
Sbjct  239   KGKSLTGVLPAVDVMGDHALVG-----------------------IFYFIGFGLFCLESL  275

Query  454   LSLWVLQVC  428
             +S+WV+QVC
Sbjct  276   VSIWVIQVC  284



>gb|EMS63153.1| Secretory carrier-associated membrane protein 6 [Triticum urartu]
Length=272

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 205/293 (70%), Gaps = 27/293 (9%)
 Frame = -2

Query  1273  NDPNPFDD-EEQEVNPFSNGGNAPGSKSR--IPQMVANTLGFGQKHDATVDIPLDSLNDP  1103
             +DPNPFD+    + NPFSNGG   G +     P       G G + DATVD+PL ++ D 
Sbjct  3     HDPNPFDEGTAGDENPFSNGGGRGGKQQHGFRPTEPVGFGGGGSRGDATVDVPLGNMGDS  62

Query  1102  KKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQ  923
               K +EL++WE+DL+RRE DIKRRE+++  AGVP+ +KNWPPFFPIIHHDI NEIP   Q
Sbjct  63    NGKARELSSWESDLRRREADIKRREESLKNAGVPMEEKNWPPFFPIIHHDIANEIPANVQ  122

Query  922   KMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLY  743
             K+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPLY
Sbjct  123   KLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLMWYRPLY  182

Query  742   NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVS  563
              AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+F GKSLTGILAAID FS+HV++G  
Sbjct  183   RAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFQGKSLTGILAAIDTFSEHVIIG--  240

Query  562   CCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
                                  IFY VGF LFCLE LLS+ VLQ V  Y  GH 
Sbjct  241   ---------------------IFYFVGFALFCLETLLSIGVLQKVYMYFRGHK  272



>dbj|BAK03193.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92624.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 208/296 (70%), Gaps = 31/296 (10%)
 Frame = -2

Query  1273  NDPNPFDD-EEQEVNPFSNGGNAPGSKS---RIPQMVANTLGFG---QKHDATVDIPLDS  1115
             +DPNPFD+    + NPFSNGG   G +    R  + V    G G    + DATVD+PLD+
Sbjct  3     HDPNPFDEGTAGDENPFSNGGGRGGKQQYGFRPTEPVGFGGGGGGGGSRGDATVDVPLDN  62

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             + D   K +EL++WE+DL+RRE DIKRRE+++  AGVP+ +KNWPPFFPIIHHDI NEIP
Sbjct  63    MGDSNGKARELSSWESDLRRREADIKRREESLKNAGVPMEEKNWPPFFPIIHHDIANEIP  122

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
                QK+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WY
Sbjct  123   ANVQKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLMWY  182

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+F GKSLTGILAAID FS+H++
Sbjct  183   RPLYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFQGKSLTGILAAIDTFSEHLI  242

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
             +G                       IFY VGF LFCLE LLS+ VLQ V  Y  GH
Sbjct  243   IG-----------------------IFYFVGFALFCLETLLSIGVLQKVYMYFRGH  275



>ref|XP_004293544.1| PREDICTED: secretory carrier-associated membrane protein 3 [Fragaria 
vesca subsp. vesca]
Length=289

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 204/285 (72%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF +EE EVNPFSN G+ AP   SR+  +     GF      TVDIP+D   
Sbjct  1     MAGRYDSNPFAEEE-EVNPFSNHGSVAPAKNSRLSPLPPERAGFNYGIGETVDIPIDGSG  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A EA+L++RE  +KR+EDA A AG+ + +KNWPPFFP+IHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKEAELRKREEVVKRKEDAAARAGIVLEEKNWPPFFPLIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLGI+ CL +NI+AVT  WIKG+GVKI+ LA+IY + G P SYVLWYRP
Sbjct  120   LQRVQYVAFITWLGIIACLFWNIIAVTTAWIKGEGVKIWFLAVIYFIAGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFFMFYL HIGFCIFAA+APPIIF GKSLTGILAAIDV SDH LVG
Sbjct  180   LYRVFRSESALKYGWFFMFYLFHIGFCIFAAVAPPIIFKGKSLTGILAAIDVLSDHALVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLE++LS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLESVLSIWVIQ  261



>ref|XP_002862723.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38981.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=263

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 207/295 (70%), Gaps = 53/295 (18%)
 Frame = -2

Query  1285  MNRRNDPNPFD-----------DEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDA  1139
             M+R +DPNPF+           +EE+EVNP   G              A  +GFG    +
Sbjct  1     MSRHHDPNPFNEEEEEEIVNPFNEEEEVNPLLKG--------------AGGVGFGSNLYS  46

Query  1138  TVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIH  959
             TV IPLD +ND   KQ EL+ WEA L+ REMD+KRREDA+A +GV ++DKNWP FFPIIH
Sbjct  47    TVHIPLDRVND--SKQIELSDWEAQLRNREMDVKRREDAIAKSGVQINDKNWPSFFPIIH  104

Query  958   HDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGC  779
             H   NEIP+ +QK+QYLAFASWLG+V CL++N++AV VCWI+G GVKIF LA IYA +GC
Sbjct  105   H---NEIPLHAQKLQYLAFASWLGLVFCLIFNVIAVIVCWIEGGGVKIFFLATIYASLGC  161

Query  778   PLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAI  599
             P+SYVLWY+PLY AMRT+SALKFGWFF FYL+HIGFCIFAAIAPPIIFHG+SLTG+LAAI
Sbjct  162   PVSYVLWYKPLYLAMRTDSALKFGWFFFFYLIHIGFCIFAAIAPPIIFHGQSLTGVLAAI  221

Query  598   DVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             DV S  +L G                       IFY VGFGLFC+E LLSLWVLQ
Sbjct  222   DVISASLLAG-----------------------IFYFVGFGLFCMELLLSLWVLQ  253



>ref|XP_007159268.1| hypothetical protein PHAVU_002G223700g [Phaseolus vulgaris]
 gb|ESW31262.1| hypothetical protein PHAVU_002G223700g [Phaseolus vulgaris]
Length=288

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 206/289 (71%), Gaps = 34/289 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRI----PQMVANTLGFGQKHDATVDIPL  1121
             M  R D NPFD  E+EVNPFSN G+ P  + SR+    P+ V    GFG    ATVDIPL
Sbjct  1     MAGRYDSNPFD--EEEVNPFSNPGSVPAATNSRLSPLKPEPVDYNYGFG----ATVDIPL  54

Query  1120  DSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
             DS  D KKK KEL + EA+L+RRE D++R+E+A A AG+ + +KNWPPFFPIIHHDI NE
Sbjct  55    DSSTDLKKKDKELQSKEAELRRREQDVRRKEEAAARAGIVLEEKNWPPFFPIIHHDIANE  114

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IP+   K+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI+ LAIIY + G P +YVL
Sbjct  115   IPIHLHKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVL  174

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT SALKFGWFFM YLLHIGFCI AA+APPI+F GKSLTGIL+AIDV  +H
Sbjct  175   WYRPLYRAFRTESALKFGWFFMLYLLHIGFCILAAVAPPIVFKGKSLTGILSAIDVLDNH  234

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              L+G                       IFY +GFGLFC+E L+S+WV+Q
Sbjct  235   ALIG-----------------------IFYFIGFGLFCIETLISIWVIQ  260



>ref|XP_009378157.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X2 [Pyrus x bretschneideri]
Length=289

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 203/285 (71%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF  EE EVNPFSN G+ AP   SR+  +     GF      TVDIP+D   
Sbjct  1     MAGRYDSNPFA-EEDEVNPFSNPGSVAPAKNSRLSPLPPERAGFNYGLGETVDIPIDGNA  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A EADL++RE  +KR+E A A AG+ + DKNWPPFFPIIHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKEADLRKREEIVKRKEAAAARAGIVLEDKNWPPFFPIIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLGIVLCL +NI+AVT  WIKGDGVKI+ LAIIY + G P SYVLWYRP
Sbjct  120   LQRLQYVAFTTWLGIVLCLFWNIIAVTTAWIKGDGVKIWFLAIIYFIAGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFFMFY+LHIGFCIFAA+APPI F GKSLTGILAAIDV S+H LVG
Sbjct  180   LYRTFRSESALKYGWFFMFYMLHIGFCIFAAVAPPIFFKGKSLTGILAAIDVLSEHALVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLEA+LS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLEAVLSVWVIQ  261



>ref|XP_003593475.1| Secretory carrier-associated membrane protein [Medicago truncatula]
 gb|AES63726.1| secretory carrier-associated membrane protein [Medicago truncatula]
Length=289

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 214/301 (71%), Gaps = 35/301 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRI----PQMVANTLGFGQKHDATVDIPL  1121
             M  R D NPFD+E+  VNPFSN GG AP + SR     P+      GFGQ    TVDIPL
Sbjct  1     MAGRYDSNPFDEEQ--VNPFSNSGGVAPATNSRPAPLNPERAGYNYGFGQ----TVDIPL  54

Query  1120  DSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
             D+  D KKK++EL A EA+L++RE +++R+E+A++ AG+ + +KNWPPFFPIIHHDI NE
Sbjct  55    DASTDVKKKERELQAKEAELRKREQEVRRKEEAISRAGIVIEEKNWPPFFPIIHHDIANE  114

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AF S LG+VLCL +N+VAVT  WIKG+GVKI+ LAIIY + G P +YVL
Sbjct  115   IPVHLQRLQYVAFFSLLGLVLCLTWNVVAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVL  174

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WY+PLY A RT+SA+KFGWFF+FYLLH+GFCI AA+APPI+F GKSLTGIL+AIDV  D+
Sbjct  175   WYKPLYRAFRTDSAIKFGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAIDVIGDY  234

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHSH  404
              ++G                       IFY +GFGLFCLE L+S+WV+ QV  Y  G   
Sbjct  235   TIIG-----------------------IFYFIGFGLFCLETLISVWVIQQVYMYFRGGGK  271

Query  403   T  401
             T
Sbjct  272   T  272



>ref|XP_003527448.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
isoform 1 [Glycine max]
Length=306

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 206/303 (68%), Gaps = 49/303 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG----------------------GNAPGSKSRIPQMVANTL  1163
             R DPNPFD+E  EVNPF++G                      G+ P S SR+  +     
Sbjct  3     RYDPNPFDEEPVEVNPFADGAAKGKGSGQSSYSGGAFYTTNTGSVPSSNSRLSPLPPEPY  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
               G    AT+DIPL++  D K K+KEL A EA+LKRRE ++KRREDA+A AG+ + +KNW
Sbjct  63    DRG----ATIDIPLNNAKDAKAKEKELQAKEAELKRREQELKRREDAIARAGIVIEEKNW  118

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI  EIPV  Q++QY+AF +WLG+VLCL++NIVAVT  WIKG+G  I+ LA
Sbjct  119   PPFFPIIHHDIAKEIPVHLQRIQYIAFTTWLGLVLCLLWNIVAVTTAWIKGEGPTIWFLA  178

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P SYVLWYRPLY AMRT+SALKFGWFF+ Y+LHI FCI AA+APPIIF GKS
Sbjct  179   IIYFISGAPGSYVLWYRPLYRAMRTDSALKFGWFFLLYMLHIAFCILAAVAPPIIFKGKS  238

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             LTGILAAIDV  D+ LVG                       IFY +GFGLFCLE++LS+W
Sbjct  239   LTGILAAIDVLGDNALVG-----------------------IFYFIGFGLFCLESVLSIW  275

Query  442   VLQ  434
             V+Q
Sbjct  276   VIQ  278



>ref|XP_008371308.1| PREDICTED: secretory carrier-associated membrane protein 3 [Malus 
domestica]
 ref|XP_008355993.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Malus domestica]
Length=289

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 204/285 (72%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF  EE EVNPFSN G+ AP   SR+  +     GF      TVDIP+D   
Sbjct  1     MAGRYDSNPFA-EEDEVNPFSNPGSVAPAKNSRLSPLPPERAGFNYGLGDTVDIPIDGNA  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A EA+L++RE  +KR+E A A AG+ + DKNWPPFFPIIHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKEAELRKREEIVKRKEAAAARAGIVLEDKNWPPFFPIIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLGI+LCL +NI+AVT  WIKGDGVKI+ LAIIY + G P SYVLWYRP
Sbjct  120   LQRLQYVAFTTWLGIILCLFWNIIAVTTAWIKGDGVKIWFLAIIYFIAGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFFMFY+LHIGFCIFAA+APPI F+GKSLTGILAAIDV SDH LVG
Sbjct  180   LYRTFRSESALKYGWFFMFYMLHIGFCIFAAVAPPIFFNGKSLTGILAAIDVLSDHALVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLEA+LS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLEAVLSVWVIQ  261



>ref|XP_010547267.1| PREDICTED: secretory carrier-associated membrane protein 3 [Tarenaya 
hassleriana]
Length=295

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 207/291 (71%), Gaps = 31/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL-  1112
             M  R D NPFD+EE EVNPF+N GG  P S SR+  +    +GF    DATVDIPLD   
Sbjct  1     MANRYDRNPFDEEE-EVNPFANSGGVPPASNSRLSPLPPEPVGFDYGRDATVDIPLDRSG  59

Query  1111  -----NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
                   + KKK+KEL A EA+L+RRE ++KR+EDA A AG+ +  KNWPPFFPIIHHDI 
Sbjct  60    PTSQNTNLKKKEKELQAKEAELRRREQELKRKEDAAARAGIVIEVKNWPPFFPIIHHDIA  119

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             NEIP+  Q++QY+AFA++LG+VLCL +NI+AVT  WIKG+GV I+LLAIIY + G P +Y
Sbjct  120   NEIPIHLQRLQYVAFATFLGMVLCLFWNIIAVTTAWIKGEGVTIWLLAIIYFIAGVPGAY  179

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
             VLWYRPLY A RT SAL FGWFF+FYLLH+ FCIFAA+APP++F GKSL GIL AIDV +
Sbjct  180   VLWYRPLYRAFRTESALSFGWFFLFYLLHLAFCIFAAVAPPVVFKGKSLAGILPAIDVLN  239

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              H LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  240   KHALVG-----------------------IFYFIGFGLFCLESVVSVWVIQ  267



>ref|XP_003580430.1| PREDICTED: secretory carrier-associated membrane protein 6 [Brachypodium 
distachyon]
Length=271

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 208/292 (71%), Gaps = 28/292 (10%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQ-KHDATVDIPLDSLND--P  1103
             +DPNPFD+   E NPFSNGG   G +    +  +  +GFG  + DATVD+PLD++     
Sbjct  3     HDPNPFDEGGAEDNPFSNGGGRGGRQQYGFR-PSEPVGFGGGRGDATVDVPLDNMGTQGS  61

Query  1102  KKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQ  923
               K +EL++WE+DLKRRE DIKRRE+++  AGVP+ DKNWPPFFPIIHHDI NEIP   Q
Sbjct  62    NGKARELSSWESDLKRREADIKRREESLKNAGVPMEDKNWPPFFPIIHHDIANEIPANVQ  121

Query  922   KMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLY  743
             K+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRPLY
Sbjct  122   KLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLMWYRPLY  181

Query  742   NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVS  563
              AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+F GKSLTGILAAID FS+HV++G  
Sbjct  182   RAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFQGKSLTGILAAIDTFSEHVIIG--  239

Query  562   CCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                  IFY VGF LFCLE LLS+ VLQ V  Y  GH
Sbjct  240   ---------------------IFYFVGFALFCLETLLSIGVLQKVYMYFRGH  270



>ref|XP_006467870.1| PREDICTED: putative secretory carrier-associated membrane protein 
1-like isoform X1 [Citrus sinensis]
 ref|XP_006467871.1| PREDICTED: putative secretory carrier-associated membrane protein 
1-like isoform X2 [Citrus sinensis]
 gb|KDO75794.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
 gb|KDO75795.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
Length=310

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 210/307 (68%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA----------PGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS+             GG            P + SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPAVRGKSSGQSRFGGGGFFTTNSASVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                 GF  + DA +DIPLD+  D KKK+KEL A EA+L+RRE D++R+E+A A AG+ + 
Sbjct  59    HEPAGFNFERDAPIDIPLDTAADLKKKEKELQAKEAELRRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AFA++LG+ LCL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFATYLGLFLCLLWNIVAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A RT SA+KFGWFF+FYLLHIGFCIFA++APPIIF
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFRTESAMKFGWFFLFYLLHIGFCIFASVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTG+L A+DV  DH LVG                       IFY +GFGLFCLE+L
Sbjct  239   KGKSLTGVLPAVDVMGDHALVG-----------------------IFYFIGFGLFCLESL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   VSIWVIQ  282



>ref|XP_008224978.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Prunus mume]
Length=289

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 203/285 (71%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF  EE EVNPFSN G+ AP   SR+  +     GF      TVDIP+D   
Sbjct  1     MAGRYDSNPFA-EEDEVNPFSNPGSVAPAKNSRLSPLPPERAGFNYGLGDTVDIPIDGNA  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A EA+L++RE  +KR+EDA A AG+ + +KNWP FFPIIHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKEAELRKREEIVKRKEDAAARAGIVLEEKNWPAFFPIIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLGIVLCL +NI+AVT  WIKG+GVKI+ LA+IY + G P SYVLWYRP
Sbjct  120   LQRVQYVAFTTWLGIVLCLFWNIIAVTTAWIKGEGVKIWFLAVIYFIAGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFFMFYLLHIGFCIFAA+APP+IF GKSLTGILAA+DV  +H LVG
Sbjct  180   LYRVFRSESALKYGWFFMFYLLHIGFCIFAAVAPPLIFKGKSLTGILAAVDVVGNHALVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLE+LLS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLESLLSIWVIQ  261



>gb|ABV68807.1| putative secretory carrier membrane protein [Triticum aestivum]
Length=276

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 206/297 (69%), Gaps = 33/297 (11%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGS------KSRIPQMVANTLGFGQ--KHDATVDIPLD  1118
              DPNPFD E  + + FSNGG   G+      KS+        +GFG     DA VDIPLD
Sbjct  3     RDPNPFD-EGADDSAFSNGGGRGGAAGGGGGKSQFQFRPTEPVGFGAGGNGDAAVDIPLD  61

Query  1117  SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEI  938
             ++N    KQ EL+ W+ADLKRRE DIKRRE+A+  AGVP+ DKNWPPFFPIIHHDI +EI
Sbjct  62    NMNGSNGKQSELSQWQADLKRREADIKRREEALKSAGVPMEDKNWPPFFPIIHHDIAHEI  121

Query  937   PVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLW  758
             P  +Q++QYLAFASWLGIVLCLV+N +AVTVCWI+G   K+F LA IY ++G PLSY++W
Sbjct  122   PANAQRLQYLAFASWLGIVLCLVWNFIAVTVCWIRGGDSKLFFLATIYGMLGVPLSYLMW  181

Query  757   YRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHV  578
             YRPLY AMRT+SA  FGWFF+ Y+LHIGFCI AAIAPPI+F GKSLTGILAAID FSDH 
Sbjct  182   YRPLYRAMRTDSAFSFGWFFLCYMLHIGFCIIAAIAPPIVFRGKSLTGILAAIDTFSDHA  241

Query  577   LVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
             LVG                       I Y VGF LF LE ++S+WVLQ V  Y  GH
Sbjct  242   LVG-----------------------ILYFVGFALFSLETVVSIWVLQRVYMYFRGH  275



>ref|XP_009378095.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X1 [Pyrus x bretschneideri]
Length=290

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 201/286 (70%), Gaps = 26/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN--GGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             M  R D NPF  EE EVNPFS   G  AP   SR+  +     GF      TVDIP+D  
Sbjct  1     MAGRYDSNPFA-EEDEVNPFSQNPGSVAPAKNSRLSPLPPERAGFNYGLGETVDIPIDGN  59

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
              D KK+++EL A EADL++RE  +KR+E A A AG+ + DKNWPPFFPIIHHDI NEIP+
Sbjct  60    ADLKKRERELQAKEADLRKREEIVKRKEAAAARAGIVLEDKNWPPFFPIIHHDIANEIPI  119

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
               Q++QY+AF +WLGIVLCL +NI+AVT  WIKGDGVKI+ LAIIY + G P SYVLWYR
Sbjct  120   HLQRLQYVAFTTWLGIVLCLFWNIIAVTTAWIKGDGVKIWFLAIIYFIAGAPGSYVLWYR  179

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY   R+ SALK+GWFFMFY+LHIGFCIFAA+APPI F GKSLTGILAAIDV S+H LV
Sbjct  180   PLYRTFRSESALKYGWFFMFYMLHIGFCIFAAVAPPIFFKGKSLTGILAAIDVLSEHALV  239

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFY +GFG+FCLEA+LS+WV+Q
Sbjct  240   G-----------------------IFYFIGFGMFCLEAVLSVWVIQ  262



>gb|ACJ84609.1| unknown [Medicago truncatula]
 gb|AFK44807.1| unknown [Medicago truncatula]
Length=289

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 213/301 (71%), Gaps = 35/301 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRI----PQMVANTLGFGQKHDATVDIPL  1121
             M  R D NPFD+E+  VNPFSN GG AP + SR     P+      GFGQ    TVDIPL
Sbjct  1     MAGRYDSNPFDEEQ--VNPFSNSGGVAPATNSRPAPLNPERAGYNYGFGQ----TVDIPL  54

Query  1120  DSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
             D+  D KKK++EL A EA+L++RE +++R+E+A++ AG+ + +KNWPPFFPIIHHDI NE
Sbjct  55    DASTDVKKKERELQAKEAELRKREQEVRRKEEAISRAGIVIEEKNWPPFFPIIHHDIANE  114

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AF S LG+VLCL +N+VAVT  WIKG+GVKI+ LAIIY + G P +YVL
Sbjct  115   IPVHLQRLQYVAFFSLLGLVLCLTWNVVAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVL  174

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WY+PLY A RT+SA+K GWFF+FYLLH+GFCI AA+APPI+F GKSLTGIL+AIDV  D+
Sbjct  175   WYKPLYRAFRTDSAIKSGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAIDVIGDY  234

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHSH  404
              ++G                       IFY +GFGLFCLE L+S+WV+ QV  Y  G   
Sbjct  235   TIIG-----------------------IFYFIGFGLFCLETLISVWVIQQVYMYFRGGGK  271

Query  403   T  401
             T
Sbjct  272   T  272



>ref|XP_007211759.1| hypothetical protein PRUPE_ppa009511mg [Prunus persica]
 gb|EMJ12958.1| hypothetical protein PRUPE_ppa009511mg [Prunus persica]
Length=289

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 202/285 (71%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF  EE EVNPFSN G+ AP   SR+  +     GF      TVDIP+D   
Sbjct  1     MAGRYDSNPFA-EEDEVNPFSNPGSVAPAKNSRLSPLPPERAGFNYGLGDTVDIPIDGNA  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A E +L++RE  +KR+EDA A AG+ + +KNWP FFPIIHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKETELRKREEIVKRKEDAAARAGIVLEEKNWPAFFPIIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLGIVLCL +NI+AVT  WIKG+GVKI+ LA+IY + G P SYVLWYRP
Sbjct  120   LQRVQYVAFTTWLGIVLCLFWNIIAVTTAWIKGEGVKIWFLAVIYFIAGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFFMFYLLHIGFCIFAA+APP+IF GKSLTGILAA+DV  +H LVG
Sbjct  180   LYRVFRSESALKYGWFFMFYLLHIGFCIFAAVAPPLIFKGKSLTGILAAVDVVGNHALVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLE+LLS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLESLLSIWVIQ  261



>ref|XP_010646776.1| PREDICTED: secretory carrier-associated membrane protein 3 [Vitis 
vinifera]
Length=312

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 208/309 (67%), Gaps = 50/309 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------GGNA----------PGSKSRIPQMVAN  1169
             M RR DPNPFD  E+EVNPFS+           GG A          P S SR+  +   
Sbjct  1     MARRYDPNPFD--EEEVNPFSDPAVRGKTSTNYGGGAFYTTNPGSVPPASNSRLSPLPPE  58

Query  1168  TLGFGQKHDATVDIPLDS----LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVP  1001
               GF     AT+DIPLD+      D KKK++EL A EA+L++RE ++KR+EDA A AG+ 
Sbjct  59    PAGFNYDGGATIDIPLDTAGSNFQDLKKKERELQAKEAELRKREQEVKRKEDAAARAGIV  118

Query  1000  VSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGV  821
             + +KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG+  CL +NI+A T  WIKG+GV
Sbjct  119   LEEKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLACCLTWNIIATTTAWIKGEGV  178

Query  820   KIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappi  641
             KI+ LAIIY + G P +YVLWYRPLY A R  SALKFGWFFMFYLLHI FCIFAA+APP+
Sbjct  179   KIWFLAIIYFIAGVPGAYVLWYRPLYRAFRNESALKFGWFFMFYLLHIAFCIFAAVAPPV  238

Query  640   iFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLE  461
             IFHGKSLTGIL A+D+  DHVLVG                       IFY +GFG+FC+E
Sbjct  239   IFHGKSLTGILPAVDLIGDHVLVG-----------------------IFYFIGFGMFCVE  275

Query  460   ALLSLWVLQ  434
             ++LS+WV+Q
Sbjct  276   SVLSIWVIQ  284



>ref|NP_001185278.1| secretory carrier-associated membrane protein 3 [Arabidopsis 
thaliana]
 gb|AEE33812.1| secretory carrier-associated membrane protein 3 [Arabidopsis 
thaliana]
Length=274

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 206/295 (70%), Gaps = 29/295 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG-GNAPGSKSRIPQMVANTLGFGQKHDATVDIPLD--S  1115
             M  R DPNPF  EE+EVNPF+N  G  P S SR+  +    +GF   +  TVDIPLD   
Sbjct  1     MANRYDPNPFA-EEEEVNPFANARGVPPASNSRLSPLPPEPVGF--DYGRTVDIPLDRAG  57

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
               D KKK+KEL A EA+LKRRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NEIP
Sbjct  58    TQDLKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIP  117

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             V  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLWY
Sbjct  118   VHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWY  177

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY A RT+SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S   +
Sbjct  178   RPLYRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAI  237

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQVCDYKNGH  410
             VG                       IFY +GF  FCLE+++S+WV+QVC + + H
Sbjct  238   VG-----------------------IFYFIGFAFFCLESVVSIWVIQVCLFNSHH  269



>sp|Q6Z8F5.1|SCAM5_ORYSJ RecName: Full=Secretory carrier-associated membrane protein 5; 
Short=Secretory carrier membrane protein 5 [Oryza sativa Japonica 
Group]
 dbj|BAD07864.1| putative secretory carrier membrane protein [Oryza sativa Japonica 
Group]
 dbj|BAG97634.1| unnamed protein product [Oryza sativa Japonica Group]
Length=281

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 203/303 (67%), Gaps = 38/303 (13%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHD-------------ATV  1133
             +DPNPFD E  + NPFSNGG     +           G   +               ATV
Sbjct  3     HDPNPFD-EGADDNPFSNGGGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGSKGGATV  61

Query  1132  DIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHD  953
             DIPLD+++D K K KEL  WEADLKRRE DI+RRE+A+  AGVP+ +KNWPPFFPIIHHD
Sbjct  62    DIPLDNMSDSKGKGKELLQWEADLKRREADIRRREEALKSAGVPMEEKNWPPFFPIIHHD  121

Query  952   IVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPL  773
             I NEIP  +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++G PL
Sbjct  122   IANEIPANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGMPL  181

Query  772   SYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDV  593
             SY++WYRPLY AMRT+SA  FGWFF+ Y+LHI FC+FAAIAPP+IF GKSLTGILAAID 
Sbjct  182   SYLMWYRPLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILAAIDT  241

Query  592   FSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKN  416
             FSDH +VG                       IFY VGF LFCLE L+S+WVLQ V  Y  
Sbjct  242   FSDHAIVG-----------------------IFYFVGFALFCLETLVSIWVLQKVYMYFR  278

Query  415   GHS  407
             GH 
Sbjct  279   GHK  281



>gb|KHN41148.1| Putative secretory carrier-associated membrane protein 1 [Glycine 
soja]
Length=314

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 206/311 (66%), Gaps = 57/311 (18%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG----------------------GNAPGSKSRIPQMVANTL  1163
             R DPNPFD+E  EVNPF++G                      G+ P S SR+  +     
Sbjct  3     RYDPNPFDEEPVEVNPFADGAAKGKGSGQSSYSGGAFYTTNTGSVPSSNSRLSPLPPEPY  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
               G    AT+DIPL++  D K K+KEL A EA+LKRRE ++KRREDA+A AG+ + +KNW
Sbjct  63    DRG----ATIDIPLNNAKDAKAKEKELQAKEAELKRREQELKRREDAIARAGIVIEEKNW  118

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI  EIPV  Q++QY+AF +WLG+VLCL++NIVAVT  WIKG+G  I+ LA
Sbjct  119   PPFFPIIHHDIAKEIPVHLQRIQYIAFTTWLGLVLCLLWNIVAVTTAWIKGEGPTIWFLA  178

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYL--------LHIGFCifaaiap  647
             IIY + G P SYVLWYRPLY AMRT+SALKFGWFF+ Y+        LHI FCI AA+AP
Sbjct  179   IIYFISGAPGSYVLWYRPLYRAMRTDSALKFGWFFLLYMASFMYFTSLHIAFCILAAVAP  238

Query  646   piiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFC  467
             PIIF GKSLTGILAAIDV  D+ LVG                       IFY +GFGLFC
Sbjct  239   PIIFKGKSLTGILAAIDVLGDNALVG-----------------------IFYFIGFGLFC  275

Query  466   LEALLSLWVLQ  434
             LE++LS+WV+Q
Sbjct  276   LESVLSIWVIQ  286



>ref|XP_008383801.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X2 [Malus domestica]
Length=289

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/285 (56%), Positives = 202/285 (71%), Gaps = 25/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGG-NAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPF +EE EVNPFSN G  AP   SR+  +     GF       VDIP+D   
Sbjct  1     MAGRYDSNPFAEEE-EVNPFSNPGIVAPAKNSRLSPLPPERAGFNYGLGDPVDIPIDGNA  59

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KK+++EL A EA+L++RE  ++R+E+A A AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  60    DLKKRERELQAKEAELRKREEIVRRKEEAAARAGIVLEEKNWPPFFPIIHHDIANEIPIH  119

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF +WLG+VLCL +N++AVT  WIKG+GVKI+ LA+IY + G P SYVLWYRP
Sbjct  120   LQRVQYVAFTTWLGLVLCLFWNVIAVTTAWIKGEGVKIWFLAVIYFISGAPGSYVLWYRP  179

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY   R+ SALK+GWFF+FYL+HIGFCIFAA+APPI F GKSLTGIL AIDV  DHVLVG
Sbjct  180   LYRVFRSESALKYGWFFLFYLIHIGFCIFAAVAPPIFFKGKSLTGILPAIDVLGDHVLVG  239

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFG+FCLE++LS+WV+Q
Sbjct  240   -----------------------IFYFIGFGMFCLESVLSIWVIQ  261



>ref|XP_004970184.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Setaria italica]
Length=287

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 195/284 (69%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPFD  E +VNPF+ G   P S SR+P +     GF     ATVDIPLDS  D
Sbjct  1     MAGRYDRNPFD--EDDVNPFAGGSVPPASNSRMPPLPHEPAGFYNDRGATVDIPLDSTKD  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KK+KEL A EA+L +RE ++KR+E+A A AG+ + DKNWPPF PIIHHDI NEIPV  
Sbjct  59    MNKKEKELQAKEAELNKRERELKRKEEAAARAGIVIEDKNWPPFMPIIHHDISNEIPVHL  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S LG+  CL +NI+A T  WIKG+GV I+LLAIIY + G P +YVLWYRPL
Sbjct  119   QRMQYLAFSSLLGLTACLFWNIIATTAAWIKGEGVMIWLLAIIYFISGVPGAYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFF+FYLLHI FC+++A+APP  F GKSL GIL AIDV     +VG 
Sbjct  179   YNAMRTESALKFGWFFLFYLLHILFCVWSAVAPPFPFKGKSLAGILPAIDVIGRSAIVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLS+ V+Q
Sbjct  238   ----------------------IFYFIGFGLFCLESLLSIAVIQ  259



>ref|XP_006449256.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
 ref|XP_006449257.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
 ref|XP_006449258.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
 gb|ESR62496.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
 gb|ESR62497.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
 gb|ESR62498.1| hypothetical protein CICLE_v10016025mg [Citrus clementina]
Length=310

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 208/307 (68%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA----------PGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS+             GG            P + SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPAVRGKSSGQSRFGGGGFFTTNSASVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                 GF  + DA +DIPLD+  D KKK+KEL A EA+L+RRE D++R+E+A A AG+ + 
Sbjct  59    HEPAGFNFERDAPIDIPLDTAADLKKKEKELQAKEAELRRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AFA++LG+ +CL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFATYLGLFVCLLWNIVAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +Y LWYRPLY A RT SA+KFGWFF+FYLLHIGFCIFA++APPIIF
Sbjct  179   WFLAIIYFIAGVPGAYGLWYRPLYRAFRTESAMKFGWFFLFYLLHIGFCIFASVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTG+L A+DV  D  LVG                       IFY +GFGLFCLE+L
Sbjct  239   KGKSLTGVLPAVDVMGDDALVG-----------------------IFYFIGFGLFCLESL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   VSIWVIQ  282



>gb|KJB57596.1| hypothetical protein B456_009G171800 [Gossypium raimondii]
 gb|KJB57604.1| hypothetical protein B456_009G171800 [Gossypium raimondii]
Length=317

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 213/312 (68%), Gaps = 51/312 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGN---------APGSKSRIPQMVA  1172
             M  R D NPFD+EE+EVNPF++             GG           P S SR+  +  
Sbjct  1     MAGRYDKNPFDEEEEEVNPFADTTARGKASGQSKFGGGLFSTSTASVPPASNSRLSPLPP  60

Query  1171  NTLGFGQKHDATVDIPLDSLN------DPKKKQKELAAWEADLKRREMDIKRREDAVAGA  1010
                GF  + +ATVDIPLD+ +      D KKK+KEL A EA+L+RRE +++R+E+AVA A
Sbjct  61    EPAGFSYEREATVDIPLDTASGGSRNQDLKKKEKELQAKEAELRRREQEVRRKEEAVARA  120

Query  1009  GVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKG  830
             GV + +KNWPPFFPIIHHDI NEIP+  Q++QY+AF+++LG+VLCL++NI+AVT  WIKG
Sbjct  121   GVVLEEKNWPPFFPIIHHDIANEIPIHLQRLQYVAFSTYLGLVLCLLWNIIAVTTAWIKG  180

Query  829   DGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaia  650
             +GV+I+ LAII+ + G P +YVLWYRPLY A R  SAL+FGWFF+FYLLHI FCIFAA+A
Sbjct  181   EGVRIWFLAIIFFIAGVPGAYVLWYRPLYRAFRNESALRFGWFFLFYLLHIAFCIFAAVA  240

Query  649   ppiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLF  470
             PPI+F GKSLTGIL A+D+   + LVG                       IFY +GFGLF
Sbjct  241   PPIVFRGKSLTGILPAVDLVGGNALVG-----------------------IFYFIGFGLF  277

Query  469   CLEALLSLWVLQ  434
             CLE+++S+WV+Q
Sbjct  278   CLESVVSIWVIQ  289



>gb|ACU17661.1| unknown [Glycine max]
Length=310

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 205/307 (67%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFS----------------------NGGNAPG-SKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS                      N G+ P  + SR+P + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPSVRGKTSSQSNFSGGAFYTTNPGSVPAATNSRLPPLK  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                + +     ATVDIPLDS  D KKK+KEL A E +L++RE +++R+E+A + AG+ + 
Sbjct  59    PEPVDYNYGFGATVDIPLDSSMDLKKKEKELQAKETELRKREQEVRRKEEAASRAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  QK+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A R  SALKFGWFF+FYLLHIGFCI AA+APPI+F
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFRNESALKFGWFFLFYLLHIGFCILAAVAPPIVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGILAAIDV  DH L+G                       IFY VGFGLFC+E L
Sbjct  239   KGKSLTGILAAIDVLGDHALIG-----------------------IFYFVGFGLFCIETL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   ISIWVIQ  282



>ref|XP_006582946.1| PREDICTED: uncharacterized protein LOC100815455 isoform X1 [Glycine 
max]
 gb|KHN07306.1| Putative secretory carrier-associated membrane protein 1 [Glycine 
soja]
Length=310

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 205/307 (67%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFS----------------------NGGNAPG-SKSRIPQMV  1175
             M  R D NPFD+EE  VNPFS                      N G+ P  + SR+P + 
Sbjct  1     MAGRYDSNPFDEEE--VNPFSDPSVRGKASSQSNFSGGAFYTTNPGSVPAATNSRLPPLK  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                + +     ATVDIPLDS  D KKK+KEL A E +L++RE +++R+E+A + AG+ + 
Sbjct  59    PEPVDYNYGFGATVDIPLDSSMDLKKKEKELQAKETELRKREQEVRRKEEAASRAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  QK+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A R  SALKFGWFF+FYLLHIGFCI AA+APPI+F
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFRNESALKFGWFFLFYLLHIGFCILAAVAPPIVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGILAAIDV  DH L+G                       IFY VGFGLFC+E L
Sbjct  239   KGKSLTGILAAIDVLGDHALIG-----------------------IFYFVGFGLFCIETL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   ISIWVIQ  282



>ref|XP_006841748.1| PREDICTED: secretory carrier-associated membrane protein 1 isoform 
X2 [Amborella trichopoda]
 gb|ERN03423.1| hypothetical protein AMTR_s00003p00261520 [Amborella trichopoda]
Length=288

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 208/285 (73%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M RR D NPFD  E++VNPF++ G+ P  + SR+  +      F     ATVDIPLDS  
Sbjct  1     MARRYDSNPFD--EEDVNPFAHPGSVPPATNSRLSPLPPEPADFNYDRGATVDIPLDSAK  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+KEL A EA+LKRRE ++KRREDA A AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DLKKKEKELQAKEAELKRREQELKRREDAAARAGIVIEEKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q+MQY AFA+ LG+V+CL +N +A+T+ W++G GVKI+ L+IIY + G P +YVLWYRP
Sbjct  119   LQRMQYFAFATLLGLVICLGWNFIAITIGWVRGLGVKIWFLSIIYFIAGVPGAYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF FYLLHIGFC+FA++APP++FHGKSLTGIL AIDVF  HVLVG
Sbjct  179   LYRAMRTDSALKFGWFFFFYLLHIGFCLFASVAPPVVFHGKSLTGILPAIDVFGGHVLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFYL+GFG F LE+LLS+WV+Q
Sbjct  239   -----------------------IFYLIGFGFFVLESLLSIWVIQ  260



>ref|XP_006305476.1| hypothetical protein CARUB_v10009907mg [Capsella rubella]
 gb|EOA38374.1| hypothetical protein CARUB_v10009907mg [Capsella rubella]
Length=291

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 203/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDS--  1115
             M  R D NPFD E+ EVNPF+N G+ P  S SR+  +     GFG  H  TVDIPLDS  
Sbjct  1     MAGRYDRNPFD-EQDEVNPFANPGSVPPASSSRLSPLPPEPAGFGYGH--TVDIPLDSPG  57

Query  1114  --LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EADL+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEADLRRREQDLKRKEDAAARAGIVIEAKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRSDSAFNFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSAQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  263



>ref|XP_007040769.1| Secretory carrier-associated membrane protein 4 isoform 3 [Theobroma 
cacao]
 gb|EOY25270.1| Secretory carrier-associated membrane protein 4 isoform 3 [Theobroma 
cacao]
Length=215

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 6/193 (3%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             MNR +DPNPFD  E+EVNPFSNGG    ++     + +  LGFGQKHDATVDIPLD++N+
Sbjct  1     MNRHHDPNPFD--EEEVNPFSNGGAVAPARP----LASEPLGFGQKHDATVDIPLDTMNE  54

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
             PKKK+KELAAWEADLKRRE DIKRREDA++ AGV V +KNWPP FPIIHHDI NEIPV +
Sbjct  55    PKKKEKELAAWEADLKRREKDIKRREDAISQAGVTVDNKNWPPIFPIIHHDIANEIPVHA  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QYLAFASWLGIVLCLVYN++AV VCWI+G GVKIF LAIIY L+GCPLSYVLWYRPL
Sbjct  115   QRLQYLAFASWLGIVLCLVYNVIAVIVCWIQGGGVKIFFLAIIYMLLGCPLSYVLWYRPL  174

Query  745   YNAMRTNSALKFG  707
             Y AMRT+SAL F 
Sbjct  175   YRAMRTDSALNFA  187



>ref|NP_001150198.1| SC3 protein [Zea mays]
 gb|ACG38223.1| SC3 protein [Zea mays]
 gb|ACR38210.1| unknown [Zea mays]
 gb|AFW72924.1| SC3 protein [Zea mays]
Length=272

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 207/294 (70%), Gaps = 29/294 (10%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQM---VANTLGFGQ-KHDATVDIPLDSLN  1109
              +DPNPFD+   E NPFSNGG         PQ         GFG  + DAT DIPLD++N
Sbjct  2     HHDPNPFDEGADE-NPFSNGGGGARGGGVKPQYGFRPTEPAGFGGGRGDATTDIPLDTMN  60

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D K K KEL+ WE+DL+RRE DI+RRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP  
Sbjct  61    DSKGKAKELSQWESDLRRRESDIRRREEALKSAGVPMEDKNWPPFFPIIHHDIANEIPAN  120

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
             +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++G PLSY++WYRP
Sbjct  121   AQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGIPLSYLMWYRP  180

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SA  FGWFF+ YLLHIGFCIFAAIAP ++F GKSLTGILAAID FSDH +VG
Sbjct  181   LYRAMRTDSAFSFGWFFLCYLLHIGFCIFAAIAPAVVFRGKSLTGILAAIDTFSDHAIVG  240

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
                                    IFY VGF LFCLE L+S+WVLQ V  Y  GH
Sbjct  241   -----------------------IFYFVGFALFCLETLVSIWVLQKVYMYFRGH  271



>ref|XP_008383800.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X1 [Malus domestica]
Length=290

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 201/286 (70%), Gaps = 26/286 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN--GGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL  1112
             M  R D NPF +EE EVNPFS   G  AP   SR+  +     GF       VDIP+D  
Sbjct  1     MAGRYDSNPFAEEE-EVNPFSQNPGIVAPAKNSRLSPLPPERAGFNYGLGDPVDIPIDGN  59

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
              D KK+++EL A EA+L++RE  ++R+E+A A AG+ + +KNWPPFFPIIHHDI NEIP+
Sbjct  60    ADLKKRERELQAKEAELRKREEIVRRKEEAAARAGIVLEEKNWPPFFPIIHHDIANEIPI  119

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
               Q++QY+AF +WLG+VLCL +N++AVT  WIKG+GVKI+ LA+IY + G P SYVLWYR
Sbjct  120   HLQRVQYVAFTTWLGLVLCLFWNVIAVTTAWIKGEGVKIWFLAVIYFISGAPGSYVLWYR  179

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY   R+ SALK+GWFF+FYL+HIGFCIFAA+APPI F GKSLTGIL AIDV  DHVLV
Sbjct  180   PLYRVFRSESALKYGWFFLFYLIHIGFCIFAAVAPPIFFKGKSLTGILPAIDVLGDHVLV  239

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             G                       IFY +GFG+FCLE++LS+WV+Q
Sbjct  240   G-----------------------IFYFIGFGMFCLESVLSIWVIQ  262



>gb|KJB21179.1| hypothetical protein B456_003G186500 [Gossypium raimondii]
Length=214

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 190/237 (80%), Gaps = 24/237 (10%)
 Frame = -2

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             +ND KK++KELAAWEADLKRRE DIKRREDAV+ AGV V DKNWPP FPIIHHDI NEIP
Sbjct  1     MNDSKKREKELAAWEADLKRREKDIKRREDAVSQAGVSVDDKNWPPIFPIIHHDIANEIP  60

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             V +Q++QYLAFASWLGIVLCLV+N++AV VCWI+G GVKIF LA+IY L+GCPLSYVLWY
Sbjct  61    VHAQRLQYLAFASWLGIVLCLVFNVIAVIVCWIQGGGVKIFFLAVIYMLLGCPLSYVLWY  120

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRT+SAL FGWFFMFYLLH+GFCIFAAIAPPI+FHGKSLTGILAAIDV SDH+L
Sbjct  121   RPLYRAMRTDSALNFGWFFMFYLLHLGFCIFAAIAPPIVFHGKSLTGILAAIDVISDHML  180

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
              GV                        + VGFGLFCLE+LLSLWV+Q +  Y  GH 
Sbjct  181   AGVF-----------------------FFVGFGLFCLESLLSLWVIQKIYLYFRGHK  214



>ref|NP_176320.1| secretory carrier-associated membrane protein 3 [Arabidopsis 
thaliana]
 sp|Q9M5P2.1|SCAM3_ARATH RecName: Full=Secretory carrier-associated membrane protein 3; 
Short=AtSC3; Short=Secretory carrier membrane protein 3 [Arabidopsis 
thaliana]
 gb|AAF36686.1|AF225920_1 secretory carrier membrane protein [Arabidopsis thaliana]
 gb|AAK76462.1| putative secretory carrier membrane protein [Arabidopsis thaliana]
 gb|AAL85067.1| putative secretory carrier membrane protein [Arabidopsis thaliana]
 gb|AAM63793.1| secretory carrier membrane protein [Arabidopsis thaliana]
 gb|AEE33811.1| secretory carrier-associated membrane protein 3 [Arabidopsis 
thaliana]
Length=289

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 201/287 (70%), Gaps = 29/287 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG-GNAPGSKSRIPQMVANTLGFGQKHDATVDIPLD--S  1115
             M  R DPNPF +EE EVNPF+N  G  P S SR+  +    +GF   +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANARGVPPASNSRLSPLPPEPVGF--DYGRTVDIPLDRAG  57

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
               D KKK+KEL A EA+LKRRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NEIP
Sbjct  58    TQDLKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIP  117

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             V  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLWY
Sbjct  118   VHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWY  177

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY A RT+SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S   +
Sbjct  178   RPLYRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAI  237

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             VG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   VG-----------------------IFYFIGFAFFCLESVVSIWVIQ  261



>ref|XP_003545859.1| PREDICTED: secretory carrier-associated membrane protein [Glycine 
max]
Length=310

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 202/307 (66%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS                        G  AP + SR+  + 
Sbjct  1     MAHRYDSNPFD--EEEVNPFSEPAVRGKTSSQSSYSGGAFYTTNPGSVAPATNSRLSPLN  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  +     ATVDIPLD   D KKK+KEL A EA+L++RE +++R+E+A A AG+ + 
Sbjct  59    PEPADYNYGFGATVDIPLDPSTDLKKKEKELQAKEAELRKREQEVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AF S LG+ LCL +NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFTSLLGLALCLTWNIVAVTSAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A RT+SAL FGWFF+FYLLH+GFCI AA+APPI+F
Sbjct  179   WFLAIIYFIAGIPGAYVLWYRPLYRAFRTDSALNFGWFFLFYLLHLGFCILAAVAPPIVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL+AIDV  DH ++G                       IFY VGFGLFC+E L
Sbjct  239   KGKSLTGILSAIDVVGDHAVIG-----------------------IFYFVGFGLFCIETL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   ISIWVIQ  282



>ref|XP_004953550.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Setaria italica]
Length=275

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 213/296 (72%), Gaps = 32/296 (11%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGS------KSRIPQMVANTLGFGQ-KHDATVDIPLDS  1115
             +DPNPFD E  + NPFSNGG   G       KS+     A  +GFG  + DATVDIPLD+
Sbjct  3     HDPNPFD-EGADDNPFSNGGGGGGGARGGGGKSQFGFRPAEPVGFGGGRGDATVDIPLDT  61

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             +ND K K KEL+ WE+DL+RR+ DI+RRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP
Sbjct  62    MNDSKGKAKELSQWESDLRRRDADIRRREEALRSAGVPMEDKNWPPFFPIIHHDIANEIP  121

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
               +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++G PLSY++WY
Sbjct  122   ANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGIPLSYLMWY  181

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRT+SA  FGWFF+ YLLHIGFC+FAAIAPPIIF GKSLTGILAAID FSDH +
Sbjct  182   RPLYRAMRTDSAFSFGWFFLCYLLHIGFCVFAAIAPPIIFRGKSLTGILAAIDTFSDHAI  241

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGH  410
             VG                       IFY VGF LFCLE L+S+WVLQ V  Y  GH
Sbjct  242   VG-----------------------IFYFVGFALFCLETLVSIWVLQKVYMYFRGH  274



>ref|XP_004243323.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Solanum lycopersicum]
Length=287

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 198/284 (70%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R + NPF  EE EVNPFSN G+ P + +  P  + +    G    ATVDIPLD  ND
Sbjct  1     MAGRYNDNPFA-EEDEVNPFSNNGSVPAASNSRPYPLPHEPA-GYDRGATVDIPLDGSND  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+LK+RE ++KR+EDA+  AGV + DKNWPPFFPIIHHDI NEIP+  
Sbjct  59    MKKKEKELQAKEAELKKREQELKRKEDAITRAGVVIEDKNWPPFFPIIHHDIANEIPIHL  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QY+AF + LG+  CLV+N+VAVT+ WI+G+G  I+LLA+IY + G P +YVLWYRPL
Sbjct  119   QKLQYVAFTTLLGLAACLVWNLVAVTLAWIRGEGPTIWLLAVIYLISGVPGAYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+ Y+ HIGFCI AA+APPI F GKSLTGIL AID+   H LVG 
Sbjct  179   YRAMRTDSALKFGWFFLSYVFHIGFCIIAAVAPPIFFKGKSLTGILPAIDLLGWHALVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +G G FCLE L+S+WV+Q
Sbjct  238   ----------------------IFYFIGAGFFCLETLMSIWVIQ  259



>gb|EEC73835.1| hypothetical protein OsI_08573 [Oryza sativa Indica Group]
Length=421

 Score =   307 bits (787),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/297 (57%), Positives = 198/297 (67%), Gaps = 41/297 (14%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHD----------------  1142
             +DPNPFD+   E NPFSNG      +           G   +                  
Sbjct  3     HDPNPFDEGADE-NPFSNGRGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGGGGGSKG  61

Query  1141  -ATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPI  965
              ATVDIPLD+++D K K KEL  WEADLKRRE DI+RRE+A+  AGVP+ +KNWPPFFPI
Sbjct  62    GATVDIPLDNMSDSKGKGKELLQWEADLKRREADIRRREEALKSAGVPMEEKNWPPFFPI  121

Query  964   IHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALM  785
             IHHDI NEIP  +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++
Sbjct  122   IHHDIANEIPANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGML  181

Query  784   GCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILA  605
             G PLSY++WYRPLY AMRT+SA  FGWFF+ Y+LHI FC+FAAIAPP+IF GKSLTGILA
Sbjct  182   GMPLSYLMWYRPLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILA  241

Query  604   AIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             AID FSDH +VG                       IFY VGF LFCLE L+S+WVLQ
Sbjct  242   AIDTFSDHAIVG-----------------------IFYFVGFALFCLETLVSIWVLQ  275



>ref|XP_009397788.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=310

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 206/305 (68%), Gaps = 44/305 (14%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN---------------------APGSKSRIPQMVAN  1169
             M RR D NPF++EE+EVNPF++ G                       P S SR+  +   
Sbjct  1     MARRYDSNPFEEEEEEVNPFADTGARGKATGLNYGGGPFYMNPATVPPASNSRLSPLPPE  60

Query  1168  TLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDK  989
                F     AT+DIPLD+  D +KK+KEL A EA+L ++E ++KRRE+A A AG+ + +K
Sbjct  61    PADFYNDRSATIDIPLDTAKDLRKKEKELQAKEAELNKKEKELKRREEAAARAGIVIEEK  120

Query  988   NWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFL  809
             NWPPFFPIIHHDI NEIP+  Q++QY AFAS LG+  CL +NI+AVT  WIKG+GVKI+L
Sbjct  121   NWPPFFPIIHHDIANEIPIHVQRLQYFAFASLLGLFACLFWNIIAVTAAWIKGEGVKIWL  180

Query  808   LAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHG  629
             LAIIY + G P +YVLWYRPLY AMRT SALKFGWFF+FY+LHIGF I++A+APPI F G
Sbjct  181   LAIIYFIAGVPGAYVLWYRPLYRAMRTESALKFGWFFLFYVLHIGFVIYSAVAPPIFFKG  240

Query  628   KSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLS  449
             KSLTGIL A+D+  DH+LVG                       IFY +GFG+FCLE+LLS
Sbjct  241   KSLTGILPAVDIIGDHLLVG-----------------------IFYFIGFGMFCLESLLS  277

Query  448   LWVLQ  434
             +WV+Q
Sbjct  278   VWVIQ  282



>gb|EAZ24280.1| hypothetical protein OsJ_08031 [Oryza sativa Japonica Group]
Length=419

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 199/293 (68%), Gaps = 37/293 (13%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHD-------------ATV  1133
             +DPNPFD E  + NPFSNGG     +           G   +               ATV
Sbjct  3     HDPNPFD-EGADDNPFSNGGGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGSKGGATV  61

Query  1132  DIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHD  953
             DIPLD+++D K K KEL  WEADLKRRE DI+RRE+A+  AGVP+ +KNWPPFFPIIHHD
Sbjct  62    DIPLDNMSDSKGKGKELLQWEADLKRREADIRRREEALKSAGVPMEEKNWPPFFPIIHHD  121

Query  952   IVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPL  773
             I NEIP  +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++G PL
Sbjct  122   IANEIPANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGMPL  181

Query  772   SYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDV  593
             SY++WYRPLY AMRT+SA  FGWFF+ Y+LHI FC+FAAIAPP+IF GKSLTGILAAID 
Sbjct  182   SYLMWYRPLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILAAIDT  241

Query  592   FSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             FSDH +VG                       IFY VGF LFCLE L+S+WVLQ
Sbjct  242   FSDHAIVG-----------------------IFYFVGFALFCLETLVSIWVLQ  271



>ref|XP_008809919.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
isoform X1 [Phoenix dactylifera]
Length=310

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 206/307 (67%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------GGNA-----------PGS-----KSRIPQMV  1175
             M RR D NPFD  E+EVNPF++       GG +           PGS      SR+  + 
Sbjct  1     MARRYDRNPFD--EEEVNPFADPAVRGKAGGQSSYGGGPFYTTHPGSVPPALNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPLD+  D KKK++EL A EA+L +RE ++KR E+A   AG+ + 
Sbjct  59    PEPADFYTDRGATVDIPLDTTKDIKKKERELQAKEAELNKREKELKRLEEAATRAGIVIE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY AF S LG+  CL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYFAFTSLLGLTACLLWNIVAVTAAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY AMRT SALKFGWFF+FYLLHI FCI++A+APPIIF
Sbjct  179   WFLAIIYFISGVPGAYVLWYRPLYRAMRTESALKFGWFFLFYLLHICFCIYSAVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL A+D+ SDHVLVG                       IFY +GFGLFC+E+L
Sbjct  239   KGKSLTGILPAVDLISDHVLVG-----------------------IFYFIGFGLFCVESL  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSVWVIQ  282



>gb|ABK21450.1| unknown [Picea sitchensis]
Length=308

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 202/306 (66%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------GGNAPGS---------------KSRIPQMVA  1172
             M RR DPNPF  EE+EVNPFS+        G +  S                S++  +  
Sbjct  1     MARRADPNPF--EEEEVNPFSDPAVRAHISGQSHYSAGPFYTTSTGGASTTNSKLSPLAP  58

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F    D TVDIPL +  D KK++KEL +WE +L+R+E +I+RRE+A+A  G  + +
Sbjct  59    EPADFTYDRDVTVDIPLGTTKDTKKREKELDSWEVELRRKEQEIRRREEAIARTGFVIKE  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWP FFPIIH+DI  EIP  +Q++ Y+AFASWLG+VLCLV+N VAVTV WIKG GV I+
Sbjct  119   KNWPSFFPIIHNDIAREIPSSAQRLMYIAFASWLGMVLCLVWNAVAVTVAWIKGYGVNIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
             LLAIIYAL GCP SYVLWY+PLY AM   SAL+FGWFF+ YL HIGFCIFAA+APP+ F+
Sbjct  179   LLAIIYALAGCPGSYVLWYKPLYRAMSNESALRFGWFFLTYLFHIGFCIFAAVAPPVFFN  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL AI+ FS + LVG                       IFYLVGFGLFCLE LL
Sbjct  239   GKSLAGILPAINAFSGNTLVG-----------------------IFYLVGFGLFCLETLL  275

Query  451   SLWVLQ  434
             S+WVLQ
Sbjct  276   SMWVLQ  281



>ref|XP_007025745.1| Secretory carrier 3 isoform 2 [Theobroma cacao]
 gb|EOY28367.1| Secretory carrier 3 isoform 2 [Theobroma cacao]
Length=317

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 209/312 (67%), Gaps = 51/312 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGN---------APGSKSRIPQMVA  1172
             M  R D NPFD+EE+EVNPF++             GG           P S SR+  +  
Sbjct  1     MAGRYDKNPFDEEEEEVNPFADPAVRGKTSGQSKFGGGLFSTNNPTAPPASNSRLSPLPP  60

Query  1171  NTLGFGQKHDATVDIPLDS------LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGA  1010
                GF    +AT+DIPLD+        D K+K+KEL A EA+L+RRE ++KR+E+A A A
Sbjct  61    EPAGFNYDREATIDIPLDTSSGGSHYQDLKRKEKELQAKEAELRRREQEVKRKEEAAARA  120

Query  1009  GVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKG  830
             G+ + +KNWPPFFPIIHHDI NEIP+  Q++QY+AF+++LG+ LCL++NI+AVT  WIKG
Sbjct  121   GIVLEEKNWPPFFPIIHHDIANEIPIHLQRLQYVAFSTFLGLCLCLLWNIIAVTTAWIKG  180

Query  829   DGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaia  650
             +GV+I+ LA+IY + G P +YVLWYRPLY A R  SAL+FGWFF+FYLLHIGFCIFAA+A
Sbjct  181   EGVRIWFLAVIYFIAGVPGAYVLWYRPLYRAFRKESALRFGWFFLFYLLHIGFCIFAAVA  240

Query  649   ppiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLF  470
             PPI+F GKSLTGIL A+D+   H LVG                       IFY VGF LF
Sbjct  241   PPIVFRGKSLTGILPAVDLIDGHALVG-----------------------IFYFVGFALF  277

Query  469   CLEALLSLWVLQ  434
             C+E+++S+WV+Q
Sbjct  278   CVESVVSIWVMQ  289



>ref|XP_006357524.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Solanum tuberosum]
Length=287

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 198/284 (70%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R + NPF  EE EVNPFSN G+ P + +  P  + +    G    ATVDIPLD   D
Sbjct  1     MAGRYNDNPFA-EEDEVNPFSNNGSVPAATNSRPYPLPHEPA-GYDRGATVDIPLDGSKD  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+LK+RE ++KR+EDA+  AGV + DKNWPPFFPIIHHDI NEIP+  
Sbjct  59    MKKKEKELQAKEAELKKREQELKRKEDAITRAGVVIDDKNWPPFFPIIHHDIANEIPIHL  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QY+AF + LG+ +CLV+N+VAVT+ WI+G+G  I+LLA+IY + G P +YVLWYRPL
Sbjct  119   QKLQYVAFTTLLGLAVCLVWNLVAVTLAWIRGEGPTIWLLAVIYLISGVPGAYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+ Y+ HIGFCI AA+APPI F GKSLTGIL AID+   H LVG 
Sbjct  179   YRAMRTDSALKFGWFFLSYVFHIGFCIIAAVAPPIFFKGKSLTGILPAIDLLGWHALVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +G G FCLE L+S+WV+Q
Sbjct  238   ----------------------IFYFIGAGFFCLETLMSIWVIQ  259



>gb|EYU29071.1| hypothetical protein MIMGU_mgv1a013821mg [Erythranthe guttata]
Length=209

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 175/221 (79%), Gaps = 23/221 (10%)
 Frame = -2

Query  1096  KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKM  917
             K +ELAA EADL RRE DI+RRE+AV+GA V    +NWPP FPIIHHDI  EIP+ +QK+
Sbjct  2     KAQELAALEADLNRRETDIRRREEAVSGAVVRTDKRNWPPCFPIIHHDIAKEIPIHAQKL  61

Query  916   QYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNA  737
             QYLAF +WLGIVLCLV+N+VA+TVCWIKG GVKIF LAIIYA +GCPLSYVLWY+PLYNA
Sbjct  62    QYLAFLTWLGIVLCLVFNVVAITVCWIKGGGVKIFFLAIIYAFIGCPLSYVLWYKPLYNA  121

Query  736   MRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             MRT+SAL+FGWFFMFYLLHI FCIFAAIAPP+IF GKSLTGILAAIDVFSD   VG    
Sbjct  122   MRTDSALRFGWFFMFYLLHIAFCIFAAIAPPVIFRGKSLTGILAAIDVFSDSAFVG----  177

Query  556   N*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                IFYLVGFGLFCLE+LLS WVLQ
Sbjct  178   -------------------IFYLVGFGLFCLESLLSFWVLQ  199



>ref|XP_010905287.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Elaeis guineensis]
Length=310

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 206/307 (67%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA-----PGS-----KSRIPQMV  1175
             M  R D NPFD  E+EVNPF++             GG       PGS      SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFADPAGRGKAAGQSSYGGGPFYTTRPGSVPPALNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPLD+  D KKK++EL A EA+L +RE ++KR E+A + AG+ + 
Sbjct  59    PEPADFYNDRSATVDIPLDTAKDLKKKERELQAKEAELNKREKELKRLEEAASRAGIVIE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY AFAS LG+  CL++N VAVTV WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYFAFASLLGLTACLLWNFVAVTVAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY AMRT SALKFG FF+FYLLHIGFCI++A+APPIIF
Sbjct  179   WFLAIIYFISGVPGAYVLWYRPLYRAMRTESALKFGRFFLFYLLHIGFCIYSAVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL AID+ SDHVLVG                       IFY +GFGLFC+E+L
Sbjct  239   KGKSLTGILPAIDLISDHVLVG-----------------------IFYFIGFGLFCVESL  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSVWVIQ  282



>ref|XP_008810165.1| PREDICTED: secretory carrier-associated membrane protein 4-like 
[Phoenix dactylifera]
Length=222

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 185/226 (82%), Gaps = 7/226 (3%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLN-  1109
             MNR  DPNP DDEE +VNPF+       S+SR+P + +  LGFG K+DATV++PLD+ N 
Sbjct  1     MNR--DPNPLDDEE-DVNPFATAAGT-DSRSRLPALPSQPLGFGNKYDATVNVPLDATNV  56

Query  1108  --DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
               D KK+++ELAAWE +LK+RE  I+RREDA+  AG+ + +KNWP FFPIIHHDI  EIP
Sbjct  57    RGDMKKRERELAAWEEELKKREKGIQRREDAMTRAGIMIEEKNWPRFFPIIHHDIGKEIP  116

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             +++Q++QYLAFASWLGIV CL++N++AV VC IKG GVKIF LA IYA++GCPLSYVLWY
Sbjct  117   IQAQRLQYLAFASWLGIVFCLLWNVIAVIVCSIKGGGVKIFFLATIYAMLGCPLSYVLWY  176

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLT  617
             RPLYNAMRT+SA+KFGWFF+ YL+H GFC  AAIAPPI+FHGKSLT
Sbjct  177   RPLYNAMRTDSAVKFGWFFLCYLIHTGFCTLAAIAPPIVFHGKSLT  222



>ref|XP_007148222.1| hypothetical protein PHAVU_006G190200g [Phaseolus vulgaris]
 gb|ESW20216.1| hypothetical protein PHAVU_006G190200g [Phaseolus vulgaris]
Length=309

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 202/311 (65%), Gaps = 57/311 (18%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRI----  1187
             M  R D NPFD+EE  VNPFS                        G  AP + SR+    
Sbjct  1     MAHRYDSNPFDEEE--VNPFSEPAVRGKKSSQSSYSGGAFYTTNPGSVAPTTNSRLSPLN  58

Query  1186  PQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAG  1007
             P+      GFG     TVDIPLD   D KKK+KEL A EA+L+RRE +++R+E+A A AG
Sbjct  59    PEPADYNYGFG-----TVDIPLDPSTDLKKKEKELQAKEAELRRREQEVRRKEEAAARAG  113

Query  1006  VPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGD  827
             + + +KNWPPFFPIIHHDI NEIPV  Q++QY+AF S LG+ LCL +NI+AVT  WIKG 
Sbjct  114   IVLEEKNWPPFFPIIHHDIANEIPVHLQRLQYVAFTSLLGLALCLTWNIIAVTSAWIKGQ  173

Query  826   GVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiap  647
             GVKI+ LAIIY + G P +YVLWYRPLY A RT+SAL +GWFF+FYLLH+GFCI AA+AP
Sbjct  174   GVKIWFLAIIYFIAGIPGAYVLWYRPLYRAFRTDSALNYGWFFLFYLLHLGFCILAAVAP  233

Query  646   piiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFC  467
             PI+F GKS TGILAAIDV  +H L+G                       IFY VGFGLFC
Sbjct  234   PIVFKGKSFTGILAAIDVVGNHTLIG-----------------------IFYFVGFGLFC  270

Query  466   LEALLSLWVLQ  434
             +E L+S+WV+Q
Sbjct  271   IETLISIWVIQ  281



>ref|XP_008672884.1| PREDICTED: LOC100282807 isoform X1 [Zea mays]
 tpg|DAA57364.1| TPA: SC3 protein [Zea mays]
Length=287

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 193/284 (68%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPF  EE +VNPF+ G   P S SR+  +     GF     ATVDIPLDS  D
Sbjct  1     MAGRYDRNPF--EEDDVNPFAGGSVPPASNSRMSALPHEPAGFYNDRGATVDIPLDSTKD  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KK+KEL A EA+L +RE ++KR+E+A A AG+ + DKNWPPF PIIHHDI NEIP+  
Sbjct  59    LSKKEKELQAKEAELNKRERELKRKEEAAARAGIVIEDKNWPPFMPIIHHDISNEIPIHL  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S LG+  CL +NI+A T  WIK +GV I+LLAIIY + G P +YVLWYRPL
Sbjct  119   QRMQYLAFSSLLGLTACLFWNIIATTAAWIKSEGVMIWLLAIIYFISGVPGAYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFF+FYLLHI FC+++A+APP  F GKSL GIL AID+     +VG 
Sbjct  179   YNAMRTESALKFGWFFLFYLLHILFCVWSAVAPPFPFKGKSLAGILPAIDIIGRSAIVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFG+FCLE+LLS+ V+Q
Sbjct  238   ----------------------IFYFIGFGMFCLESLLSIVVIQ  259



>ref|XP_010492493.1| PREDICTED: secretory carrier-associated membrane protein 5 [Camelina 
sativa]
Length=291

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 202/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPFD E+ EVNPF+N G+ P  S S++  +     GFG  +  TVDIPLD   
Sbjct  1     MAGRYDRNPFD-EQDEVNPFANPGSVPAASNSKLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEAELRRREQDVKRKEDAAARAGIVIEAKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRSDSAFSFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSAQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  263



>ref|XP_010458504.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Camelina sativa]
Length=291

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 202/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPFD E+ EVNPF+N  + P  S SR+  +     GFG  +  TVDIPLD   
Sbjct  1     MAGRYDRNPFD-EQDEVNPFANPESVPAASNSRLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+LKRRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEAKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AFA++LG+VL L++NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVRLQRLQYIAFATYLGLVLALLWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRSDSAFSFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSAQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  263



>ref|XP_010476025.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Camelina sativa]
Length=291

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 200/289 (69%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPF  E+ EVNPF+N G+ P  S SR+  +     GFG  +  TVDIPLD   
Sbjct  1     MAGRYDRNPFA-EQDEVNPFANPGSVPAASNSRLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EADL+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEADLRRREQDVKRKEDAAARAGIVIEAKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R +SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRNDSAFSFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSAQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  263



>ref|NP_001149185.1| LOC100282807 [Zea mays]
 gb|ACG34491.1| SC3 protein [Zea mays]
Length=303

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 193/284 (68%), Gaps = 25/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPF  EE +VNPF+ G   P S SR+  +     GF     ATVDIPLDS  D
Sbjct  1     MAGRYDRNPF--EEDDVNPFAGGSVPPASNSRMSALPHEPAGFYNDRGATVDIPLDSTKD  58

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
               KK+KEL A EA+L +RE ++KR+E+A A AG+ + DKNWPPF PIIHHDI NEIP+  
Sbjct  59    LSKKEKELQAKEAELNKRERELKRKEEAAARAGIVIEDKNWPPFMPIIHHDISNEIPIHL  118

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S LG+  CL +NI+A T  WIK +GV I+LLAIIY + G P +YVLWYRPL
Sbjct  119   QRMQYLAFSSLLGLTACLFWNIIATTAAWIKSEGVMIWLLAIIYFISGVPGAYVLWYRPL  178

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFF+FYLLHI FC+++A+APP  F GKSL GIL AID+     +VG 
Sbjct  179   YNAMRTESALKFGWFFLFYLLHILFCVWSAVAPPFPFKGKSLAGILPAIDIIGRSAIVG-  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFG+FCLE+LLS+ V+Q
Sbjct  238   ----------------------IFYFIGFGMFCLESLLSIVVIQ  259



>ref|XP_002888095.1| hypothetical protein ARALYDRAFT_475195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64354.1| hypothetical protein ARALYDRAFT_475195 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/287 (56%), Positives = 201/287 (70%), Gaps = 29/287 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG-GNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSL-  1112
             M  R DPNPF +EE EVNPF+N  G  P S SR+  +    +GF   +  TVDIPL+   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPRGVPPASNSRLSPLPPEPVGF--DYGRTVDIPLERPG  57

Query  1111  -NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
               D KKK+KEL A EA+LKRRE ++KR+EDA A AG+ +  KNWPPFFP+IHHDI NEIP
Sbjct  58    GQDLKKKEKELQAKEAELKRREQELKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIP  117

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             V  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLWY
Sbjct  118   VHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWY  177

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY A RT+SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S   +
Sbjct  178   RPLYRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAI  237

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             VG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   VG-----------------------IFYFIGFAFFCLESVVSIWVIQ  261



>ref|XP_006417383.1| hypothetical protein EUTSA_v10008358mg [Eutrema salsugineum]
 gb|ESQ35736.1| hypothetical protein EUTSA_v10008358mg [Eutrema salsugineum]
Length=291

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 201/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPFD EE EVNPF+N G+ P  S SR+  +     GFG  +  TVDIPLD   
Sbjct  1     MAGRYDRNPFDQEE-EVNPFANPGSVPAASNSRLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEAELRRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IP+  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPIRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLALIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R++SAL FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRSDSALSFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSGQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFAFFCLESVVSIWVIQ  263



>ref|XP_002316646.2| SCAMP37 family protein [Populus trichocarpa]
 gb|EEE97258.2| SCAMP37 family protein [Populus trichocarpa]
Length=306

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 202/304 (66%), Gaps = 46/304 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA-------PGSKSRIPQMVANT  1166
             M  R DPNPFD+EE  VNPFS+             GG A       P S SR+  +    
Sbjct  1     MAGRYDPNPFDEEE--VNPFSDPAVRSKASGQSKYGGRAFNTASAPPASNSRLSPLPPEP  58

Query  1165  LGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKN  986
               F   +  TVDIP+D+  D +KK+KEL A EA+L+RRE ++KRREDA A AG+ + +KN
Sbjct  59    ADF-YNYGNTVDIPIDAPADLRKKEKELQAKEAELRRREQEVKRREDAAARAGIVLEEKN  117

Query  985   WPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLL  806
             WPPFFPIIHHDI NEIPV  QK+QY+AF ++LG+  CL +N+++VT  WIKG GV I+ L
Sbjct  118   WPPFFPIIHHDIANEIPVHLQKIQYVAFTTFLGMAFCLFWNVISVTTLWIKGGGVNIWFL  177

Query  805   AIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGK  626
             ++IY + G P +YVLWYRPLY A RT SA++FGWFFMFY LHIGFCIFAA+APPI+F GK
Sbjct  178   SVIYFIAGVPGAYVLWYRPLYRAFRTESAMRFGWFFMFYALHIGFCIFAAVAPPIVFKGK  237

Query  625   SLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSL  446
             SLTGILAA+DV   H L G                       IFY +GFG FCLE+LLS+
Sbjct  238   SLTGILAAVDVVGKHALAG-----------------------IFYFIGFGCFCLESLLSI  274

Query  445   WVLQ  434
             WV+Q
Sbjct  275   WVIQ  278



>ref|XP_012091529.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X1 [Jatropha curcas]
 gb|KDP20909.1| hypothetical protein JCGZ_21380 [Jatropha curcas]
Length=305

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 203/302 (67%), Gaps = 43/302 (14%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN------------GGN------APGSKSRIPQMVANTLG  1160
             M  R DPNPFD  E+EVNPFS+            GG        P S SR+  +      
Sbjct  1     MAGRYDPNPFD--EEEVNPFSDPAVRGKGQQKFSGGAFYTASAPPASNSRLSPLPPEPAD  58

Query  1159  FGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWP  980
             FG  H ATVDIP+DS  D KKK+KEL A EA+L+RRE D+KRREDA A AG+ + +KNWP
Sbjct  59    FGYDHGATVDIPIDSTTDLKKKEKELQAKEAELRRREQDVKRREDAAARAGIVLEEKNWP  118

Query  979   PFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAI  800
             PFFPIIHHDI NEIP+  Q++QY+AF ++LG+VLCL +NI+A+T  WIKG+GV+I+ LAI
Sbjct  119   PFFPIIHHDIANEIPIHLQRIQYVAFTTYLGLVLCLFWNIIAITTAWIKGEGVRIWFLAI  178

Query  799   IYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSL  620
             IY + G P +YVLWYRPLY A RT SA+KFGWFFMFY++HI FCI AA+APPI F GKS 
Sbjct  179   IYFIAGVPGAYVLWYRPLYRAFRTESAMKFGWFFMFYMVHIAFCIVAAVAPPIFFKGKSF  238

Query  619   TGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWV  440
             TGIL+AIDV  DH LVG+                          +GFG FCLE +LS+WV
Sbjct  239   TGILSAIDVIGDHALVGIFY-----------------------FIGFGFFCLEVVLSIWV  275

Query  439   LQ  434
             LQ
Sbjct  276   LQ  277



>ref|XP_004504993.1| PREDICTED: secretory carrier-associated membrane protein-like 
isoform X2 [Cicer arietinum]
Length=289

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/290 (57%), Positives = 206/290 (71%), Gaps = 35/290 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVA-----NTLGFGQKHDATVDIP  1124
             M  R D NPF   E+EVNPFSN G+ P  + SR+  +       N  GFG+    TVDIP
Sbjct  1     MAGRYDSNPF--AEEEVNPFSNPGSVPPATNSRLAPLKPERADYNNYGFGE----TVDIP  54

Query  1123  LDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVN  944
             LD+  D KKK+KEL + EADL+RRE +++R+E+A A AG+ + +KNWPPFFPIIHHDI N
Sbjct  55    LDTSTDLKKKEKELQSKEADLRRREQEVRRKEEAAARAGIVLEEKNWPPFFPIIHHDIAN  114

Query  943   EIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYV  764
             EIPV  QK+QY+AF + LG+VLCL++N++AVT  WIKG+GVKI+ LAIIY + G P +YV
Sbjct  115   EIPVHLQKLQYVAFTTLLGLVLCLLWNVIAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYV  174

Query  763   LWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSD  584
             LWYRPLY   RT SALKFGWFF+ YL+HIGFCI AA+APPI+F GKSLTGIL+AIDV  +
Sbjct  175   LWYRPLYRTFRTESALKFGWFFLLYLIHIGFCILAAVAPPIVFKGKSLTGILSAIDVIDN  234

Query  583   HVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             H L+G                       IFY VGFGLFCLE L+S+WV+Q
Sbjct  235   HTLIG-----------------------IFYFVGFGLFCLETLISIWVIQ  261



>ref|XP_009104571.1| PREDICTED: secretory carrier-associated membrane protein 3 [Brassica 
rapa]
Length=293

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 205/291 (70%), Gaps = 33/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN--GGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD-  1118
             M  + D NPF  EE+EVNPF+N   G+ P  S SR+  +    +GF   +  TVDIPLD 
Sbjct  1     MANKYDRNPFA-EEEEVNPFANNNSGSVPAASNSRLSPLPPEPVGF--DYGRTVDIPLDN  57

Query  1117  ---SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
                +  + KKK+KEL A EADL+RRE ++KR+EDA A AG+ +  KNWPP FP+IHHDI 
Sbjct  58    DRSASQNLKKKEKELQAKEADLRRREQEVKRKEDAAARAGISIEVKNWPPIFPLIHHDIA  117

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             NEIPV  Q++QY+AFA++LG+VLCL +NI+A+T  WIKG+GV I+LLA+IY + G P  Y
Sbjct  118   NEIPVHLQRLQYVAFATYLGLVLCLFWNIIAITTAWIKGEGVTIWLLALIYFIAGVPGGY  177

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
             VLWYRPLY A RT+SAL FGWFFMFY+LHI FC+FAA+APP++F GKSL GIL A+DV S
Sbjct  178   VLWYRPLYRAFRTDSALSFGWFFMFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAVDVLS  237

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              + LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   GNTLVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  265



>ref|XP_010035696.1| PREDICTED: secretory carrier-associated membrane protein 1 [Eucalyptus 
grandis]
 gb|KCW47136.1| hypothetical protein EUGRSUZ_K00942 [Eucalyptus grandis]
 gb|KCW47137.1| hypothetical protein EUGRSUZ_K00942 [Eucalyptus grandis]
Length=303

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 203/303 (67%), Gaps = 52/303 (17%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPF----------------------SNGGNAPGSKSRIPQMVANTL  1163
             R DPNPF   E+EVNPF                      +N G+ P + SR+  +     
Sbjct  3     RFDPNPF---EEEVNPFADQGGRGKGAGQSNYGGGAFYMTNPGSVPPATSRLSPLPPEPY  59

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
               G    AT+DIPLD+  D K K+KEL A EA+LK+RE ++KRREDA + AG+ + +KNW
Sbjct  60    DRG----ATIDIPLDNAKDIKAKEKELQAKEAELKKREQELKRREDAASRAGIVIEEKNW  115

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI NEIP+  QK+QY+AF ++LG+VLCL++NIVAVT  WIKG+G  I+ LA
Sbjct  116   PPFFPIIHHDIPNEIPIHLQKIQYVAFTTYLGLVLCLLWNIVAVTTAWIKGEGPTIWFLA  175

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P +YVLWYRPLY AMRT+SALKFGWFF FYL+H+GFCIFA +APPIIF GKS
Sbjct  176   IIYFISGVPGAYVLWYRPLYRAMRTDSALKFGWFFFFYLIHLGFCIFACVAPPIIFKGKS  235

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             LTGIL AID+ + H LVG                       IFYLVGF  FC+E+LLS+W
Sbjct  236   LTGILPAIDLLTGHALVG-----------------------IFYLVGFAFFCIESLLSVW  272

Query  442   VLQ  434
             VLQ
Sbjct  273   VLQ  275



>ref|XP_002881402.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=274

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 203/287 (71%), Gaps = 44/287 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQE---VNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDS  1115
             M+R +DPNPF++EE+E   VNPF  G    G   R+P   +  LGFG    +TV IPLD 
Sbjct  1     MSRHHDPNPFNEEEEEEEIVNPFLKGA---GGVGRVPAS-SRPLGFGSNLYSTVHIPLDR  56

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             +ND   KQ EL+ WEA L+ REMD+KRRE+A++ +GV ++DKNWP FFPIIHH   NEIP
Sbjct  57    VND--SKQIELSDWEAQLRNREMDVKRRENAISKSGVQINDKNWPSFFPIIHH---NEIP  111

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
             + +QK+QYLAFASWLG+V CL++N++AV VCWI+G G  IF LA IYA +GCP+SYVLWY
Sbjct  112   LHAQKLQYLAFASWLGLVFCLIFNVIAVIVCWIEGAGGYIFFLATIYAFLGCPVSYVLWY  171

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             +PLY AMRT+SALKFGWFF FYL+HIGFCIFAAIAPPIIF G+SLTG+LAAID       
Sbjct  172   KPLYLAMRTDSALKFGWFFFFYLIHIGFCIFAAIAPPIIFDGQSLTGVLAAID-------  224

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                      IFY  GFG FC+E+LLSLWVLQ
Sbjct  225   -------------------------IFYFAGFGFFCMESLLSLWVLQ  246



>ref|XP_011622325.1| PREDICTED: secretory carrier-associated membrane protein 1 isoform 
X1 [Amborella trichopoda]
Length=310

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 207/307 (67%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M RR D NPFD  E++VNPF++                       G   P + SR+  + 
Sbjct  1     MARRYDSNPFD--EEDVNPFADPTLRNKASGQSNYGGGPFYTTHPGSVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPLDS  D KKK+KEL A EA+LKRRE ++KRREDA A AG+ + 
Sbjct  59    PEPADFNYDRGATVDIPLDSAKDLKKKEKELQAKEAELKRREQELKRREDAAARAGIVIE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q+MQY AFA+ LG+V+CL +N +A+T+ W++G GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRMQYFAFATLLGLVICLGWNFIAITIGWVRGLGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + L+IIY + G P +YVLWYRPLY AMRT+SALKFGWFF FYLLHIGFC+FA++APP++F
Sbjct  179   WFLSIIYFIAGVPGAYVLWYRPLYRAMRTDSALKFGWFFFFYLLHIGFCLFASVAPPVVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
             HGKSLTGIL AIDVF  HVLVG                       IFYL+GFG F LE+L
Sbjct  239   HGKSLTGILPAIDVFGGHVLVG-----------------------IFYLIGFGFFVLESL  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSIWVIQ  282



>emb|CDY52219.1| BnaA01g35910D [Brassica napus]
Length=293

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 204/291 (70%), Gaps = 33/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN--GGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD-  1118
             M  + D NPF  EE+EVNPF+N   G+ P  S SR+  +     GF   +  TVDIPLD 
Sbjct  1     MANKYDRNPFA-EEEEVNPFANNNSGSVPAASNSRLSPLPPEPAGF--DYGRTVDIPLDN  57

Query  1117  ---SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
                +  + KKK+KEL A EADL+RRE ++KR+EDA A AG+ +  KNWPP FP+IHHDI 
Sbjct  58    DRSASQNLKKKEKELQAKEADLRRREQEVKRKEDAAARAGISIEVKNWPPIFPLIHHDIA  117

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             NEIPV  Q++QY+AFA++LG+VLCL +NI+A+T  WIKG+GV I+LLA+IY + G P  Y
Sbjct  118   NEIPVHLQRLQYVAFATYLGLVLCLFWNIIAITTAWIKGEGVTIWLLALIYFIAGVPGGY  177

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
             VLWYRPLY A RT+SAL FGWFFMFY+LHI FC+FAA+APP++F GKSL GIL A+DV S
Sbjct  178   VLWYRPLYRAFRTDSALSFGWFFMFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAVDVLS  237

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              + LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   GNTLVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  265



>ref|XP_006392026.1| hypothetical protein EUTSA_v10023622mg [Eutrema salsugineum]
 gb|ESQ29312.1| hypothetical protein EUTSA_v10023622mg [Eutrema salsugineum]
Length=291

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 202/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLDS--  1115
             M  R DPNPF +EE EVNPF+N G+  P S SR+  +    +GF   +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPGSIPPASNSRLSPLPPEPVGF--SYGRTVDIPLDGGR  57

Query  1114  --LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+L+RRE ++KR+EDA A AGV +  KNWPPFFP+IHHDI NE
Sbjct  58    SGTQDLKKKEKELQAKEAELRRREQELKRKEDAAARAGVVIEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+ FA++LG+V+CL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVHLQRLQYVTFATYLGLVVCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT+SAL FG FF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S +
Sbjct  178   WYRPLYRAFRTDSALSFGGFFVFYMLHILFCVFAAVAPPVVFKGKSLAGILPAIDVLSGN  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   TLVG-----------------------IFYFIGFAFFCLESVVSIWVIQ  263



>ref|NP_001241001.1| uncharacterized protein LOC100795535 [Glycine max]
 gb|ACU18714.1| unknown [Glycine max]
 gb|KHN10307.1| Secretory carrier-associated membrane protein [Glycine soja]
Length=288

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 203/285 (71%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD  E+EVNPF N G+ P  + SR+  +    + +     ATVDIPLDS  
Sbjct  1     MAGRYDSNPFD--EEEVNPFYNPGSVPAATNSRLSPLKPEPVDYNYGFGATVDIPLDSST  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+KEL A E +L++RE +++RRE+A + AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DLKKKEKELQAKETELRKREQEVRRREEAASRAGIVLEEKNWPPFFPIIHHDIANEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QY+AF + LG+VLCL +N++AVT  WIKG+GVKI+ LAIIY + G P +YVLWYRP
Sbjct  119   LQKLQYVAFTTLLGLVLCLFWNVIAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A R  SALKFGWFFMFYLLHIGFCI AA+APPI+F GKSLTGILAAIDV  DH L+G
Sbjct  179   LYRAFRNESALKFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILAAIDVLGDHALIG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFC+E L+S+WV+Q
Sbjct  239   -----------------------IFYFIGFGLFCVETLISIWVIQ  260



>gb|KDO75796.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
Length=343

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 210/340 (62%), Gaps = 81/340 (24%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA----------PGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS+             GG            P + SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPAVRGKSSGQSRFGGGGFFTTNSASVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                 GF  + DA +DIPLD+  D KKK+KEL A EA+L+RRE D++R+E+A A AG+ + 
Sbjct  59    HEPAGFNFERDAPIDIPLDTAADLKKKEKELQAKEAELRRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AFA++LG+ LCL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFATYLGLFLCLLWNIVAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAM---------------------------------  734
             + LAIIY + G P +YVLWYRPLY A                                  
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFSFKRDCSDRVIADQLALNLVSFLVFLSHYKPSC  238

Query  733   RTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN  554
             RT SA+KFGWFF+FYLLHIGFCIFA++APPIIF GKSLTG+L A+DV  DH LVG     
Sbjct  239   RTESAMKFGWFFLFYLLHIGFCIFASVAPPIIFKGKSLTGVLPAVDVMGDHALVG-----  293

Query  553   *HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                               IFY +GFGLFCLE+L+S+WV+Q
Sbjct  294   ------------------IFYFIGFGLFCLESLVSIWVIQ  315



>ref|XP_002521417.1| secretory carrier membrane protein, putative [Ricinus communis]
 gb|EEF40907.1| secretory carrier membrane protein, putative [Ricinus communis]
Length=308

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 205/305 (67%), Gaps = 45/305 (15%)
 Frame = -2

Query  1288  IMNRRNDPNPFDDEEQEVNPFSN--------------GGN------APGSKSRIPQMVAN  1169
             +  R NDPNPFD  E+EVNPFS+              GG        P S SR+  +   
Sbjct  1     MAGRHNDPNPFD--EEEVNPFSDPVVRGKASSQQKFSGGAFYTASAPPPSNSRLSPLPPE  58

Query  1168  TLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDK  989
                FG  H ATVDIP+DS  D +KK+KEL A EA+L+RRE D+KRREDA A AG+ + +K
Sbjct  59    PADFGYDHGATVDIPIDSATDLRKKEKELQAKEAELRRREQDVKRREDAAARAGIVLEEK  118

Query  988   NWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFL  809
             NWPPFFPIIHHDI NEIP+  Q++QY+AF ++LG+VLCL +NI+AVT  WIKG+GVKI+ 
Sbjct  119   NWPPFFPIIHHDIANEIPIHLQRIQYVAFTTFLGLVLCLFWNIIAVTTAWIKGEGVKIWF  178

Query  808   LAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHG  629
             LA+IY + G P +Y+LWYRPLY A R  SALKFGWFF+FYL+H+GFCI AA+APPIIF G
Sbjct  179   LAVIYFIAGVPGAYILWYRPLYRAFRNESALKFGWFFLFYLVHLGFCILAAVAPPIIFKG  238

Query  628   KSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLS  449
             KS TGIL+AIDV  DH LVG+                          +GFG FCLE +LS
Sbjct  239   KSFTGILSAIDVVGDHALVGIFY-----------------------FIGFGFFCLELVLS  275

Query  448   LWVLQ  434
             +WVLQ
Sbjct  276   IWVLQ  280



>emb|CDY03815.1| BnaC01g29320D [Brassica napus]
Length=294

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 204/291 (70%), Gaps = 33/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG--GNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD-  1118
             M  + D NPF +EE EVNPF+N   G+ P  S SR+  +    +GF   +  TVDIPLD 
Sbjct  1     MANQYDRNPFAEEE-EVNPFANNNTGSVPAASNSRLSPLPPEPVGF--DYGRTVDIPLDN  57

Query  1117  ---SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
                +  +  KK+KEL A EADL+RRE ++KR+EDA A AG+ +  KNWPP FP+IHHDI 
Sbjct  58    DRSASQNLNKKEKELQAKEADLRRREQEVKRKEDAAARAGITIEVKNWPPIFPLIHHDIA  117

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             NEIPV  Q++QY+AFA++LG+VLCL +NI+A+T  WIKG+GV I+LLA+IY + G P  Y
Sbjct  118   NEIPVHLQRLQYVAFATYLGLVLCLFWNIIAITTAWIKGEGVTIWLLALIYFIAGVPGGY  177

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
             VLWYRPLY A RT+SAL FGWFFMFY+LHI FC+FAA+APP++F GKSL GIL A+DV S
Sbjct  178   VLWYRPLYRAFRTDSALSFGWFFMFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAVDVLS  237

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              + LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   GNTLVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  265



>ref|XP_002889854.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66113.1| secretory carrier membrane protein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=288

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 197/285 (69%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD E+ EVNPF+N G+ P  S SR+  +     GF    D  +D P     
Sbjct  1     MAGRYDRNPFD-EQDEVNPFANPGSVPSASNSRLSPLPPEPAGFAY-GDIPLDRPGSGTQ  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NEIPV 
Sbjct  59    DLKKKEKELQAKEAELRRREQDLKRKEDAAARAGIVIEAKNWPPFFPLIHHDIANEIPVR  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLWYRP
Sbjct  119   LQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S   LVG
Sbjct  179   LYRAFRSDSAFNFGWFFLFYMLHILFCVFAAVAPPIVFKGKSLAGILPAIDVLSAQALVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE+++S+WV+Q
Sbjct  239   -----------------------IFYFIGFGLFCLESVVSIWVIQ  260



>ref|XP_003593476.1| Secretory carrier-associated membrane protein [Medicago truncatula]
 gb|AES63727.1| secretory carrier-associated membrane protein [Medicago truncatula]
Length=280

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 207/301 (69%), Gaps = 44/301 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRI----PQMVANTLGFGQKHDATVDIPL  1121
             M  R D NPFD+E+  VNPFSN GG AP + SR     P+      GFGQ    TVDIPL
Sbjct  1     MAGRYDSNPFDEEQ--VNPFSNSGGVAPATNSRPAPLNPERAGYNYGFGQ----TVDIPL  54

Query  1120  DSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
             D+  D KKK++EL A EA+L++RE +++R+E+A++ AG+ + +KNWPPFFPIIHHDI NE
Sbjct  55    DASTDVKKKERELQAKEAELRKREQEVRRKEEAISRAGIVIEEKNWPPFFPIIHHDIANE  114

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+AF S LG+VLCL +N+VAVT  WIKG+GVKI+ LAIIY + G P +YVL
Sbjct  115   IPVHLQRLQYVAFFSLLGLVLCLTWNVVAVTAAWIKGEGVKIWFLAIIYFIAGVPGAYVL  174

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             W         T+SA+KFGWFF+FYLLH+GFCI AA+APPI+F GKSLTGIL+AIDV  D+
Sbjct  175   W---------TDSAIKFGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAIDVIGDY  225

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHSH  404
              ++G                       IFY +GFGLFCLE L+S+WV+ QV  Y  G   
Sbjct  226   TIIG-----------------------IFYFIGFGLFCLETLISVWVIQQVYMYFRGGGK  262

Query  403   T  401
             T
Sbjct  263   T  263



>ref|XP_011043254.1| PREDICTED: secretory carrier-associated membrane protein 3 [Populus 
euphratica]
Length=306

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 201/304 (66%), Gaps = 46/304 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA-------PGSKSRIPQMVANT  1166
             M  R DPNPFD  E+EVNPFS+             GG A       P S SR+  +    
Sbjct  1     MAGRYDPNPFD--EEEVNPFSDPAVRSKASGQSKYGGRAFNTASAPPASNSRLSPLPPEP  58

Query  1165  LGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKN  986
               F   +  TVDIP+D+  D +KK+KEL A EA+L+RRE ++KR+EDA A AG+ + +KN
Sbjct  59    ADF-YNYGNTVDIPIDAPADLRKKEKELQAKEAELRRREQEVKRKEDAAARAGIVLEEKN  117

Query  985   WPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLL  806
             WPPFFPIIHHDI NEIPV  QK+QY+AF ++LG+  CL +N+++VT  WIKG GV I+ L
Sbjct  118   WPPFFPIIHHDIANEIPVHLQKLQYVAFTTFLGMTFCLFWNVISVTTLWIKGGGVNIWFL  177

Query  805   AIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGK  626
             A+IY + G P +Y LWYRPLY A RT SA++FGWFFMFY LHIGFCIFAA+APPI+F GK
Sbjct  178   AVIYFIAGVPGAYFLWYRPLYRAFRTESAMRFGWFFMFYALHIGFCIFAAVAPPIVFKGK  237

Query  625   SLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSL  446
             SLTGILAA+DV   + L G                       IFY +GFG FCLE+LLS+
Sbjct  238   SLTGILAAVDVVGKNALAG-----------------------IFYFIGFGCFCLESLLSI  274

Query  445   WVLQ  434
             WV+Q
Sbjct  275   WVIQ  278



>ref|XP_011027922.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Populus euphratica]
Length=306

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 202/304 (66%), Gaps = 46/304 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN--------------------GGNAPGSKSRIPQMVANT  1166
             M  R DPNPFD+EE  VNPFS+                     G  P S SR+  +    
Sbjct  1     MAARYDPNPFDEEE--VNPFSDPAVRSKASGQSNYSGSAFNTTGVPPASNSRLSPLPPEP  58

Query  1165  LGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKN  986
              GF   +  TVDIP+D+  D +KK+KEL A EA+L RRE ++KR EDA A AGV + +KN
Sbjct  59    AGF-YNYGTTVDIPIDAAADLRKKEKELQAREAELIRREKEVKRLEDAAARAGVVLEEKN  117

Query  985   WPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLL  806
             WPPFFPIIHHD+ NEIPV  QK+QY+AF ++LG+  CL +N++AVT  WI+G+GVKI+ L
Sbjct  118   WPPFFPIIHHDVANEIPVHLQKIQYVAFTTFLGLTFCLFWNVIAVTTAWIQGEGVKIWFL  177

Query  805   AIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGK  626
             ++IY + G P +Y LWYRPLY A RT SA++FGWFF+FY+LHIGFCIFAA+APPI+F GK
Sbjct  178   SVIYFISGVPGAYFLWYRPLYRAFRTESAMRFGWFFLFYVLHIGFCIFAAVAPPIVFKGK  237

Query  625   SLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSL  446
             SLTGILAA+DV  ++ + G                       IFY +GFG FCLE+LLS+
Sbjct  238   SLTGILAAVDVVGNNSIAG-----------------------IFYFIGFGCFCLESLLSI  274

Query  445   WVLQ  434
             WV+Q
Sbjct  275   WVIQ  278



>dbj|BAJ86707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 195/277 (70%), Gaps = 30/277 (11%)
 Frame = -2

Query  1264  NPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKE  1085
             N F+D++  VNPF+ G   P S SR+  +     GF       VDIP+DS  D KKK+KE
Sbjct  5     NGFEDDD--VNPFAGGSVPPASNSRLSPLSHEPAGF-----YNVDIPMDSTKDVKKKEKE  57

Query  1084  LAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLA  905
             L A EA+L +RE ++KR+E+A + AG+ + DKNWPPFFP+IHH+I NEIP+  QKMQYLA
Sbjct  58    LQAMEAELNKREKELKRKEEAASRAGIVIEDKNWPPFFPLIHHNISNEIPIHLQKMQYLA  117

Query  904   FASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTN  725
             F+S+LGI LCL +NI+A T  WIKG+GV ++LLAIIY + G P +YVLWYRPLYNAMRT 
Sbjct  118   FSSFLGIALCLFFNIIATTTAWIKGEGVMVWLLAIIYFISGVPGAYVLWYRPLYNAMRTE  177

Query  724   SALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HL  545
             SALKFGWFF+FY++HI FC+++A++PP  F G SLTGIL AIDV +  ++VG        
Sbjct  178   SALKFGWFFLFYMIHIIFCVWSAVSPPFPFKGNSLTGILPAIDVITKSLIVG--------  229

Query  544   PSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                            IFY VGFGLFCLE+LLS+ V+Q
Sbjct  230   ---------------IFYFVGFGLFCLESLLSIGVIQ  251



>ref|XP_004485722.1| PREDICTED: secretory carrier-associated membrane protein-like 
[Cicer arietinum]
Length=291

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 218/302 (72%), Gaps = 35/302 (12%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRI----PQMVANTLGFGQKHDATVDIPL  1121
             M  R D NPFD+EEQ VNPFSN G+ AP + SR+    P+ V    GFG    ATVDIPL
Sbjct  1     MAGRYDSNPFDEEEQ-VNPFSNSGSVAPVTNSRLAPLNPEPVDYNYGFG----ATVDIPL  55

Query  1120  DSL-NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVN  944
             DS  ND KKK+KEL A EA+L+RRE +++R+E+A++ AG+ + +KNWPPFFPIIHHDI N
Sbjct  56    DSSSNDVKKKEKELQAKEAELRRREQELRRKEEAISRAGIVIEEKNWPPFFPIIHHDIPN  115

Query  943   EIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYV  764
             EIP+  Q++QY+AF+S LG+VLCL +N++AVT  WIKG+GVKI+ LAIIY + G P +YV
Sbjct  116   EIPIHLQRLQYVAFSSLLGLVLCLTWNVIAVTSAWIKGEGVKIWFLAIIYFIAGVPGAYV  175

Query  763   LWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSD  584
             LWYRPLY A RT+SA+KFG FF+FYLLH+GFCI AA+APPI+F GKSLTGIL+AIDV  D
Sbjct  176   LWYRPLYRAFRTDSAIKFGRFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAIDVIGD  235

Query  583   HVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHS  407
             H L+G                       IFY VGFGLFCLE L+S+WV+ QV  Y  G  
Sbjct  236   HTLIG-----------------------IFYFVGFGLFCLETLISVWVIQQVYMYFRGGG  272

Query  406   HT  401
              T
Sbjct  273   KT  274



>ref|XP_010268786.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Nelumbo nucifera]
Length=288

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 206/285 (72%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R DPNPF  EE++VNPF++ GN P  + SR+  +      F     ATVDIPLD+  
Sbjct  1     MAGRYDPNPF--EEEDVNPFASPGNVPSATNSRLSPLPPEPADFSYGRGATVDIPLDAEK  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D K+++KEL A EA+L++RE ++KRREDA+A AG+ + +KNWPPFFP+IHHDI NEIP+ 
Sbjct  59    DLKRREKELEAKEAELRKREQELKRREDAIARAGIVIEEKNWPPFFPLIHHDIANEIPLH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QY+AF S LG+  CL++NIVAVT  WIKG+GVKI+ L+IIY + G P  YVLWYRP
Sbjct  119   LQKLQYVAFTSLLGLFACLLWNIVAVTTAWIKGEGVKIWFLSIIYFITGVPGGYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRT+SALKFGWFF+FYL+HIGFCIF+A+APPIIF GKSLTGIL AID+ S + LVG
Sbjct  179   LYRAMRTDSALKFGWFFLFYLVHIGFCIFSAVAPPIIFKGKSLTGILPAIDLISGNALVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             V                       FY +GF LF +E+L+S+WV+Q
Sbjct  239   V-----------------------FYFIGFALFTIESLMSVWVIQ  260



>gb|KHN08571.1| Secretory carrier-associated membrane protein 1 [Glycine soja]
Length=310

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 199/307 (65%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPFD+EE  VNPFS                        G  AP + SR+  + 
Sbjct  1     MAHRYDSNPFDEEE--VNPFSEPAVRGKTSSQSSYSGGAFYTTNPGSVAPATNSRLSPLN  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  +     ATVDI LD   D KKK+KEL A E +L++RE +++R+E+A A AG+ + 
Sbjct  59    PEPADYNYGFGATVDIRLDPSMDLKKKEKELQAKENELRKREQEVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AF S LG  LC+ +NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFTSLLGFALCITWNIVAVTSAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A RT+SAL FGWFF+FYLLH+GFCI AA+APPI+F
Sbjct  179   WFLAIIYFIAGIPGAYVLWYRPLYRAFRTDSALNFGWFFLFYLLHLGFCILAAVAPPIVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL+AIDV  +H ++G                       IFY VGFGLFC+E L
Sbjct  239   KGKSLTGILSAIDVVGNHAVIG-----------------------IFYFVGFGLFCIETL  275

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  276   ISVWVIQ  282



>ref|XP_009416073.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=310

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 207/306 (68%), Gaps = 46/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPF---------------------SNGGNAPG-SKSRIPQMVA  1172
             M  R D NPFD EE++VNPF                     +N GN P  SK R+  +  
Sbjct  1     MAGRYDRNPFD-EEEDVNPFADPGVRGKAAGSNYGGGSFYMTNPGNVPPVSKPRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F     ATVDIPLD+  D KKK+KEL A EA+L RRE +IKRRE+A A AG+ + D
Sbjct  60    EPADFHNDRGATVDIPLDTEKDLKKKEKELQAKEAELNRREKEIKRREEAAARAGIIIED  119

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDIVNEIPV  Q++QY AFAS +G+  CL +NIVA T  WIKG+GVKI+
Sbjct  120   KNWPPFFPIIHHDIVNEIPVHLQRLQYFAFASLIGLTACLFWNIVATTAAWIKGEGVKIW  179

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              LAIIY + G P +YVLWYRPLY AMRT+SAL +GWFF+FYLLHIGF +++A+APP+IFH
Sbjct  180   FLAIIYFISGVPGAYVLWYRPLYRAMRTDSALNYGWFFLFYLLHIGFVVYSAVAPPLIFH  239

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+ S+ VLVG                       IFYLVGFGLFC+E+LL
Sbjct  240   GKSLTGILPAVDLISEDVLVG-----------------------IFYLVGFGLFCIESLL  276

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  277   SIWVMQ  282



>ref|XP_007132643.1| hypothetical protein PHAVU_011G112500g [Phaseolus vulgaris]
 gb|ESW04637.1| hypothetical protein PHAVU_011G112500g [Phaseolus vulgaris]
Length=303

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 206/300 (69%), Gaps = 46/300 (15%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG-------------------GNAPGSKSRIPQMVANTLGFG  1154
             R DPNPF++E+ EVNPF++G                   GN P + SR+  +       G
Sbjct  3     RYDPNPFEEEDVEVNPFADGQAKGKGSSYSGGAFYTTNSGNVPSANSRLSPLPPEPYDRG  62

Query  1153  QKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPF  974
                 AT+DIPLDS  D K K+KEL A EADLKRRE ++KRREDA++ AG+ + +KNWPPF
Sbjct  63    ----ATIDIPLDSSKDVKAKEKELQAREADLKRREQELKRREDAISRAGIVIEEKNWPPF  118

Query  973   FPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIY  794
             FPIIHHDI  EIP+  Q++QY+AF++WLG+VLCLV+NIVAVT  WIKG+G  I+ LAIIY
Sbjct  119   FPIIHHDIGKEIPIHLQRIQYIAFSTWLGLVLCLVWNIVAVTTAWIKGEGPTIWFLAIIY  178

Query  793   ALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTG  614
              + G P SYVLWYRPLY AMRT+SALKFGWFF+ Y++HI FCIFAA+APPIIF GKSLTG
Sbjct  179   FISGAPGSYVLWYRPLYRAMRTDSALKFGWFFLVYVIHIAFCIFAAVAPPIIFKGKSLTG  238

Query  613   ILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             ILAAIDV  D+ LVG+                          +GFG FCLE++LS+WV+Q
Sbjct  239   ILAAIDVLGDNALVGIFY-----------------------FIGFGFFCLESVLSIWVIQ  275



>emb|CBI18594.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 197/284 (69%), Gaps = 39/284 (14%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M RR DPNPFD+EE  VNPFS+    P  + +     +   G G  +        +  +D
Sbjct  1     MARRYDPNPFDEEE--VNPFSD----PAVRGK----TSTNYGGGAFYTT------NPGSD  44

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK++EL A EA+L++RE ++KR+EDA A AG+ + +KNWPPFFPIIHHDI NEIP+  
Sbjct  45    LKKKERELQAKEAELRKREQEVKRKEDAAARAGIVLEEKNWPPFFPIIHHDIANEIPIHL  104

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QY+AF ++LG+  CL +NI+A T  WIKG+GVKI+ LAIIY + G P +YVLWYRPL
Sbjct  105   QKLQYVAFTTFLGLACCLTWNIIATTTAWIKGEGVKIWFLAIIYFIAGVPGAYVLWYRPL  164

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y A R  SALKFGWFFMFYLLHI FCIFAA+APP+IFHGKSLTGIL A+D+  DHVLVG 
Sbjct  165   YRAFRNESALKFGWFFMFYLLHIAFCIFAAVAPPVIFHGKSLTGILPAVDLIGDHVLVG-  223

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFG+FC+E++LS+WV+Q
Sbjct  224   ----------------------IFYFIGFGMFCVESVLSIWVIQ  245



>gb|AFW59324.1| hypothetical protein ZEAMMB73_850428 [Zea mays]
Length=214

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 172/227 (76%), Gaps = 23/227 (10%)
 Frame = -2

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             + D + K KEL++WE+DLKRRE DIKRRE+A+  AGVP+ +KNWPPFFPIIHHDI NEIP
Sbjct  1     MGDSRSKVKELSSWESDLKRREADIKRREEALKNAGVPMEEKNWPPFFPIIHHDIANEIP  60

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
                QK+QYLAFASWLGIVLCL +N VAV VCWIK    K+F LA IYAL+G PLSY++WY
Sbjct  61    ANVQKLQYLAFASWLGIVLCLSWNFVAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWY  120

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV+
Sbjct  121   RPLYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVI  180

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +G                       IFY VGF LFCLE LLS+ VLQ
Sbjct  181   IG-----------------------IFYFVGFALFCLETLLSIGVLQ  204



>gb|EMT26496.1| Secretory carrier-associated membrane protein 6 [Aegilops tauschii]
Length=220

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 178/227 (78%), Gaps = 7/227 (3%)
 Frame = -2

Query  1114  LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIP  935
             + D   K +EL++WE+DL+RRE DIKRRE+++  AGVP+ +KNWPPFFPIIHHDI NEIP
Sbjct  1     MGDSNGKARELSSWESDLRRREADIKRREESLKNAGVPMEEKNWPPFFPIIHHDIANEIP  60

Query  934   VESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWY  755
                QK+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WY
Sbjct  61    ANVQKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLMWY  120

Query  754   RPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVL  575
             RPLY AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+F GKSLTGILAAID FS+H++
Sbjct  121   RPLYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFQGKSLTGILAAIDTFSEHLI  180

Query  574   VGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +GV       P +  +F  H+  L IFY VGF LFCLE LLS+ VLQ
Sbjct  181   IGVRTL---FPRT--LFPSHL--LAIFYFVGFALFCLETLLSIGVLQ  220



>ref|XP_008455345.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Cucumis melo]
Length=283

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 200/283 (71%), Gaps = 32/283 (11%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGG--NAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDP  1103
             R D NPFD   ++VNPFSN G  + P + +R+  +   T   G    AT+DIPLD+  D 
Sbjct  3     RYDSNPFD---EDVNPFSNPGVGSVPPANTRLSPLPPETYDRG----ATIDIPLDNGKDL  55

Query  1102  KKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQ  923
             K K+KEL A EA+LK+RE D+KRREDA++ AG+ + +KNWPPFFP+IHHDI NEIP+  Q
Sbjct  56    KAKEKELQAKEAELKKREQDLKRREDAISRAGIVIEEKNWPPFFPLIHHDIANEIPIHLQ  115

Query  922   KMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLY  743
              +QY+AF + LG+V+CL +NIVAVTV WIKG+G  I+ LAIIY + G P +YV WYRPLY
Sbjct  116   NIQYVAFTTLLGLVVCLSWNIVAVTVAWIKGEGPTIWFLAIIYFISGVPGAYVGWYRPLY  175

Query  742   NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVS  563
              A RT+SALKFGWFF+ YL+HIGFC+F+A+APPIIF GKSLTGIL AID+ S + LVG  
Sbjct  176   RATRTDSALKFGWFFLVYLIHIGFCVFSAVAPPIIFKGKSLTGILPAIDLLSSNALVG--  233

Query  562   CCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                  IFY +GF  FC+E+L+S+WV+Q
Sbjct  234   ---------------------IFYFIGFAFFCIESLISIWVIQ  255



>gb|ACU54988.1| secretory carrier membrane protein [Triticum aestivum]
Length=279

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 194/277 (70%), Gaps = 30/277 (11%)
 Frame = -2

Query  1264  NPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKE  1085
             N F+D++  VNPF+ G   P S SR+  +     GF       VDIP+DS  D KKK+KE
Sbjct  5     NGFEDDD--VNPFAGGSVPPASNSRLSPLSHEPAGF-----YNVDIPMDSTKDVKKKEKE  57

Query  1084  LAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLA  905
             L   EA+L +RE ++KR+E+A + AG+ + DKNWPPFFP+IHH+I NEIP+  QKMQYLA
Sbjct  58    LQVMEAELNKREKELKRKEEAASRAGIVIEDKNWPPFFPLIHHNISNEIPIHLQKMQYLA  117

Query  904   FASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTN  725
             F+S+LGI LCL +NI+A T  WIKG+GV ++LLAIIY + G P +YVLWYRPLYNAMRT 
Sbjct  118   FSSFLGIALCLFFNIIATTTAWIKGEGVMVWLLAIIYFISGVPGAYVLWYRPLYNAMRTE  177

Query  724   SALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HL  545
             SALKFGWFF+FY++HI FC+++A++PP  F G SLTGIL AIDV +  ++VG        
Sbjct  178   SALKFGWFFLFYMIHIIFCVWSAVSPPFPFKGNSLTGILPAIDVITKSLIVG--------  229

Query  544   PSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                            IFY VGFGLFCLE+LLS+ V+Q
Sbjct  230   ---------------IFYFVGFGLFCLESLLSIGVIQ  251



>ref|XP_006647732.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Oryza brachyantha]
Length=217

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 173/236 (73%), Gaps = 24/236 (10%)
 Frame = -2

Query  1111  NDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPV  932
              D K K KEL  WE+DLKRRE DI+RRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP 
Sbjct  5     EDSKGKGKELLQWESDLKRREADIRRREEALKSAGVPMEDKNWPPFFPIIHHDIANEIPA  64

Query  931   ESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYR  752
              +QK+QYLAFASWLGIVLCL +N +AV VCWI+G   K+F LA IY ++G PLSY++WYR
Sbjct  65    NAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGTPLSYLMWYR  124

Query  751   PLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLV  572
             PLY AMRT+SA  FGWFF+ Y+LHI FC+FAAIAPP+IF GKSLTGILAAID FSDH +V
Sbjct  125   PLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILAAIDTFSDHAIV  184

Query  571   GVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ-VCDYKNGHS  407
             G                       IFY VGF LFCLE L+S+WVLQ V  Y  GH 
Sbjct  185   G-----------------------IFYFVGFALFCLETLVSIWVLQKVYMYFRGHK  217



>ref|XP_004136814.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Cucumis sativus]
 gb|KGN43588.1| hypothetical protein Csa_7G047240 [Cucumis sativus]
Length=283

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 199/283 (70%), Gaps = 32/283 (11%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGG--NAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDP  1103
             R D NPFD   ++VNPFSN G  + P + SR+  +   T   G    AT+DIPLD+  D 
Sbjct  3     RYDSNPFD---EDVNPFSNPGVGSVPPANSRLSPLPPETYDRG----ATIDIPLDNGKDL  55

Query  1102  KKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQ  923
             K K+KEL A EA+LK+RE D+KRREDA++ AG+ + +KNWPPFFP+IHHDI NEIP+  Q
Sbjct  56    KAKEKELQAKEAELKKREQDLKRREDAISRAGIVIEEKNWPPFFPLIHHDIANEIPIHLQ  115

Query  922   KMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLY  743
              +QY+AF + LG+V+CL +NIVAVT  WIKG+G  I+ LAIIY + G P +YV WYRPLY
Sbjct  116   NIQYVAFTTLLGLVVCLSWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVGWYRPLY  175

Query  742   NAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVS  563
              A RT+SALKFGWFF+ YL+HIGFC+F+A+APPIIF GKSLTGIL AID+ S + LVG  
Sbjct  176   RATRTDSALKFGWFFLVYLIHIGFCVFSAVAPPIIFKGKSLTGILPAIDLLSSNALVG--  233

Query  562   CCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                  IFY +GF  FC+E+L+S+WV+Q
Sbjct  234   ---------------------IFYFIGFAFFCIESLISIWVIQ  255



>ref|XP_011086081.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Sesamum indicum]
 ref|XP_011086082.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Sesamum indicum]
Length=310

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 201/307 (65%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-----------------------APGSKSRIPQMV  1175
             M  R D NPFD EE EVNPF++GG                         P + SR+  + 
Sbjct  1     MAGRYDRNPFD-EEDEVNPFADGGGRGKASGQSKFGGGPFYTTATGSVPPVTNSRLSPLP  59

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     A VDIPLDS  D K+K++EL A EA+LKRRE D++R+E+A A AG+ + 
Sbjct  60    PEPADF-YNPTAPVDIPLDSAADLKQKERELQAKEAELKRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  QK+QY+AF + LG+V+ L++N++AVT  WIK    KI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTLLGLVIALLWNVIAVTTAWIKHGDAKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A R  SALKFGWFF+FYLLHIGFCIFAA+APP++F
Sbjct  179   WFLAIIYFISGVPGAYVLWYRPLYRAFRNESALKFGWFFLFYLLHIGFCIFAAVAPPVVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL A+D+  DHVLVGV                       FY +GFGLFCLE++
Sbjct  239   RGKSLTGILPAVDLIGDHVLVGV-----------------------FYFIGFGLFCLESV  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSIWVIQ  282



>ref|XP_007025744.1| Secretory carrier-associated membrane protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOY28366.1| Secretory carrier-associated membrane protein 1 isoform 1 [Theobroma 
cacao]
Length=357

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 215/342 (63%), Gaps = 71/342 (21%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFS-------------------------NGGNA---------  1208
             M  R D NPFD+EE+EVNPF+                         NG  A         
Sbjct  1     MAGRYDKNPFDEEEEEVNPFAFNYGVSVAVYLKNFEILYGFGESFRNGDPAVRGKTSGQS  60

Query  1207  ---------------PGSKSRIPQMVANTLGFGQKHDATVDIPLDS------LNDPKKKQ  1091
                            P S SR+  +     GF    +AT+DIPLD+        D K+K+
Sbjct  61    KFGGGLFSTNNPTAPPASNSRLSPLPPEPAGFNYDREATIDIPLDTSSGGSHYQDLKRKE  120

Query  1090  KELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQY  911
             KEL A EA+L+RRE ++KR+E+A A AG+ + +KNWPPFFPIIHHDI NEIP+  Q++QY
Sbjct  121   KELQAKEAELRRREQEVKRKEEAAARAGIVLEEKNWPPFFPIIHHDIANEIPIHLQRLQY  180

Query  910   LAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMR  731
             +AF+++LG+ LCL++NI+AVT  WIKG+GV+I+ LA+IY + G P +YVLWYRPLY A R
Sbjct  181   VAFSTFLGLCLCLLWNIIAVTTAWIKGEGVRIWFLAVIYFIAGVPGAYVLWYRPLYRAFR  240

Query  730   TNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG---VSC  560
               SAL+FGWFF+FYLLHIGFCIFAA+APPI+F GKSLTGIL A+D+   H LVG   ++C
Sbjct  241   KESALRFGWFFLFYLLHIGFCIFAAVAPPIVFRGKSLTGILPAVDLIDGHALVGQKLITC  300

Query  559   CN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             C          +D       IFY VGF LFC+E+++S+WV+Q
Sbjct  301   C--------VKWDS-----WIFYFVGFALFCVESVVSIWVMQ  329



>gb|KDO75798.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
 gb|KDO75799.1| hypothetical protein CISIN_1g019268mg [Citrus sinensis]
Length=272

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 192/270 (71%), Gaps = 25/270 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA----------PGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPFS+             GG            P + SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFSDPAVRGKSSGQSRFGGGGFFTTNSASVPPATNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                 GF  + DA +DIPLD+  D KKK+KEL A EA+L+RRE D++R+E+A A AG+ + 
Sbjct  59    HEPAGFNFERDAPIDIPLDTAADLKKKEKELQAKEAELRRREQDVRRKEEAAARAGIVLE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AFA++LG+ LCL++NIVAVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFATYLGLFLCLLWNIVAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A RT SA+KFGWFF+FYLLHIGFCIFA++APPIIF
Sbjct  179   WFLAIIYFIAGVPGAYVLWYRPLYRAFRTESAMKFGWFFLFYLLHIGFCIFASVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HL  545
              GKSLTG+L A+DV  DH LVGV     +L
Sbjct  239   KGKSLTGVLPAVDVMGDHALVGVRILQPNL  268



>ref|NP_172584.1| secretory carrier-associated membrane protein 5 [Arabidopsis 
thaliana]
 sp|Q9SXA5.2|SCAM5_ARATH RecName: Full=Secretory carrier-associated membrane protein 5; 
Short=Secretory carrier membrane protein 5 [Arabidopsis thaliana]
 gb|AEE28695.1| secretory carrier-associated membrane protein 5 [Arabidopsis 
thaliana]
Length=291

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 199/289 (69%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D N FD E+ EVNPF+N G+ P  S SR+  +     GFG  +  TVDIPLD   
Sbjct  1     MGGRYDRNTFD-EQDEVNPFANPGSVPAASNSRLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EADL+RRE D+KR++DA A AG+ +  KNWP FFP+IHHDI NE
Sbjct  58    SGAQDLKKKEKELQAKEADLRRREQDLKRKQDAAARAGIVIEAKNWPTFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             I V  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   ILVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL AIDV S  
Sbjct  178   WYRPLYRAFRSDSAFNFGWFFLFYMLHILFCLFAAVAPPIVFKGKSLAGILPAIDVLSAQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GFGLFCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFGLFCLESVVSIWVIQ  263



>gb|KHN22909.1| Putative secretory carrier-associated membrane protein 1 [Glycine 
soja]
Length=306

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 203/303 (67%), Gaps = 49/303 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG----------------------GNAPGSKSRIPQMVANTL  1163
             R DPNPFD+E  EVNPF++G                      G+ P + SR+  +     
Sbjct  3     RYDPNPFDEEPIEVNPFADGTAKGKGSGQSSYSGGAFYTTNTGSVPSANSRLSPLPPEPY  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
               G    AT+DIPLD+  D K K+KEL A EA+LKRRE ++KRREDA+A AG+ + +KNW
Sbjct  63    DRG----ATIDIPLDNAKDIKAKEKELQAKEAELKRREQELKRREDAIARAGIVIEEKNW  118

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI  EIP+  Q++QY+AF +WLG+VLCL++NIVAVT  WIKG+G  I+ LA
Sbjct  119   PPFFPIIHHDIAKEIPIHLQRIQYIAFTTWLGLVLCLLWNIVAVTTAWIKGEGPTIWFLA  178

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P SYVLWYRPLY AMRT+SALKFGWFF+ Y+LHI FCI AA+APPIIF GKS
Sbjct  179   IIYFISGAPGSYVLWYRPLYRAMRTDSALKFGWFFLLYMLHIAFCILAAVAPPIIFKGKS  238

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             LTGILAAIDV  D+ LVG+                          +GFG FCLE++LS+W
Sbjct  239   LTGILAAIDVLGDNALVGIFY-----------------------FIGFGFFCLESVLSIW  275

Query  442   VLQ  434
             V+Q
Sbjct  276   VIQ  278



>gb|KJB57603.1| hypothetical protein B456_009G171800 [Gossypium raimondii]
Length=298

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 195/271 (72%), Gaps = 28/271 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGN---------APGSKSRIPQMVA  1172
             M  R D NPFD+EE+EVNPF++             GG           P S SR+  +  
Sbjct  1     MAGRYDKNPFDEEEEEVNPFADTTARGKASGQSKFGGGLFSTSTASVPPASNSRLSPLPP  60

Query  1171  NTLGFGQKHDATVDIPLDSLN------DPKKKQKELAAWEADLKRREMDIKRREDAVAGA  1010
                GF  + +ATVDIPLD+ +      D KKK+KEL A EA+L+RRE +++R+E+AVA A
Sbjct  61    EPAGFSYEREATVDIPLDTASGGSRNQDLKKKEKELQAKEAELRRREQEVRRKEEAVARA  120

Query  1009  GVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKG  830
             GV + +KNWPPFFPIIHHDI NEIP+  Q++QY+AF+++LG+VLCL++NI+AVT  WIKG
Sbjct  121   GVVLEEKNWPPFFPIIHHDIANEIPIHLQRLQYVAFSTYLGLVLCLLWNIIAVTTAWIKG  180

Query  829   DGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaia  650
             +GV+I+ LAII+ + G P +YVLWYRPLY A R  SAL+FGWFF+FYLLHI FCIFAA+A
Sbjct  181   EGVRIWFLAIIFFIAGVPGAYVLWYRPLYRAFRNESALRFGWFFLFYLLHIAFCIFAAVA  240

Query  649   ppiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             PPI+F GKSLTGIL A+D+   + LVGVS C
Sbjct  241   PPIVFRGKSLTGILPAVDLVGGNALVGVSIC  271



>gb|KJB66654.1| hypothetical protein B456_010G150400 [Gossypium raimondii]
Length=318

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 211/313 (67%), Gaps = 52/313 (17%)
 Frame = -2

Query  1285  MNRRNDPNPFDDE-EQEVNPFSN--------------GG----NAP----GSKSRIPQMV  1175
             M  R D NPF +E E+EVNPFS+              GG    N P     S SR+  + 
Sbjct  1     MAGRFDENPFAEEGEEEVNPFSDPAVRGKASGQSKFGGGLFSKNVPSAPLASNSRLSPLP  60

Query  1174  ANTLGFGQKHDATVDIPLDSLN------DPKKKQKELAAWEADLKRREMDIKRREDAVAG  1013
                 GF   H+AT+DIPLD+ +      D KKK+KEL A EA+L+RRE +++R+E+A A 
Sbjct  61    PEPAGFNYGHEATIDIPLDTASGGSRYQDLKKKEKELQAKEAELRRREQEVRRKEEAAAR  120

Query  1012  AGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIK  833
             AG+ + +KNWPPFFPIIHHDI N+IPV  Q++QY+AF+++LG+ LCL++NIVAVT  WIK
Sbjct  121   AGITLEEKNWPPFFPIIHHDIANDIPVHLQRLQYVAFSTFLGLFLCLLWNIVAVTTAWIK  180

Query  832   GDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaai  653
             G+GV+I+ LAIIY + G P +Y+LWYRPLY A R  +AL FG FF+F LLHIGFCIFAA+
Sbjct  181   GEGVRIWFLAIIYFIAGVPGAYILWYRPLYRAFRKETALSFGRFFLFDLLHIGFCIFAAV  240

Query  652   appiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGL  473
             APPI+F GKSLTGIL A+D+ SD+ LVG                       IFY +GFGL
Sbjct  241   APPIVFRGKSLTGILPAVDLISDNALVG-----------------------IFYFIGFGL  277

Query  472   FCLEALLSLWVLQ  434
             FC+E+++S+WV+Q
Sbjct  278   FCVESIVSIWVIQ  290



>emb|CDY67793.1| BnaCnng56430D [Brassica napus]
Length=291

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 197/289 (68%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPFD E  EVNPF+N G+ P  S SR+  +     GFG     TVD+PLD   
Sbjct  1     MAGRYDRNPFD-EGDEVNPFANPGSVPAASSSRLSPLPPEPAGFG--FGRTVDVPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+LKRRE D+KR+EDA A AG+ +  KNWPP FP+IHHDI NE
Sbjct  58    SGAQDLKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPLFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IP+  Q++QY+AF+++LG+VL L +N++AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPIRLQRLQYIAFSTYLGLVLALFWNVIAVTTAWIKGEGVTIWLLALIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R +SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL A+D+ S  
Sbjct  178   WYRPLYRAFRNDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPALDMLSSQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFAFFCLESVVSIWVIQ  263



>ref|XP_012088340.1| PREDICTED: secretory carrier-associated membrane protein 1 [Jatropha 
curcas]
 gb|KDP24177.1| hypothetical protein JCGZ_25834 [Jatropha curcas]
Length=302

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/301 (52%), Positives = 202/301 (67%), Gaps = 49/301 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG--------------------GNAPGSKSRIPQMVANTLGF  1157
             R D NPFD  E+EVNPF++                      N P + SR+  +       
Sbjct  3     RYDSNPFD--EEEVNPFADQPAKGKGSGQSSYGGGAFYMPNNVPPANSRLSPLPPEPYDR  60

Query  1156  GQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPP  977
             G    AT+DIPLD+  D + K+KEL A EA+LK+RE ++KRREDA+A AG+ + +KNWPP
Sbjct  61    G----ATIDIPLDAAKDLRAKEKELQAKEAELKKREQELKRREDAIARAGIVIEEKNWPP  116

Query  976   FFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAII  797
             FFPIIHHDI NEIPV  Q++QY+AF + LG+V+CL++NI+AVT  WIKG+G  I+ LA+I
Sbjct  117   FFPIIHHDIGNEIPVHLQRLQYVAFTTLLGLVICLLWNIIAVTTAWIKGEGPTIWFLAVI  176

Query  796   YALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLT  617
             Y + G P +YV+WYRPLY AMRT+SALKFGWFF+ Y++HIGFCIFAA+APPIIF GKSL 
Sbjct  177   YFISGVPGAYVMWYRPLYRAMRTDSALKFGWFFLCYMVHIGFCIFAAVAPPIIFKGKSLA  236

Query  616   GILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL  437
             GIL AID+   H LVG                       IFY +GFGLFC+E+LLS+WV+
Sbjct  237   GILPAIDLLGSHALVG-----------------------IFYFIGFGLFCVESLLSIWVI  273

Query  436   Q  434
             Q
Sbjct  274   Q  274



>gb|KJB57602.1| hypothetical protein B456_009G171800 [Gossypium raimondii]
Length=286

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 195/271 (72%), Gaps = 28/271 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGN---------APGSKSRIPQMVA  1172
             M  R D NPFD+EE+EVNPF++             GG           P S SR+  +  
Sbjct  1     MAGRYDKNPFDEEEEEVNPFADTTARGKASGQSKFGGGLFSTSTASVPPASNSRLSPLPP  60

Query  1171  NTLGFGQKHDATVDIPLDSLN------DPKKKQKELAAWEADLKRREMDIKRREDAVAGA  1010
                GF  + +ATVDIPLD+ +      D KKK+KEL A EA+L+RRE +++R+E+AVA A
Sbjct  61    EPAGFSYEREATVDIPLDTASGGSRNQDLKKKEKELQAKEAELRRREQEVRRKEEAVARA  120

Query  1009  GVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKG  830
             GV + +KNWPPFFPIIHHDI NEIP+  Q++QY+AF+++LG+VLCL++NI+AVT  WIKG
Sbjct  121   GVVLEEKNWPPFFPIIHHDIANEIPIHLQRLQYVAFSTYLGLVLCLLWNIIAVTTAWIKG  180

Query  829   DGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaia  650
             +GV+I+ LAII+ + G P +YVLWYRPLY A R  SAL+FGWFF+FYLLHI FCIFAA+A
Sbjct  181   EGVRIWFLAIIFFIAGVPGAYVLWYRPLYRAFRNESALRFGWFFLFYLLHIAFCIFAAVA  240

Query  649   ppiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             PPI+F GKSLTGIL A+D+   + LVGVS C
Sbjct  241   PPIVFRGKSLTGILPAVDLVGGNALVGVSIC  271



>ref|XP_009148449.1| PREDICTED: secretory carrier-associated membrane protein 5 [Brassica 
rapa]
 emb|CDX97938.1| BnaA06g06890D [Brassica napus]
Length=291

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 198/289 (69%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D NPFD E  EVNPF+N G+ P  S SR+  +     GFG  +  TVD+PLD   
Sbjct  1     MAGRYDRNPFD-EGDEVNPFANPGSVPAASSSRLSPLPPEPAGFG--YGRTVDVPLDRPG  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 D KKK+KEL A EA+LKRRE D+KR+EDA A AG+ +  KNWPP FP+IHHDI NE
Sbjct  58    SGAQDLKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPLFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IP+  Q++QY+AF+++LG+VL L +N++AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPIRLQRLQYIAFSTYLGLVLALFWNVIAVTTAWIKGEGVTIWLLALIYFISGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A R +SAL FGWFF+FY+LHI FC+FAA+APPI+F GKSL GIL A+D+ S  
Sbjct  178   WYRPLYRAFRNDSALSFGWFFLFYMLHIVFCVFAAVAPPIVFKGKSLAGILPALDMLSSQ  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG                       IFY +GF  FCLE+++S+WV+Q
Sbjct  238   ALVG-----------------------IFYFIGFAFFCLESVVSIWVIQ  263



>gb|KFK43410.1| hypothetical protein AALP_AA1G122300 [Arabis alpina]
Length=291

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 199/284 (70%), Gaps = 31/284 (11%)
 Frame = -2

Query  1270  DPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPL----DSLND  1106
             D NPF  EE E+NPF+N G+ P  S SR+  +     G+G  +  TVDIPL        D
Sbjct  6     DRNPFAREE-EINPFANPGSVPAASNSRLSPLPPEPAGYG--YGRTVDIPLGNPGSGTQD  62

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFP+IHHDI NEIP+  
Sbjct  63    LKKKEKELQAKEAELQRREQDLKRKEDAAAQAGIVIEVKNWPPFFPLIHHDIANEIPIRL  122

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLWYRPL
Sbjct  123   QRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLALIYFISGVPGGYVLWYRPL  182

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y A R++SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV + H+LVG 
Sbjct  183   YRAFRSDSALNFGWFFLFYMLHILFCVFAAVAPPVVFKGKSLAGILPAIDVLNGHLLVG-  241

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GF  FCLE+++S+WV+Q
Sbjct  242   ----------------------IFYFIGFAFFCLESVVSIWVIQ  263



>ref|NP_001158996.1| SC3 protein [Zea mays]
 gb|ACG34256.1| SC3 protein [Zea mays]
 gb|ACN36871.1| unknown [Zea mays]
 tpg|DAA63151.1| TPA: SC3 protein [Zea mays]
Length=305

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 203/306 (66%), Gaps = 51/306 (17%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN------------GGNA----------PGSKSRIPQMVA  1172
             M  R D NPF  EE++VNPFS             GG A          P S SR+  +  
Sbjct  1     MAGRYDGNPF--EEEDVNPFSEQARGKAGGQSNFGGGAFYMPNTRNMPPASNSRLSPLPP  58

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F     ATVDIPLDS  D K+++KEL A EA+L +RE ++KRRE+A A AG+ + +
Sbjct  59    EPADF----SATVDIPLDSSKDLKRREKELQAREAELNKREKELKRREEAAARAGIVIEE  114

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPF P+IHHDI NEIP   Q+MQY+AFAS+LG+V CL +N++AVT  WIKG+GVKI+
Sbjct  115   KNWPPFLPLIHHDITNEIPSHLQRMQYVAFASFLGLVCCLFWNVIAVTTAWIKGEGVKIW  174

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
             LLAIIY + G P +YVLWYRPLYNAMRT+SALKFG FF+ Y+ HI FC+F+A+APP++F 
Sbjct  175   LLAIIYFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLLYVFHILFCVFSAVAPPVVFE  234

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL AID+ S + LVG                       IFY VGFGLFCLE+LL
Sbjct  235   GKSLAGILPAIDLISVNALVG-----------------------IFYFVGFGLFCLESLL  271

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  272   SIWVIQ  277



>ref|XP_011096286.1| PREDICTED: secretory carrier-associated membrane protein 2 [Sesamum 
indicum]
 ref|XP_011096287.1| PREDICTED: secretory carrier-associated membrane protein 2 [Sesamum 
indicum]
Length=300

 Score =   288 bits (738),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 199/298 (67%), Gaps = 40/298 (13%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN--------------APGSKSRIPQMVANTLGFGQK  1148
             M  R D NPF  EE+EVNPF++GG                P + SR+  +      F   
Sbjct  1     MAGRYDSNPF--EEEEVNPFADGGGRGKTSNQSTYTGSVPPVTNSRLSPLPPEPADF-YN  57

Query  1147  HDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFP  968
               A V+IPLDS +D KKK++EL A EA+LKRRE +++R+E+A A AG+ + +KNWPPFFP
Sbjct  58    PTAPVNIPLDSTSDLKKKERELQAKEAELKRREQEVRRKEEAAARAGIVLEEKNWPPFFP  117

Query  967   IIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYAL  788
             IIHHDI NEIP+  QK+QY+AF ++LG+   L++N++AVT  WIK    KI+ LAIIY +
Sbjct  118   IIHHDIANEIPIHLQKLQYVAFTTFLGLAFSLLWNVIAVTTAWIKQGDPKIWFLAIIYLI  177

Query  787   MGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGIL  608
              G P +YVLWYRPLY A R  SALKFGWFFMFYLLHIGFCIFAA+APP++F GKSL GIL
Sbjct  178   SGVPGAYVLWYRPLYRAFRNESALKFGWFFMFYLLHIGFCIFAAVAPPVVFKGKSLAGIL  237

Query  607   AAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              A+D+   HVLVG                       IFY +GFGLFCLE++LS+WV+Q
Sbjct  238   PAVDLIGKHVLVG-----------------------IFYFIGFGLFCLESVLSIWVIQ  272



>gb|AFK40454.1| unknown [Lotus japonicus]
Length=288

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 204/285 (72%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD  E+EVNPFSN G  P  + SR+  +    + +     ATVDIPLD+ N
Sbjct  1     MAGRYDSNPFD--EEEVNPFSNPGRVPPATNSRLSPLKPEPVDYNYGFGATVDIPLDTSN  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D K K+KEL + EA+LKRRE +++RRE+A A AG+ + +KNWPPFFPIIHHDI NEIPV 
Sbjct  59    DLKNKEKELQSKEAELKRREQEVRRREEAAARAGIVIEEKNWPPFFPIIHHDIANEIPVH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              Q++QY+AF + LG+V+CL +N++AVT  WIKG+GVKI+ LA+IY + G P +YVLWYRP
Sbjct  119   LQRLQYVAFTTLLGLVVCLTWNVIAVTAAWIKGEGVKIWFLAVIYFISGVPGAYVLWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A R  SALKFGWFF+FY++HIGFCI AA+APPI+F GKSLTGILAAIDV  +H L+G
Sbjct  179   LYRAFRNESALKFGWFFLFYMIHIGFCILAAVAPPIVFKGKSLTGILAAIDVLDNHALIG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    IFY +GFGLFCLE ++S+WVLQ
Sbjct  239   -----------------------IFYFIGFGLFCLETVISIWVLQ  260



>ref|XP_010905603.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
isoform X2 [Elaeis guineensis]
Length=271

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 196/284 (69%), Gaps = 41/284 (14%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPFD+EE  VNPF++    P  + +     A    +G     T D+       
Sbjct  1     MAGRYDSNPFDEEE--VNPFAD----PAVRGK----AAGQSNYGGGPFYTTDL-------  43

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+L +RE ++KRRE+A A AG+ + +KNWPPFFPIIHHDI NEIP+  
Sbjct  44    -KKKEKELQAKEAELNKREKELKRREEAAARAGIVIEEKNWPPFFPIIHHDIANEIPIHL  102

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q++QY AFAS LG+ +CL +NI+AVT  WIKG GVKI+LLAIIY + G P +YVLWYRPL
Sbjct  103   QRLQYFAFASLLGLTICLFWNIIAVTTAWIKGQGVKIWLLAIIYFISGVPGAYVLWYRPL  162

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SAL+FGWFF+FYLLHIGFCIF+A+APPIIF GKSLTGIL A+D+ S H LVG 
Sbjct  163   YRAMRTDSALRFGWFFLFYLLHIGFCIFSAVAPPIIFKGKSLTGILPAVDLISGHALVG-  221

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFC+E+LLS+WV+Q
Sbjct  222   ----------------------IFYFIGFGLFCVESLLSIWVIQ  243



>ref|XP_010689702.1| PREDICTED: secretory carrier-associated membrane protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=305

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 205/300 (68%), Gaps = 45/300 (15%)
 Frame = -2

Query  1273  NDPNPFDDEEQEVNPFS-------------NGGN----APGSKSRIPQMVANTLGFGQ--  1151
              + NPF   E++VNPF+             NGG      PGS +  P  V + L  G+  
Sbjct  3     QNQNPF--AEEDVNPFADQPNGKGSKQSAFNGGAFYMPNPGSVAPSPNPVLSPLPSGRAD  60

Query  1150  -KHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPF  974
                 ATVDIPL++  D K K+KEL A EA+LK+RE +++RREDA++ AG+ + +KNWPPF
Sbjct  61    YNRGATVDIPLENGMDLKSKEKELLAKEAELKKREQELRRREDAISRAGIVIEEKNWPPF  120

Query  973   FPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIY  794
             FP+IHHDI NEIPV  QK+QY+AF ++LG+ LCL++NIVAVT+ WIKG+GVKI+LLAIIY
Sbjct  121   FPLIHHDIPNEIPVHLQKLQYVAFTTYLGLALCLLWNIVAVTIAWIKGEGVKIWLLAIIY  180

Query  793   ALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTG  614
              + G P +YV WYRPLY AMRT+SALKFGWFF+ Y +HIGFCI AA+APPI+F GKSLTG
Sbjct  181   FISGVPGAYVFWYRPLYRAMRTDSALKFGWFFIAYSVHIGFCILAAVAPPIVFEGKSLTG  240

Query  613   ILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             IL AIDV S + ++G                       I YLVGFGLF LE LLS+WV+Q
Sbjct  241   ILPAIDVLSGNAIIG-----------------------ILYLVGFGLFVLEVLLSIWVIQ  277



>ref|XP_010905601.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010905602.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
isoform X1 [Elaeis guineensis]
Length=311

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 205/308 (67%), Gaps = 49/308 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPF++                       G   P S SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFADPAVRGKAAGQSNYGGGPFYTTHPGSVPPASNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLD-SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPV  998
                  F     ATVDIPLD S  D KKK+KEL A EA+L +RE ++KRRE+A A AG+ +
Sbjct  59    PEPADFYSDRSATVDIPLDTSTKDLKKKEKELQAKEAELNKREKELKRREEAAARAGIVI  118

Query  997   SDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVK  818
              +KNWPPFFPIIHHDI NEIP+  Q++QY AFAS LG+ +CL +NI+AVT  WIKG GVK
Sbjct  119   EEKNWPPFFPIIHHDIANEIPIHLQRLQYFAFASLLGLTICLFWNIIAVTTAWIKGQGVK  178

Query  817   IFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappii  638
             I+LLAIIY + G P +YVLWYRPLY AMRT+SAL+FGWFF+FYLLHIGFCIF+A+APPII
Sbjct  179   IWLLAIIYFISGVPGAYVLWYRPLYRAMRTDSALRFGWFFLFYLLHIGFCIFSAVAPPII  238

Query  637   FHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEA  458
             F GKSLTGIL A+D+ S H LVG                       IFY +GFGLFC+E+
Sbjct  239   FKGKSLTGILPAVDLISGHALVG-----------------------IFYFIGFGLFCVES  275

Query  457   LLSLWVLQ  434
             LLS+WV+Q
Sbjct  276   LLSIWVIQ  283



>emb|CDO99609.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 202/299 (68%), Gaps = 40/299 (13%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNA---------------PGSKSRIPQMVANTLGFGQ  1151
             M  R D NPFD EE+EVNPF++GG +                 + SR+  +      F  
Sbjct  1     MAGRYDRNPFD-EEEEVNPFADGGKSKFSGGAFYTTSGSVPAATHSRLSPLPPEPADF-Y  58

Query  1150  KHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFF  971
                A++DIPLD+  D KKK+KEL A EA+L+RRE D+KR+E+A A AG+ + +KNWPPFF
Sbjct  59    NSTASIDIPLDNAADLKKKEKELQAKEAELRRREQDVKRKEEAAARAGIVLEEKNWPPFF  118

Query  970   PIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYA  791
             PIIHHDI N+IP+  Q+MQY+AF ++LG+V CL +N++AVT  WIK    KI+ LAIIY 
Sbjct  119   PIIHHDIGNDIPIHLQRMQYVAFTTFLGLVACLFWNVIAVTTAWIKEGDPKIWFLAIIYF  178

Query  790   LMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGI  611
             + G P +YVLWYRPLYNA RT+SA+KFGWFF+FYLLHI F IFAA+APP++F GKSL GI
Sbjct  179   ISGVPGAYVLWYRPLYNAFRTDSAMKFGWFFLFYLLHIIFVIFAAVAPPVVFKGKSLAGI  238

Query  610   LAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             L A+D+ S  VLVGV                       FY +GFGLFCLE++LS+WV+Q
Sbjct  239   LPAVDLISKQVLVGV-----------------------FYFIGFGLFCLESVLSVWVIQ  274



>ref|XP_010931924.1| PREDICTED: secretory carrier-associated membrane protein 2 isoform 
X2 [Elaeis guineensis]
Length=286

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 203/284 (71%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R DPNPF  EE++VNPFS+ G++  S SR+  +      F      T DIP+D+  D
Sbjct  1     MAGRFDPNPF--EEEQVNPFSHPGSS-LSDSRLSPLPPEPAEFYNDRGVTRDIPVDTTKD  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K+K+KEL A EA L++RE ++KRREDA++ AGV + +KNWPP FPIIHHDI NEIP+ S
Sbjct  58    LKRKEKELQAKEAALRKREQELKRREDALSRAGVVLEEKNWPPCFPIIHHDIANEIPIYS  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAFAS+LG+  CL +NI+AVT   IKG+GVKI+ L+IIY + GCPL+YVLWYRPL
Sbjct  118   QRMQYLAFASFLGLTACLFWNIIAVTTALIKGEGVKIWFLSIIYFISGCPLAYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT SA+KFGWFFMFY++HI FCI+ A+APP  F GKSLTGILAAIDV  D+VLVG+
Sbjct  178   YRAMRTESAMKFGWFFMFYMVHIAFCIYCAVAPPFPFKGKSLTGILAAIDVIGDNVLVGI  237

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                     Y +GFG FC+E+L+S+WV+Q
Sbjct  238   F-----------------------YFIGFGFFCIESLISIWVIQ  258



>ref|XP_010278340.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Nelumbo nucifera]
Length=311

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 209/307 (68%), Gaps = 47/307 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA-----PGS-----KSRIPQMV  1175
             M  R DPNPF++EE EVNPF++             GG A     PGS      SR+  + 
Sbjct  1     MAGRYDPNPFEEEE-EVNPFADPAARGKASGQSHYGGGAFFTTNPGSVPSATNSRLSPLP  59

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPL +  D KKK+KEL A EA+L++RE ++KR+E+A A AG+ + 
Sbjct  60    PEPADFNYGRGATVDIPLGTEKDLKKKEKELQAKEAELRKREQELKRKEEAAARAGIVIE  119

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY+AF + LG+  CL++NIVAVT  WIKG+GVKI
Sbjct  120   EKNWPPFFPIIHHDIANEIPIHLQRLQYVAFTTLLGLFACLLWNIVAVTTAWIKGEGVKI  179

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P  YVLWYRPLY AMRT SALKFGWFF+FYLLHIGFCIFAA+APPIIF
Sbjct  180   WFLAIIYFISGVPGGYVLWYRPLYRAMRTESALKFGWFFLFYLLHIGFCIFAAVAPPIIF  239

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL A+D+ S +VLVG                       IFY +GFGLFC+E++
Sbjct  240   KGKSLTGILPAVDLISGNVLVG-----------------------IFYFIGFGLFCVESM  276

Query  454   LSLWVLQ  434
             +S+WV+Q
Sbjct  277   ISIWVIQ  283



>ref|XP_009416074.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=309

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 206/306 (67%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPF---------------------SNGGNAPG-SKSRIPQMVA  1172
             M  R D NPFD EE++VNPF                     +N GN P  SK R+  +  
Sbjct  1     MAGRYDRNPFD-EEEDVNPFADPGVRGKAAGSNYGGGSFYMTNPGNVPPVSKPRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F     ATVDIPLD+  D KKK+KEL A EA+L RRE +IKRRE+A A  G+ + D
Sbjct  60    EPADFHNDRGATVDIPLDTEKDLKKKEKELQAKEAELNRREKEIKRREEAAA-PGIIIED  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDIVNEIPV  Q++QY AFAS +G+  CL +NIVA T  WIKG+GVKI+
Sbjct  119   KNWPPFFPIIHHDIVNEIPVHLQRLQYFAFASLIGLTACLFWNIVATTAAWIKGEGVKIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              LAIIY + G P +YVLWYRPLY AMRT+SAL +GWFF+FYLLHIGF +++A+APP+IFH
Sbjct  179   FLAIIYFISGVPGAYVLWYRPLYRAMRTDSALNYGWFFLFYLLHIGFVVYSAVAPPLIFH  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+ S+ VLVG                       IFYLVGFGLFC+E+LL
Sbjct  239   GKSLTGILPAVDLISEDVLVG-----------------------IFYLVGFGLFCIESLL  275

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  276   SIWVMQ  281



>ref|XP_009603718.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Nicotiana tomentosiformis]
Length=309

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/306 (51%), Positives = 201/306 (66%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN----------------------APGSKSRIPQMVA  1172
             M  R D NPFD EE+EVNPF++GG                        P + SR+  +  
Sbjct  1     MAGRYDRNPFD-EEEEVNPFADGGGRGKSSGQSKFSGGAFNITSGSVPPATNSRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F  + DA +DIPLDS +D KKK+KEL A E++L+RRE ++KRREDA A AG+ + +
Sbjct  60    EPADFYDR-DAPIDIPLDSASDLKKKEKELQAKESELRRREQELKRREDAAARAGIVIEE  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG+V CL++NIVA T  WIK   VKI+
Sbjct  119   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLVACLLWNIVATTTAWIKEGDVKIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              L+IIY +   P +Y +WYRPLY A RT  A+KF WFF+FY++HI FCIFAA+APP++F 
Sbjct  179   FLSIIYFISAVPGAYFMWYRPLYRAFRTEGAMKFAWFFLFYMVHIIFCIFAAVAPPVVFR  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+   +VLVG                       IFY +GFGLFCLE++L
Sbjct  239   GKSLTGILPAVDLIGKNVLVG-----------------------IFYFIGFGLFCLESVL  275

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  276   SIWVIQ  281



>ref|XP_002305668.2| hypothetical protein POPTR_0004s03680g [Populus trichocarpa]
 gb|EEE86179.2| hypothetical protein POPTR_0004s03680g [Populus trichocarpa]
Length=278

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 195/284 (69%), Gaps = 29/284 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R DPNPFD+EE  VNPF   G  P S SR+  +     GF   +  TVDIP+D+  D
Sbjct  1     MAGRYDPNPFDEEE--VNPFI--GVPPASNSRLSPLPPEPAGF-YNYGTTVDIPIDAAAD  55

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              +KK+KEL A EA+L+RRE  +KR EDA A AGV + +KNWPPFFPIIHHD+ NEIPV  
Sbjct  56    LRKKEKELQAREAELRRRE-KVKRLEDAAARAGVVLEEKNWPPFFPIIHHDVANEIPVHL  114

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QY+A  ++LG+  CL +N++AVT  WI G+GV I+ L++ Y + G P +Y LWYRPL
Sbjct  115   QKIQYVALTTFLGLTFCLFWNVIAVTTAWIHGEGVNIWFLSVNYFISGVPGAYFLWYRPL  174

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y A RT SA++FGWFF+FY+LHIGFCIFAA+APP IF GKSLTGILAA+DV  ++ + G 
Sbjct  175   YRAFRTASAMRFGWFFLFYVLHIGFCIFAAVAPPKIFKGKSLTGILAAVDVVGNNTIAG-  233

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFG FCLE+LLS+WV+Q
Sbjct  234   ----------------------IFYFIGFGCFCLESLLSIWVIQ  255



>ref|XP_004232822.1| PREDICTED: secretory carrier-associated membrane protein 2 [Solanum 
lycopersicum]
Length=309

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 202/306 (66%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN----------------------APGSKSRIPQMVA  1172
             M  R D NPF+ EE+EVNPF++GG                        P + SR+  +  
Sbjct  1     MAGRYDHNPFE-EEEEVNPFADGGGRGKSSGQSKFSGGAFYTTSGSVPPATNSRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F  + +A++DIPLDS +D KKK+KEL + E +L+RRE D+KRREDA A AG+ + +
Sbjct  60    EPADFYDR-NASIDIPLDSASDLKKKEKELQSKENELRRREQDLKRREDAAARAGIVLEE  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG++ CL++NIVA T  WIK   VKI+
Sbjct  119   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLIACLLWNIVATTTAWIKEGDVKIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              L+IIY + G P +Y +WYRPLY A RT  A+KF WFF+FYL+HI FC+FAA+APP++F 
Sbjct  179   FLSIIYFISGVPGAYFMWYRPLYRAFRTEGAMKFAWFFLFYLVHIVFCVFAAVAPPVVFR  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+   +VLVG                       IFY +GFGLFCLE+LL
Sbjct  239   GKSLTGILPAVDLIGKNVLVG-----------------------IFYFIGFGLFCLESLL  275

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  276   SIWVIQ  281



>ref|NP_001184960.1| secretory carrier-associated membrane protein 5 [Arabidopsis 
thaliana]
 gb|AEE28696.1| secretory carrier-associated membrane protein 5 [Arabidopsis 
thaliana]
Length=304

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 200/302 (66%), Gaps = 44/302 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R D N FD E+ EVNPF+N G+ P  S SR+  +     GFG  +  TVDIPLD   
Sbjct  1     MGGRYDRNTFD-EQDEVNPFANPGSVPAASNSRLSPLPPEPAGFG--YGRTVDIPLDRPG  57

Query  1117  --------------SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWP  980
                            + D KKK+KEL A EADL+RRE D+KR++DA A AG+ +  KNWP
Sbjct  58    SGAQNNSCLNVTLLGIQDLKKKEKELQAKEADLRRREQDLKRKQDAAARAGIVIEAKNWP  117

Query  979   PFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAI  800
              FFP+IHHDI NEI V  Q++QY+AFA++LG+VL L +NI+AVT  WIKG+GV I+LLA+
Sbjct  118   TFFPLIHHDIANEILVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAV  177

Query  799   IYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSL  620
             IY + G P  YVLWYRPLY A R++SA  FGWFF+FY+LHI FC+FAA+APPI+F GKSL
Sbjct  178   IYFISGVPGGYVLWYRPLYRAFRSDSAFNFGWFFLFYMLHILFCLFAAVAPPIVFKGKSL  237

Query  619   TGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWV  440
              GIL AIDV S   LVG                       IFY +GFGLFCLE+++S+WV
Sbjct  238   AGILPAIDVLSAQALVG-----------------------IFYFIGFGLFCLESVVSIWV  274

Query  439   LQ  434
             +Q
Sbjct  275   IQ  276



>ref|XP_006644801.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Oryza brachyantha]
Length=286

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 199/284 (70%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPFD  E +VNPF+ G   P S SR+P +     GF     ATVDIPLDS  D
Sbjct  1     MAGRYDRNPFD--EDDVNPFAGGSVPPASNSRMPPLPPEP-GFYNDRSATVDIPLDSTKD  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+L +RE ++KRRE+A + AG+ + +KNWPPFFPIIHHDI NEIP+  
Sbjct  58    MKKKEKELQAKEAELNKRERELKRREEAASRAGIVIEEKNWPPFFPIIHHDISNEIPIHL  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S LG+  CL +NI+A T  WIKG+GV I+LLAIIY + G P +YVLWYRPL
Sbjct  118   QRMQYLAFSSLLGLAACLFWNIIATTAAWIKGEGVMIWLLAIIYFISGVPGAYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFF+FYL+HI FCI++A+APP  F GKSL GIL AIDV  ++ +VG 
Sbjct  178   YNAMRTESALKFGWFFLFYLIHILFCIWSAVAPPFPFKGKSLAGILPAIDVIGNNAIVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLS+ V+Q
Sbjct  237   ----------------------IFYFIGFGLFCLESLLSVVVIQ  258



>emb|CAE05478.1| OSJNBa0006A01.24 [Oryza sativa Japonica Group]
 emb|CAE03932.3| OSJNba0093F12.6 [Oryza sativa Japonica Group]
Length=245

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 190/286 (66%), Gaps = 48/286 (17%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGGNAPG---SKSRIPQMVANTLGFGQ-KHDATVDIPLDSLN  1109
              +DPNPFD+   + NPFSNGG   G   S+ +         GFG  + DATVD+PLD++ 
Sbjct  2     HHDPNPFDEGNADDNPFSNGGGGGGGGGSRQQYGFRPTEPAGFGAGRGDATVDVPLDTMG  61

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D                     IKRRE+A+  AGVP+ DKNWPPFFPIIHHDI NEIP  
Sbjct  62    D---------------------IKRREEALRNAGVPMEDKNWPPFFPIIHHDIANEIPAN  100

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              QK+QYLAFASWLGIVLCL +N +AV VCWIK    K+F LA IYAL+G PLSY++WYRP
Sbjct  101   LQKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYRP  160

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY AMRTNSA  FGWFF+ YL+HIGFCI AAIAPPI+FHGKSLTGILAAID FS+HV++G
Sbjct  161   LYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVIIG  220

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQV  431
                                    IFY VGF LFCLE LLS+ VLQ+
Sbjct  221   -----------------------IFYFVGFALFCLETLLSIGVLQI  243



>ref|XP_004504992.1| PREDICTED: secretory carrier-associated membrane protein-like 
isoform X1 [Cicer arietinum]
Length=311

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 205/312 (66%), Gaps = 57/312 (18%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPF   E+EVNPFS+                       G   P + SR+  + 
Sbjct  1     MAGRYDSNPF--AEEEVNPFSDPAVRGKTSSQSNYSGGAFYTTNPGSVPPATNSRLAPLK  58

Query  1174  A-----NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGA  1010
                   N  GFG+    TVDIPLD+  D KKK+KEL + EADL+RRE +++R+E+A A A
Sbjct  59    PERADYNNYGFGE----TVDIPLDTSTDLKKKEKELQSKEADLRRREQEVRRKEEAAARA  114

Query  1009  GVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKG  830
             G+ + +KNWPPFFPIIHHDI NEIPV  QK+QY+AF + LG+VLCL++N++AVT  WIKG
Sbjct  115   GIVLEEKNWPPFFPIIHHDIANEIPVHLQKLQYVAFTTLLGLVLCLLWNVIAVTAAWIKG  174

Query  829   DGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaia  650
             +GVKI+ LAIIY + G P +YVLWYRPLY   RT SALKFGWFF+ YL+HIGFCI AA+A
Sbjct  175   EGVKIWFLAIIYFIAGVPGAYVLWYRPLYRTFRTESALKFGWFFLLYLIHIGFCILAAVA  234

Query  649   ppiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLF  470
             PPI+F GKSLTGIL+AIDV  +H L+G                       IFY VGFGLF
Sbjct  235   PPIVFKGKSLTGILSAIDVIDNHTLIG-----------------------IFYFVGFGLF  271

Query  469   CLEALLSLWVLQ  434
             CLE L+S+WV+Q
Sbjct  272   CLETLISIWVIQ  283



>ref|NP_001044437.1| Os01g0780500 [Oryza sativa Japonica Group]
 sp|Q7F613.1|SCAM2_ORYSJ RecName: Full=Secretory carrier-associated membrane protein 2; 
Short=RiSC; Short=Secretory carrier membrane protein 2 [Oryza 
sativa Japonica Group]
 gb|AAF36688.1|AF225922_1 secretory carrier membrane protein [Oryza sativa]
 dbj|BAB63575.1| putative secretory carrier membrane protein [Oryza sativa Japonica 
Group]
 dbj|BAF06351.1| Os01g0780500 [Oryza sativa Japonica Group]
 dbj|BAG90929.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71595.1| hypothetical protein OsI_03979 [Oryza sativa Indica Group]
Length=286

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 199/284 (70%), Gaps = 26/284 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R D NPFD  E +VNPF+ G   P S SR+P +  +  GF     ATVDIPLDS  D
Sbjct  1     MAGRYDRNPFD--EDDVNPFAGGSVPPASNSRMPPL-PHEPGFYNDRGATVDIPLDSTKD  57

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+L +RE +++RRE+A + AG+ + +KNWPPFFPIIHHDI NEIP+  
Sbjct  58    MKKKEKELQAKEAELNKRESELRRREEAASRAGIVIEEKNWPPFFPIIHHDISNEIPIHL  117

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S LG+  CL +NI+A T  WIKG GV I+LLAIIY + G P +YVLWYRPL
Sbjct  118   QRMQYLAFSSLLGLAACLFWNIIATTAAWIKGAGVMIWLLAIIYFISGVPGAYVLWYRPL  177

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFF+FYL+HI FCI++A+APP  F GKSL GIL AIDV  ++ +VG 
Sbjct  178   YNAMRTESALKFGWFFLFYLIHILFCIWSAVAPPFPFKGKSLAGILPAIDVIGNNAIVG-  236

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY +GFGLFCLE+LLS+ V+Q
Sbjct  237   ----------------------IFYFIGFGLFCLESLLSVVVIQ  258



>ref|NP_001242096.1| uncharacterized protein LOC100796729 [Glycine max]
 gb|ACU20451.1| unknown [Glycine max]
Length=306

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 200/303 (66%), Gaps = 49/303 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG----------------------GNAPGSKSRIPQMVANTL  1163
             R  PNPFD+E  EVNPF++G                      G+ P + SR+  +     
Sbjct  3     RYGPNPFDEEPIEVNPFADGTAKGKGSGQSSYSGGAFYTTNTGSVPSANSRLSPLPPEPY  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
               G    AT+DIPLD+  D K K+KEL A EA+LKRRE ++KRREDA+A AG+ + +KNW
Sbjct  63    DRG----ATIDIPLDNAKDIKAKEKELQAKEAELKRREQELKRREDAIARAGIVIEEKNW  118

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI  EIP+  Q++QY+AF +WLG+VLCL++NIVAVT  WIKG+   I+ LA
Sbjct  119   PPFFPIIHHDIAKEIPIHLQRIQYIAFTTWLGLVLCLLWNIVAVTTAWIKGESPTIWFLA  178

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P SYVLWYRPLY AMRT+SALKFGWFF+ Y+LHI FCI AA+APPIIF GKS
Sbjct  179   IIYFISGAPGSYVLWYRPLYRAMRTDSALKFGWFFLLYMLHIAFCILAAVAPPIIFKGKS  238

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             LTGILAAIDV  D  LVG+                          +GFG FCLE++LS+W
Sbjct  239   LTGILAAIDVLGDSALVGIFY-----------------------FIGFGFFCLESVLSIW  275

Query  442   VLQ  434
             V+Q
Sbjct  276   VIQ  278



>gb|EYU43399.1| hypothetical protein MIMGU_mgv1a010567mg [Erythranthe guttata]
Length=308

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 199/306 (65%), Gaps = 48/306 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN----------------------APGSKSRIPQMVA  1172
             M  R D NPFD+EE  VNPF++GG                        P + SR+  +  
Sbjct  1     MAGRYDRNPFDEEE--VNPFADGGARGKPSGQSKFGGGSFFNSTGSVPPATNSRLSPLPP  58

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F     A VDIPLDS +D KKK++EL A EA+LKRRE +++R+E+A A AG+ + +
Sbjct  59    EPADF-YNPTAPVDIPLDSASDLKKKERELQAKEAELKRREQEVRRKEEAAARAGIVLEE  117

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG+V  L++N++AVT  WIK    KI+
Sbjct  118   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTYLGLVCALLWNVIAVTTAWIKQGDAKIW  177

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              LA+IY + G P  YVLWYRPLY A R+ SA+KF WFF+FYLLHIGFCIFAA+APP++F 
Sbjct  178   FLALIYFISGVPGGYVLWYRPLYRAFRSESAMKFTWFFLFYLLHIGFCIFAAVAPPVVFR  237

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL A+D+   HVLVG                       IFY VGFGLFCLE++L
Sbjct  238   GKSLAGILPAVDLIGKHVLVG-----------------------IFYFVGFGLFCLESVL  274

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  275   SIWVIQ  280



>sp|A2YMP7.1|SCAM1_ORYSI RecName: Full=Putative secretory carrier-associated membrane 
protein 1; Short=Secretory carrier membrane protein 1 [Oryza 
sativa Indica Group]
 gb|EAZ04358.1| hypothetical protein OsI_26498 [Oryza sativa Indica Group]
Length=306

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 202/307 (66%), Gaps = 52/307 (17%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG--GNAPGSKS------------RIPQMVANT------  1166
             M  R D NPF  EE +VNPFS    G A G  S             +P M +N+      
Sbjct  1     MAGRYDSNPF--EEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSMSSNSRLSPLP  58

Query  1165  ---LGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  FG    ATVDIPLDS  D K ++KEL A EA+L +RE ++KRRE+A A AG+ + 
Sbjct  59    PEPAAFG----ATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIE  114

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPF P+IHHDI NEIP   Q+MQY+AFAS+LG+  CL +N++AVT  W+KG+GVKI
Sbjct  115   EKNWPPFLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKI  174

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             +LLAIIY + G P +YVLWYRPLYNAMRT+SALKFG FF+ YL HI FC+F+A+APP++F
Sbjct  175   WLLAIIYFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVF  234

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSL GIL AID+ S + LVG                       IFY VGFGLFC+E+L
Sbjct  235   EGKSLAGILPAIDLISKNALVG-----------------------IFYFVGFGLFCVESL  271

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  272   LSIWVIQ  278



>ref|NP_001060004.1| Os07g0564600 [Oryza sativa Japonica Group]
 sp|Q8H5X5.1|SCAM1_ORYSJ RecName: Full=Secretory carrier-associated membrane protein 1; 
Short=Secretory carrier membrane protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAC15812.1| putative secretory carrier membrane protein [Oryza sativa Japonica 
Group]
 dbj|BAF21918.1| Os07g0564600 [Oryza sativa Japonica Group]
 gb|EAZ40313.1| hypothetical protein OsJ_24759 [Oryza sativa Japonica Group]
 dbj|BAG87744.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95389.1| unnamed protein product [Oryza sativa Japonica Group]
Length=306

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 200/307 (65%), Gaps = 52/307 (17%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFS---------------------NGGNAPG--SKSRIPQMV  1175
             M  R D NPF  EE +VNPFS                     N  N P   S SR+  + 
Sbjct  1     MAGRYDSNPF--EEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSVSSNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  FG    ATVDIPLDS  D K ++KEL A EA+L +RE ++KRRE+A A AG+ + 
Sbjct  59    PEPAAFG----ATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIE  114

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPF P+IHHDI NEIP   Q+MQY+AFAS+LG+  CL +N++AVT  W+KG+GVKI
Sbjct  115   EKNWPPFLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKI  174

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             +LLAIIY + G P +YVLWYRPLYNAMRT+SALKFG FF+ YL HI FC+F+A+APP++F
Sbjct  175   WLLAIIYFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVF  234

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSL GIL AID+ S + LVG                       IFY VGFGLFC+E+L
Sbjct  235   EGKSLAGILPAIDLISKNALVG-----------------------IFYFVGFGLFCVESL  271

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  272   LSIWVIQ  278



>ref|XP_009623077.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Nicotiana tomentosiformis]
Length=308

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 199/303 (66%), Gaps = 47/303 (16%)
 Frame = -2

Query  1279  RRNDPNPFDDEEQEVNPFSNGGN---------------------APGSKSRIPQMVANTL  1163
             R  + NPFD EEQE+NPFS+ G                      AP + SR+  +     
Sbjct  4     RYYNDNPFD-EEQEMNPFSDQGARGKSQSNYGGGPFYMMNPVSVAPATNSRLSPLPHEPA  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
              + +   ATVDIPLD+  D K K+KEL A EA+L+++E ++KRREDA+A AG+ + +KNW
Sbjct  63    DYDR--GATVDIPLDNSKDLKNKEKELQAKEAELRKKEQELKRREDAIARAGIVIEEKNW  120

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI NEIP+  Q +QY+AF + LG+  CL++N++AVTV WIKG G+ I+LLA
Sbjct  121   PPFFPIIHHDIANEIPIHLQNLQYVAFTTLLGLAACLLWNLIAVTVAWIKGQGITIWLLA  180

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P +YVLWYRPLY AMRT+SALKFGWFF+ YL HIGFCI AA+APPI F GKS
Sbjct  181   IIYLISGVPGAYVLWYRPLYRAMRTDSALKFGWFFLCYLFHIGFCIIAAVAPPIFFKGKS  240

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             L GIL AID+   + LVGV                       FY +GF  FCLE+L+S+W
Sbjct  241   LAGILPAIDLLGWNGLVGV-----------------------FYFIGFAFFCLESLISIW  277

Query  442   VLQ  434
             V+Q
Sbjct  278   VIQ  280



>gb|KEH29623.1| secretory carrier-associated membrane protein [Medicago truncatula]
Length=306

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 202/303 (67%), Gaps = 49/303 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG----------------------GNAPGSKSRIPQMVANTL  1163
             R DPNPF++EE  VNPF++G                      G+ P + SR+  +     
Sbjct  3     RYDPNPFEEEETHVNPFADGTAKGKGSGQSSYGGGAFYTTNPGSVPSAASRLSPLPHEPY  62

Query  1162  GFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNW  983
                   +ATVDIPLDS  D K K+KEL A E++LK+RE ++KRREDA+A AG+ + +KNW
Sbjct  63    ----DRNATVDIPLDSSKDVKAKEKELQARESELKKREQELKRREDAIARAGIVIEEKNW  118

Query  982   PPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLA  803
             PPFFPIIHHDI  EIP+  Q+MQY+AF++WLG+VLCL++NIVAVT  WIKG+G  I+ LA
Sbjct  119   PPFFPIIHHDIGTEIPIHLQRMQYIAFSTWLGLVLCLLWNIVAVTTAWIKGEGPTIWFLA  178

Query  802   IIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKS  623
             IIY + G P SYV+WYRPLY AMRT+SALKFGWFF+ Y+LHI FCIFAA+APPIIF GKS
Sbjct  179   IIYFISGVPASYVMWYRPLYRAMRTDSALKFGWFFVSYMLHIAFCIFAAVAPPIIFKGKS  238

Query  622   LTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLW  443
             LTGILAAIDV     LVG+                          +GFG FC+E+L+S+W
Sbjct  239   LTGILAAIDVIGGSALVGIFY-----------------------FIGFGFFCIESLMSVW  275

Query  442   VLQ  434
             V Q
Sbjct  276   VFQ  278



>ref|XP_003568158.1| PREDICTED: secretory carrier-associated membrane protein 3 [Brachypodium 
distachyon]
Length=282

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 194/284 (68%), Gaps = 30/284 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  ++  N F+D++  VNPF+ G     S +R+  +     GF       VDIP+DS  D
Sbjct  1     MAGKHGRNGFEDDD--VNPFAGGSVPAASNARLSPLSHEPAGF-----YNVDIPMDSAKD  53

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              KKK+KEL A EA+L +RE ++KR+E+A + AG+ + +KNWPP FP+IHH+I NEIP+  
Sbjct  54    VKKKEKELQAMEAELNKREKELKRKEEAASRAGIVIEEKNWPPLFPLIHHNISNEIPIHL  113

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             Q+MQYLAF+S+LG+  CL +NI+A T  W+KG+GV I+LLAIIY + G P +YVLWYRPL
Sbjct  114   QRMQYLAFSSFLGLTACLFWNIIATTTAWVKGEGVMIWLLAIIYFISGVPGAYVLWYRPL  173

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             YNAMRT SALKFGWFFMFY++HI FC+++A++PP  F G SLTGIL AIDV +   +VG 
Sbjct  174   YNAMRTESALKFGWFFMFYMIHIIFCVWSAVSPPFPFKGNSLTGILPAIDVITKSAIVG-  232

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFY VGFGLFCLE+LLS+ V+Q
Sbjct  233   ----------------------IFYFVGFGLFCLESLLSIGVIQ  254



>emb|CDY12892.1| BnaA09g13820D [Brassica napus]
Length=292

 Score =   282 bits (721),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 203/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R DPNPF +EE EVNPF+N G+  P S SR+  +    +GFG  +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPGSIPPASNSRLSPLPPEPVGFG--YGRTVDIPLDNDR  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
              +  + KKK+KEL A EA+LKRRE D+KRREDA A AGV +  KNWPPFFP+IHHDI NE
Sbjct  58    SATQNLKKKEKELQAKEAELKRREQDVKRREDAAARAGVNIEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLAVIYFIAGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT+SAL FGWFF+FY+LHI F +FAA+APP++F GKSL GIL AIDV S +
Sbjct  178   WYRPLYRAFRTDSALSFGWFFLFYMLHILFTVFAAVAPPVVFKGKSLAGILPAIDVISGN  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG+                          +GFG FCLE+++S+WV+Q
Sbjct  238   TLVGIFYF-----------------------IGFGFFCLESVVSIWVIQ  263



>ref|XP_010540860.1| PREDICTED: secretory carrier-associated membrane protein 1 [Tarenaya 
hassleriana]
Length=282

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 203/294 (69%), Gaps = 30/294 (10%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKK  1097
             R D NPF  EE  VNPF+N G  P + S++  +       G    ATVDIPLDS  D K 
Sbjct  3     RYDSNPF--EEDTVNPFANPGTVPPATSKLSPLPPEPYDRG----ATVDIPLDSGKDLKA  56

Query  1096  KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKM  917
             K+KEL A EA+LKRRE ++KR+EDA+A AG+ + +KNWPPFFP+IHHDI NEIP+  Q++
Sbjct  57    KEKELQAKEAELKRREQELKRKEDAIAQAGIVIEEKNWPPFFPVIHHDIANEIPIHLQRI  116

Query  916   QYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNA  737
             QY+AF S LG+V+CL++N+VAVT  WIKG+G  I+ LAIIY + G P +YV+WYRPLY A
Sbjct  117   QYVAFTSLLGLVMCLLWNVVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRA  176

Query  736   MRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             MRT+SALKFGWFF+ YL HIGFC+FAA+APPIIF GKSLTGIL AIDV S ++LVG+   
Sbjct  177   MRTDSALKFGWFFLSYLFHIGFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFY-  235

Query  556   N*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVL-QVCDYKNGHSHTV  398
                                    +GFG FCLE+L+S+WV+ QV  Y  G    V
Sbjct  236   ----------------------FIGFGFFCLESLISIWVIQQVYMYFRGSGKAV  267



>gb|KFK40463.1| hypothetical protein AALP_AA3G376300 [Arabis alpina]
Length=412

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 191/275 (69%), Gaps = 32/275 (12%)
 Frame = -2

Query  1258  FDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKKKQKELA  1079
             FDD   EVNPF+N    P + S++  +       G        IPLDS  D K K+KEL 
Sbjct  142   FDD--GEVNPFANHATVPAAPSKLSPLPPEPYDRG-------TIPLDSGKDLKAKEKELQ  192

Query  1078  AWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKMQYLAFA  899
             A EA+L+RRE ++KR+EDA+A AG+ + +KNWPPFFP+IHHDI NEIP+  Q++QY+AF 
Sbjct  193   AKEAELRRREQELKRKEDAMAQAGIVIEEKNWPPFFPLIHHDISNEIPIHLQRIQYVAFT  252

Query  898   SWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNAMRTNSA  719
             S LG+V+CL++NIVAVT  WIKG+G  I+ LAIIY + G P +YV+WYRPLY AMRT+SA
Sbjct  253   SLLGLVVCLLWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRAMRTDSA  312

Query  718   LKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCCN*HLPS  539
             LKFGWFF  YL HIGFC+FAA+APPIIF GKSLTGIL AIDV S ++LVG          
Sbjct  313   LKFGWFFFTYLFHIGFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVG----------  362

Query  538   SIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                          IFY +GF  FCLE+L+S+WV+Q
Sbjct  363   -------------IFYFIGFAFFCLESLVSIWVIQ  384



>ref|XP_009113142.1| PREDICTED: secretory carrier-associated membrane protein 3 [Brassica 
rapa]
Length=291

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 203/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R DPNPF +EE EVNPF+N G+  P S SR+  +    +GFG  +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPGSIPPASNSRLSPLPPEPVGFG--YGRTVDIPLDNDR  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
              +  + KKK+KEL A EA+LKRRE D+KRREDA A AGV +  KNWPPFFP+IHHDI NE
Sbjct  58    SATQNLKKKEKELQAKEAELKRREQDVKRREDAAARAGVNIEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLAVIYFIAGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT+SAL FGWFF+FY+LHI F +FAA+APP++F GKSL GIL AIDV S +
Sbjct  178   WYRPLYRAFRTDSALSFGWFFLFYMLHILFTVFAAVAPPVVFKGKSLAGILPAIDVISGN  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG+                          +GFG FCLE+++S+WV+Q
Sbjct  238   TLVGIFYF-----------------------IGFGFFCLESVVSIWVIQ  263



>ref|XP_010657282.1| PREDICTED: secretory carrier-associated membrane protein 1 isoform 
X2 [Vitis vinifera]
Length=249

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 188/284 (66%), Gaps = 63/284 (22%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLND  1106
             M  R + NPFD+E+  VNPF+                                      D
Sbjct  1     MAGRYESNPFDEED--VNPFA--------------------------------------D  20

Query  1105  PKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVES  926
              K K++EL A EA+LK+RE ++KRREDAVA AG+ + +KNWPPFFP+IHHDI NEIP+  
Sbjct  21    TKAKERELQAKEAELKKREQELKRREDAVARAGIVIEEKNWPPFFPLIHHDIANEIPIHQ  80

Query  925   QKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPL  746
             QK+QY+AF ++LG+VLCL +NIVAVT  WIKG+G  I+ LAIIY L G P +YVLWYRPL
Sbjct  81    QKLQYVAFTTYLGLVLCLTWNIVAVTTAWIKGEGPTIWFLAIIYFLSGVPGAYVLWYRPL  140

Query  745   YNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGV  566
             Y AMRT+SALKFGWFF+FYLLHI FCIFA++APPI+F GKSLTGIL A+D+ S H LVG 
Sbjct  141   YRAMRTDSALKFGWFFLFYLLHIAFCIFASVAPPIVFKGKSLTGILPAVDLLSKHALVG-  199

Query  565   SCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                   IFYL+GFGLFCLE+LLS+WV+Q
Sbjct  200   ----------------------IFYLIGFGLFCLESLLSIWVVQ  221



>emb|CDY40956.1| BnaCnng09990D [Brassica napus]
Length=292

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/289 (56%), Positives = 203/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN-APGSKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R DPNPF +EE EVNPF+N G+  P S SR+  +    +GFG  +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPGSIPPASNSRLSPLPPEPVGFG--YGRTVDIPLDNER  57

Query  1117  -SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
              +  + KKK+KEL A EA+LKRRE D+KRREDA A AGV +  KNWPPFFP+IHHDI NE
Sbjct  58    SATQNLKKKEKELQAKEAELKRREQDVKRREDAAARAGVNIEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IP+  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPIHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLAVIYFIAGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT+SAL FGWFF+FY+LHI F +FAA+APP++F GKSL GIL AIDV S +
Sbjct  178   WYRPLYRAFRTDSALSFGWFFLFYMLHILFSVFAAVAPPVVFKGKSLAGILPAIDVISGN  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG+                          +GFG FCLE+++S+WV+Q
Sbjct  238   TLVGIFYF-----------------------IGFGFFCLESVVSIWVIQ  263



>ref|XP_010418095.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
[Camelina sativa]
Length=290

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 200/288 (69%), Gaps = 30/288 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R DPNPF +EE EVNPF+N  G  P S SR+  +    +GF   +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPKGVPPASNSRLSPLPPEPVGF--DYGRTVDIPLDRPG  57

Query  1117  SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEI  938
                D KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFPIIHHDI NEI
Sbjct  58    GTQDLKKKEKELQAKEAELRRREQDLKRKEDAAARAGIVIEVKNWPPFFPIIHHDIANEI  117

Query  937   PVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLW  758
             PV  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLW
Sbjct  118   PVHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLAVIYFIAGVPGGYVLW  177

Query  757   YRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHV  578
             YRPLY A RT+SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S   
Sbjct  178   YRPLYRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQA  237

Query  577   LVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +VG+                          +GFG FCLE+++S+WV+Q
Sbjct  238   IVGIFY-----------------------FIGFGFFCLESVVSIWVIQ  262



>ref|XP_010430139.1| PREDICTED: secretory carrier-associated membrane protein 3 [Camelina 
sativa]
Length=290

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 200/288 (69%), Gaps = 30/288 (10%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-GGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLD---  1118
             M  R DPNPF +EE EVNPF+N  G  P S SR+  +    +GF   +  TVDIPLD   
Sbjct  1     MANRYDPNPFAEEE-EVNPFANPKGVPPASNSRLSPLPPEPVGF--DYGRTVDIPLDRPG  57

Query  1117  SLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEI  938
                D KKK+KEL A EA+L+RRE D+KR+EDA A AG+ +  KNWPPFFPIIHHDI NEI
Sbjct  58    GTQDLKKKEKELQAKEAELRRREQDLKRKEDAAARAGIVIEVKNWPPFFPIIHHDIANEI  117

Query  937   PVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLW  758
             PV  Q++QY+ FA++LG+VLCL +NI+AVT  WIKG+GV I+LLA+IY + G P  YVLW
Sbjct  118   PVHLQRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLAVIYFIAGVPGGYVLW  177

Query  757   YRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHV  578
             YRPLY A RT+SAL FGWFF+FY+LHI FC+FAA+APP++F GKSL GIL AIDV S   
Sbjct  178   YRPLYRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQA  237

Query  577   LVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +VG+                          +GFG FCLE+++S+WV+Q
Sbjct  238   IVGIFY-----------------------FIGFGFFCLESVVSIWVIQ  262



>sp|Q9ZTX0.1|SCAM_PEA RecName: Full=Secretory carrier-associated membrane protein; 
Short=Secretory carrier membrane protein [Pisum sativum]
 gb|AAC82326.1| similarity to SCAMP37 [Pisum sativum]
Length=289

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 201/285 (71%), Gaps = 26/285 (9%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R DPNPFD  E++VNPFSN  +A   + SR   +  +   +      TVDIPLD+  
Sbjct  1     MAGRYDPNPFD--EEQVNPFSNPRSAASATNSRPAPLNPDRADYNYGFGPTVDIPLDTST  58

Query  1108  DPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVE  929
             D KKK+++L A EA+L++RE +++R+E+A+A AG+ + +KNWPPFFPIIHHDI NEIP+ 
Sbjct  59    DGKKKERDLQAKEAELRKREQEVRRKEEAIARAGIVIEEKNWPPFFPIIHHDITNEIPIH  118

Query  928   SQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRP  749
              + +QY+AF S LG+VLCL +N+V+VT  WIKG+GVKI+ LAIIY + G P +Y LWYRP
Sbjct  119   LRTLQYVAFFSLLGLVLCLTWNVVSVTAAWIKGEGVKIWFLAIIYFIAGVPGAYALWYRP  178

Query  748   LYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVG  569
             LY A RT+SA+KFGWFFMFYLLHIGFCI AA+APPI+F GKSLTGIL+AIDV  D+ LVG
Sbjct  179   LYRAFRTDSAIKFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILSAIDVVGDYTLVG  238

Query  568   VSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +                          +GFG FCLE L+S+WV+Q
Sbjct  239   IFY-----------------------FIGFGFFCLETLISIWVIQ  260



>ref|XP_009763334.1| PREDICTED: secretory carrier-associated membrane protein 2-like 
[Nicotiana sylvestris]
Length=309

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 200/306 (65%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGN----------------------APGSKSRIPQMVA  1172
             M  R D NPFD EE+EVNPF++GG                          + SR+  +  
Sbjct  1     MAGRYDRNPFD-EEEEVNPFADGGGRGKSSGQSKFSGGAFNITSGSVPSATNSRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F  + +A++DIPLDS  D KKK+KEL A E++L+RRE ++K+REDA A AG+ +  
Sbjct  60    EPADFYDR-NASIDIPLDSSADLKKKEKELQAKESELRRREQELKKREDAAARAGIVIEK  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG++ CLV+NIVA T  WIK   VKI+
Sbjct  119   KNWPPFFPIIHHDIGNEIPIHLQKLQYVAFTTFLGLIACLVWNIVATTTAWIKEGDVKIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              L+IIY + G P +Y LWYRPLY A RT  A+KF WFF+FY++HI FCIFAA+APP++F 
Sbjct  179   FLSIIYFISGVPGAYFLWYRPLYRAFRTEGAMKFAWFFLFYMVHIIFCIFAAVAPPVVFR  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+   +VLVG                       IFY +GFGLFCLE++L
Sbjct  239   GKSLTGILPAVDLIGKNVLVG-----------------------IFYFIGFGLFCLESVL  275

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  276   SIWVIQ  281



>ref|XP_004251795.1| PREDICTED: secretory carrier-associated membrane protein 1 [Solanum 
lycopersicum]
Length=308

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 198/306 (65%), Gaps = 47/306 (15%)
 Frame = -2

Query  1288  IMNRRNDPNPFDDEEQEVNPFSNGGN---------------------APGSKSRIPQMVA  1172
             +  R  + NPFD E QE NPF++ G                       P + SR+  +  
Sbjct  1     MAGRYYNDNPFD-EGQEDNPFTDQGTRGKGQSNYGSGPFYMMNPASVPPATNSRLSPLPH  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 + +   ATVDIPLD+  D K K+KEL A EA+LK+ E D+KRREDA+A AGV + +
Sbjct  60    EPADYDR--GATVDIPLDNPKDLKNKEKELQAKEAELKKLEQDLKRREDAIARAGVVIEE  117

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF +WLG+V CL++N++AVT  WIKG+G+ I+
Sbjct  118   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFFTWLGLVACLLWNLIAVTSAWIKGEGITIW  177

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
             LLAIIY + G P +YVLWYRPLY+AMRT+SALKFGWFF+ YL HIGFCI A +APPI F 
Sbjct  178   LLAIIYLISGVPGAYVLWYRPLYHAMRTDSALKFGWFFLCYLFHIGFCIIATVAPPIFFK  237

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL AID+   + LVGV                       FY +GF  FC+E+L 
Sbjct  238   GKSLAGILPAIDLIGWNGLVGV-----------------------FYFIGFAFFCIESLT  274

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  275   SIWVIQ  280



>gb|EMS49280.1| Secretory carrier-associated membrane protein 3 [Triticum urartu]
Length=294

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 195/292 (67%), Gaps = 45/292 (15%)
 Frame = -2

Query  1264  NPFDDEEQEVNPFSN---------------GGNAPGSKSRIPQMVANTLGFGQKHDATVD  1130
             N F+D++  VNPF+                G   P S SR+  +     GF       VD
Sbjct  5     NGFEDDD--VNPFAGLGHYVWWNDGSVCQGGSVPPASNSRLSPLSHEPAGF-----YNVD  57

Query  1129  IPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDI  950
             IP+DS  D KKK+KEL A EA+L +RE ++KR+E+A + AG+ + DKNWPPFFP+IHH+I
Sbjct  58    IPMDSTKDVKKKEKELQAMEAELNKREKELKRKEEAASRAGIVIEDKNWPPFFPLIHHNI  117

Query  949   VNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLS  770
              NEIP+  QKMQYLAF+S+LGI LCL +NI+A T  WIKG+GV ++LLAIIY + G P +
Sbjct  118   SNEIPIHLQKMQYLAFSSFLGIALCLFFNIIATTTAWIKGEGVMVWLLAIIYFISGVPGA  177

Query  769   YVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVF  590
             YVLWYRPLYNAMRT SALKFGWFF+FY++HI FC+++A++PP  F G SLTGIL AIDV 
Sbjct  178   YVLWYRPLYNAMRTESALKFGWFFLFYMIHIIFCVWSAVSPPFPFKGNSLTGILPAIDVI  237

Query  589   SDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
             +  ++VG                       IFY VGFGLFCLE+LLS+ V+Q
Sbjct  238   TKSLIVG-----------------------IFYFVGFGLFCLESLLSIGVIQ  266



>ref|XP_007043517.1| Secretory carrier membrane protein (SCAMP) family protein isoform 
3 [Theobroma cacao]
 gb|EOX99348.1| Secretory carrier membrane protein (SCAMP) family protein isoform 
3 [Theobroma cacao]
Length=263

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 184/259 (71%), Gaps = 27/259 (10%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFS---------------------NGGNAPGSKSRIPQMVANTLG  1160
             R D NPFD  E+EVNPFS                     N G+ P + SR+  +      
Sbjct  3     RFDSNPFD--EEEVNPFSDPAVRKGSAQSNYGGGAFYTTNPGSVPPATSRLSPLPPEPYD  60

Query  1159  FGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWP  980
              G    AT+DIPLDS  D K K+KEL A EA+LK+RE ++KR+EDA+A AG+ + +KNWP
Sbjct  61    RG----ATIDIPLDSAKDLKAKEKELQAKEAELKKREQELKRKEDAIARAGIVIEEKNWP  116

Query  979   PFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAI  800
             P+FPIIHHDI NEIP+  QKMQY+AF + LG+VLCL +NI+AVT  WIKG+G  I+ LAI
Sbjct  117   PYFPIIHHDIANEIPIHLQKMQYVAFTTLLGLVLCLSWNIIAVTTAWIKGEGPTIWFLAI  176

Query  799   IYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSL  620
             IY + G P  YVLWYRPLY AMRT+SALKFGWFF+FYLLHIGFCIFAA+APPIIF GKSL
Sbjct  177   IYFISGVPGGYVLWYRPLYRAMRTDSALKFGWFFLFYLLHIGFCIFAAVAPPIIFKGKSL  236

Query  619   TGILAAIDVFSDHVLVGVS  563
              GIL AID+  +H LVGVS
Sbjct  237   AGILPAIDLLGNHALVGVS  255



>ref|XP_009767609.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Nicotiana sylvestris]
Length=308

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 200/306 (65%), Gaps = 47/306 (15%)
 Frame = -2

Query  1288  IMNRRNDPNPFDDEEQEVNPFSNGGN---------------------APGSKSRIPQMVA  1172
             +  R  + NPFD EE+E++PFS+ G                      AP + SR+  +  
Sbjct  1     MAGRYYNDNPFD-EEEEMSPFSDEGARGKSQSNYGGGPFYMMNPVSVAPATNSRLSPLPH  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 + +   ATVDIPLD+  D K K+KEL A EA+L+++E ++KRREDA+A AG+ + +
Sbjct  60    EPADYDR--GATVDIPLDNSKDLKNKEKELQAKEAELRKKEQELKRREDAIARAGIVIEE  117

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  Q +QY+AF + LG+  CL++N++AVTV WIKG G+ I+
Sbjct  118   KNWPPFFPIIHHDIANEIPIHLQNLQYVAFTTLLGLAACLLWNLIAVTVAWIKGQGITIW  177

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
             LLAIIY + G P +YVLWYRPLY AMRT+SALKFGWFF+ YL HIGFCI AA+APPI F 
Sbjct  178   LLAIIYLISGVPGAYVLWYRPLYRAMRTDSALKFGWFFLCYLFHIGFCIIAAVAPPIFFK  237

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL AID+   + LVGV                       FY +GF  FCLE+L+
Sbjct  238   GKSLAGILPAIDLLGWNGLVGV-----------------------FYFIGFAFFCLESLI  274

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  275   SIWVIQ  280



>ref|XP_006347094.1| PREDICTED: putative secretory carrier-associated membrane protein 
1-like [Solanum tuberosum]
Length=309

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 201/306 (66%), Gaps = 47/306 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN----------------------GGNAPGSKSRIPQMVA  1172
             M  R D NPF+ EE+EVNPF++                      G   P + SR+  +  
Sbjct  1     MAGRYDHNPFE-EEEEVNPFADGGGRGKSSGKSKFSGGAFYTTSGSVPPATNSRLSPLPP  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 F  + +A++DIPLD+ +D KKK+KEL + E +L+RRE D+KRREDA A AG+ + +
Sbjct  60    EPADFYDR-NASIDIPLDNASDLKKKEKELQSKENELRRREQDLKRREDAAARAGIVLEE  118

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF ++LG++ CL++NIVA T  WIK   VKI+
Sbjct  119   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLIACLLWNIVATTTAWIKEGDVKIW  178

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
              L+IIY + G P +Y +WYRPLY A RT  A+KF WFF+FY++HI FC+FAA+APP++F 
Sbjct  179   FLSIIYFISGVPGAYFMWYRPLYRAFRTEGAMKFAWFFLFYVVHIVFCVFAAVAPPVVFR  238

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSLTGIL A+D+   +VLVG                       IFY +GFGLFCLE+LL
Sbjct  239   GKSLTGILPAVDLIGKNVLVG-----------------------IFYFIGFGLFCLESLL  275

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  276   SIWVIQ  281



>ref|XP_004134729.1| PREDICTED: secretory carrier-associated membrane protein 3 [Cucumis 
sativus]
 gb|KGN49189.1| hypothetical protein Csa_6G516970 [Cucumis sativus]
Length=295

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 204/291 (70%), Gaps = 31/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAP-GSKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD EE+EVNPF+N G+ P  + SR+  +    + F     ATVDIPLDS +
Sbjct  1     MAGRYDRNPFD-EEEEVNPFANPGSVPPATNSRLSPLPPEPVDFNYGRGATVDIPLDSNS  59

Query  1108  DPKK------KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
             +         K+KEL A EADL+RRE ++KRREDA   AG+ + +KNWPPFFPIIHHDI 
Sbjct  60    EGSNYKDLKKKEKELQAKEADLRRREQEVKRREDAANRAGIVLEEKNWPPFFPIIHHDIA  119

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             N+IP+  Q++QY+AF + LG+ LCL++NIVAVT  WIKG+GVKI+ LA+IY + G P  Y
Sbjct  120   NDIPIHLQRLQYVAFTTLLGLTLCLLWNIVAVTTAWIKGEGVKIWFLAVIYFIAGVPGGY  179

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
              LWYRPLYNA R+ SA+KFGWFFMFYLLHIGFCIFAA+APPI+F GKSLTGIL AID+  
Sbjct  180   FLWYRPLYNASRSESAMKFGWFFMFYLLHIGFCIFAAVAPPIVFRGKSLTGILPAIDLIG  239

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
               VLVG                       IFY +GFGLFCLE++LS+WV+Q
Sbjct  240   GQVLVG-----------------------IFYFIGFGLFCLESVLSIWVIQ  267



>ref|XP_011039763.1| PREDICTED: secretory carrier-associated membrane protein 1 isoform 
X2 [Populus euphratica]
Length=282

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 197/281 (70%), Gaps = 29/281 (10%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKK  1097
             R D NPF  EE+EVNPF+N G+ P + SR+  +       G    ATVDIPLDS  D K 
Sbjct  3     RYDSNPF--EEEEVNPFANPGSVPPATSRLSPLPHEPYDRG----ATVDIPLDSGKDLKA  56

Query  1096  KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKM  917
             K+KEL A EA+LKRRE ++KR+EDA+A AG+ + DKNWPPFFPIIHHDI NEIP+  QK+
Sbjct  57    KEKELQAKEAELKRREQELKRKEDAIARAGIVIEDKNWPPFFPIIHHDIGNEIPIHLQKI  116

Query  916   QYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNA  737
             QY+AF ++LG+ +CL +NIVAVT  WIKG+G  I+ LAIIY + G P  YV+WYRPLY A
Sbjct  117   QYVAFTTFLGLFVCLSWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGGYVMWYRPLYRA  176

Query  736   MRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             MRT+SALKFGW F+ YLLHIGFCIFAA+APPI+F GKSL GIL AID+   H LVG+   
Sbjct  177   MRTDSALKFGWSFLAYLLHIGFCIFAAVAPPIVFKGKSLAGILPAIDLMGSHALVGIFY-  235

Query  556   N*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    +GFG FC+E+LLS+WV+Q
Sbjct  236   ----------------------FIGFGFFCVESLLSVWVIQ  254



>ref|XP_004507204.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Cicer arietinum]
Length=307

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 201/304 (66%), Gaps = 50/304 (16%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNG-----------------------GNAPGSKSRIPQMVANT  1166
             R DPNPF++E+   NPF++G                       G+ P + SR+  +    
Sbjct  3     RYDPNPFEEEDLHENPFADGVAKGKGGSGQSSYGGGAFYTTNPGSVPSATSRLSPLPPEP  62

Query  1165  LGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKN  986
                G    AT+DIPLD   D K K+KEL A E++LK+RE +IKRREDA+A AG+ + +KN
Sbjct  63    YDRG----ATIDIPLDGSKDVKAKEKELQARESELKKREQEIKRREDAIARAGIVIEEKN  118

Query  985   WPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLL  806
             WPPFFPIIHHDI NEIP+  Q++QY+AF +WLG+VLCL++NIVAVT  WIKG+G  I+ L
Sbjct  119   WPPFFPIIHHDIGNEIPIHLQRLQYVAFTTWLGLVLCLLWNIVAVTTAWIKGEGPTIWFL  178

Query  805   AIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGK  626
             AIIY + G P SYV+WYRPLY AMRT+SALKFGWFF+ Y+LHIGFCIFAA+APPIIF GK
Sbjct  179   AIIYFISGVPGSYVMWYRPLYRAMRTDSALKFGWFFVAYMLHIGFCIFAAVAPPIIFKGK  238

Query  625   SLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSL  446
             SLTGILAAIDV     LVG+                          +GFG FCLE+LLS+
Sbjct  239   SLTGILAAIDVIGGSALVGIFY-----------------------FIGFGFFCLESLLSV  275

Query  445   WVLQ  434
             WV Q
Sbjct  276   WVFQ  279



>gb|ADE77955.1| unknown [Picea sitchensis]
Length=311

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 205/307 (67%), Gaps = 47/307 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNG---GNAPG--------------------SKSRIPQMV  1175
             M  R D NPF+ EE EVNPFS+    G  PG                    + SR+  + 
Sbjct  1     MGSRYDANPFEPEE-EVNPFSDPSVRGQMPGQSNFSGGAFYTTHTGSVPSVAGSRLSPLP  59

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPL +  D KKK+KEL A EA+LKRRE D+KRRE+A A AG+ + 
Sbjct  60    PEPADFSYDRGATVDIPLGTTKDFKKKEKELEAKEAELKRREQDLKRREEAAARAGIVLE  119

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI  EIP   Q++QY AF++WLGIVLCLV+N VAVT+ WI+G GVKI
Sbjct  120   EKNWPPFFPIIHHDITREIPTHLQRLQYTAFSTWLGIVLCLVWNFVAVTIAWIRGYGVKI  179

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIYA+ GCP +YVLWYRPLY AMRT SA+KFG FF+FYLLHIGFC+FAA+APP++F
Sbjct  180   WFLAIIYAIAGCPGAYVLWYRPLYRAMRTESAIKFGRFFLFYLLHIGFCVFAAVAPPVVF  239

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSL GIL  IDVFSDH+LVG                       IFYL+GF LF LE++
Sbjct  240   KGKSLAGILPTIDVFSDHLLVG-----------------------IFYLIGFILFTLESI  276

Query  454   LSLWVLQ  434
             +S+ V+Q
Sbjct  277   ISVRVIQ  283



>ref|XP_008439906.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Cucumis melo]
Length=295

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 204/291 (70%), Gaps = 31/291 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPLDSLN  1109
             M  R D NPFD EE+EVNPF+N G+ P  + SR+  +    + F     ATVDIPLDS +
Sbjct  1     MAGRYDRNPFD-EEEEVNPFANPGSVPAATNSRLSPLPPEPVDFNYGRGATVDIPLDSNS  59

Query  1108  DPKK------KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIV  947
             +         K+KEL A EA+L+RRE ++KRREDA   AG+ + +KNWPPFFPIIHHDI 
Sbjct  60    EGSNYKDLKKKEKELQAKEAELRRREQEVKRREDAANRAGIVLEEKNWPPFFPIIHHDIA  119

Query  946   NEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSY  767
             N+IP+  Q++QY+AF + LG+ LCL++NIVAVT  WIKG+GVKI+ LA+IY + G P  Y
Sbjct  120   NDIPIHLQRLQYVAFTTLLGLTLCLLWNIVAVTTAWIKGEGVKIWFLAVIYFIAGVPGGY  179

Query  766   VLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFS  587
              LWYRPLYNA R+ SA+KFGWFFMFYLLHIGFCIFAA+APPI+F GKSLTGIL AID+  
Sbjct  180   FLWYRPLYNASRSESAMKFGWFFMFYLLHIGFCIFAAVAPPIVFRGKSLTGILPAIDLIG  239

Query  586   DHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
               VLVG                       IFY +GFGLFCLE++LS+WV+Q
Sbjct  240   SRVLVG-----------------------IFYFIGFGLFCLESVLSIWVIQ  267



>ref|XP_010057474.1| PREDICTED: secretory carrier-associated membrane protein 3-like 
isoform X2 [Eucalyptus grandis]
Length=304

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 203/302 (67%), Gaps = 44/302 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN------------GGNAPGS--KSRIPQMVANTLGFGQK  1148
             M  R + NPFD+EE  VNPFS+            GG + G    SR+  +      F  +
Sbjct  1     MAGRYEKNPFDEEE--VNPFSDPAVRTKASTKYGGGCSTGGLPNSRLSPLPPEPADFYDR  58

Query  1147  HDATVDIPLDS----LNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWP  980
               AT+DIPLD+      D K+K++EL A EA+LK+RE +++R+E+A+A AGV + +KNWP
Sbjct  59    -GATIDIPLDTAGSGYQDLKRKERELQAKEAELKKREQEVRRKEEALARAGVTIEEKNWP  117

Query  979   PFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAI  800
             PF PIIHHDI NEIP+  Q++QY+AF ++LG+VLCL +NI+AVT  WIKG+GVKI+ LA+
Sbjct  118   PFLPIIHHDIANEIPIHLQRLQYVAFTTFLGMVLCLFWNIIAVTTAWIKGEGVKIWFLAL  177

Query  799   IYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSL  620
             IY + G P +Y LWYRPLY A RT+SA++FGWFF+FYLLHIGFCI AA+APPI+F G SL
Sbjct  178   IYFISGAPGAYFLWYRPLYRAFRTDSAIRFGWFFLFYLLHIGFCIIAAVAPPIVFKGNSL  237

Query  619   TGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWV  440
              GILAAI++ +   +V                        IFY VGFGLFC+E LLS+WV
Sbjct  238   AGILAAINLSNKGAIVA-----------------------IFYFVGFGLFCVETLLSIWV  274

Query  439   LQ  434
             +Q
Sbjct  275   IQ  276



>ref|XP_008800152.1| PREDICTED: secretory carrier-associated membrane protein 1-like 
[Phoenix dactylifera]
Length=310

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 202/307 (66%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPFD  E+EVNPF++                       G   P S SR+  + 
Sbjct  1     MAGRYDSNPFD--EEEVNPFADPRVRGKVAGQSNYGGGPFYTTHPGSVPPASNSRLSPLP  58

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     ATVDIPLD+  D KK++KEL A EA+L +RE ++KRRE+A A AGV + 
Sbjct  59    PEPADFYDDRSATVDIPLDTSKDLKKREKELQAKEAELNKREKELKRREEAAARAGVVIE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  Q++QY AFAS LG+  CL +NI+AVT  WIKG+GVKI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQRLQYFAFASLLGLTACLFWNIIAVTTAWIKGEGVKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             +LLAIIY + G P +YVLWYRPLY AMRT+SA++FG FF+ YLLHIGFCIF+A+APPIIF
Sbjct  179   WLLAIIYFISGVPGAYVLWYRPLYRAMRTDSAMRFGLFFLLYLLHIGFCIFSAVAPPIIF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSLTGIL AID+ S   LVG                       IFY +GFGLFCLE+L
Sbjct  239   KGKSLTGILPAIDLISGKALVG-----------------------IFYFIGFGLFCLESL  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSIWVIQ  282



>ref|XP_010931923.1| PREDICTED: secretory carrier-associated membrane protein 2 isoform 
X1 [Elaeis guineensis]
Length=308

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 203/305 (67%), Gaps = 46/305 (15%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-------------GGNA-----PGSK---SRIPQMVAN  1169
             M  R DPNPF  EE++VNPFS              GG       PGS    SR+  +   
Sbjct  1     MAGRFDPNPF--EEEQVNPFSEPTLQGKATRQSNYGGGPFYTTHPGSSLSDSRLSPLPPE  58

Query  1168  TLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDK  989
                F      T DIP+D+  D K+K+KEL A EA L++RE ++KRREDA++ AGV + +K
Sbjct  59    PAEFYNDRGVTRDIPVDTTKDLKRKEKELQAKEAALRKREQELKRREDALSRAGVVLEEK  118

Query  988   NWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFL  809
             NWPP FPIIHHDI NEIP+ SQ+MQYLAFAS+LG+  CL +NI+AVT   IKG+GVKI+ 
Sbjct  119   NWPPCFPIIHHDIANEIPIYSQRMQYLAFASFLGLTACLFWNIIAVTTALIKGEGVKIWF  178

Query  808   LAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHG  629
             L+IIY + GCPL+YVLWYRPLY AMRT SA+KFGWFFMFY++HI FCI+ A+APP  F G
Sbjct  179   LSIIYFISGCPLAYVLWYRPLYRAMRTESAMKFGWFFMFYMVHIAFCIYCAVAPPFPFKG  238

Query  628   KSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLS  449
             KSLTGILAAIDV  D+VLVG+                        Y +GFG FC+E+L+S
Sbjct  239   KSLTGILAAIDVIGDNVLVGIF-----------------------YFIGFGFFCIESLIS  275

Query  448   LWVLQ  434
             +WV+Q
Sbjct  276   IWVIQ  280



>emb|CDY15009.1| BnaCnng04120D [Brassica napus]
Length=292

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 201/289 (70%), Gaps = 31/289 (11%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSNGGNAPG-SKSRIPQMVANTLGFGQKHDATVDIPL----  1121
             M  R DPNPF  EE+EVNPF+N G+ P  S SR+  +  + +GF   +  TVDIPL    
Sbjct  1     MANRYDPNPFA-EEEEVNPFANDGSVPAASNSRLSPLPPDPVGF--DYGRTVDIPLGNDR  57

Query  1120  DSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNE  941
                 + KKK+KEL A EADL+RRE ++KRREDA A AG+    KNWPPFFP+IHHDI NE
Sbjct  58    SGTQNLKKKEKELQAKEADLRRREQEVKRREDAAARAGITTEVKNWPPFFPLIHHDIANE  117

Query  940   IPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVL  761
             IPV  Q++QY+ FA++LG+VLCL +NI+A+T  WIKG+GV I+LLA+IY + G P  YVL
Sbjct  118   IPVHLQRLQYVTFATYLGLVLCLFWNIIAITTAWIKGEGVTIWLLALIYFIAGVPGGYVL  177

Query  760   WYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDH  581
             WYRPLY A RT+SAL FGWFFMFY+LHI FC+FAA+APP++F GKSL GIL A+DV S +
Sbjct  178   WYRPLYRAFRTDSALSFGWFFMFYMLHIVFCVFAAVAPPVVFKGKSLAGILPAVDVLSGN  237

Query  580   VLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
              LVG+                          +GFG FC+E+++S+WV+Q
Sbjct  238   TLVGIFY-----------------------FIGFGFFCMESVVSIWVIQ  263



>gb|EYU27957.1| hypothetical protein MIMGU_mgv1a010497mg [Erythranthe guttata]
Length=310

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 196/307 (64%), Gaps = 48/307 (16%)
 Frame = -2

Query  1285  MNRRNDPNPFDDEEQEVNPFSN-----------------------GGNAPGSKSRIPQMV  1175
             M  R D NPFD E  EVNPFS+                       G   P S SR+  + 
Sbjct  1     MAGRYDSNPFD-EGDEVNPFSDGGGKGKAAGQSKFSRGSFYTSNTGSVPPASNSRLSPLP  59

Query  1174  ANTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVS  995
                  F     A+VDI LDS +D KKK++EL A E++LKRRE +++R+E+AVA AG+ + 
Sbjct  60    PEPADF-YNPTASVDISLDSASDLKKKERELQAKESELKRREQEVRRKEEAVARAGIVIE  118

Query  994   DKNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKI  815
             +KNWPPFFPIIHHDI NEIP+  QK+QY+AF + LG+   L++N++AVT  WIK    KI
Sbjct  119   EKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTLLGLAFALLWNVIAVTTAWIKQGDAKI  178

Query  814   FLLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiF  635
             + LAIIY + G P +YVLWYRPLY A R  SALKFGWFF+FY+LHIGF IFAA+APP++F
Sbjct  179   WFLAIIYFISGVPGAYVLWYRPLYRAFRNESALKFGWFFLFYMLHIGFVIFAAVAPPVVF  238

Query  634   HGKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEAL  455
              GKSL GIL A+D+   HVLVG                       IFY +GFGLFC+EA+
Sbjct  239   KGKSLAGILPAVDLIGQHVLVG-----------------------IFYFIGFGLFCVEAV  275

Query  454   LSLWVLQ  434
             LS+WV+Q
Sbjct  276   LSVWVIQ  282



>ref|XP_006371596.1| secretory carrier membrane family protein [Populus trichocarpa]
 gb|ERP49393.1| secretory carrier membrane family protein [Populus trichocarpa]
Length=282

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 197/281 (70%), Gaps = 29/281 (10%)
 Frame = -2

Query  1276  RNDPNPFDDEEQEVNPFSNGGNAPGSKSRIPQMVANTLGFGQKHDATVDIPLDSLNDPKK  1097
             R D NPF  EE+EVNPF+N G+ P + SR+  +       G    AT+DIPLDS  + K 
Sbjct  3     RYDSNPF--EEEEVNPFANPGSVPPATSRLSPLPHEPYDRG----ATIDIPLDSGKELKA  56

Query  1096  KQKELAAWEADLKRREMDIKRREDAVAGAGVPVSDKNWPPFFPIIHHDIVNEIPVESQKM  917
             K+KEL A EA+LKRRE ++KR+EDA+A AG+ + DKNWPPFFPIIHHDI NEIP+  QK+
Sbjct  57    KEKELQAKEAELKRREQELKRKEDAIARAGIVIEDKNWPPFFPIIHHDIGNEIPIHLQKI  116

Query  916   QYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIFLLAIIYALMGCPLSYVLWYRPLYNA  737
             QY+AF ++LG+ +CL +NIVAVT  WIKG+G  I+ LAIIY + G P  YV+WYRPLY A
Sbjct  117   QYVAFTTFLGLFVCLSWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGGYVMWYRPLYRA  176

Query  736   MRTNSALKFGWFFMFYLLHIGFCifaaiappiiFHGKSLTGILAAIDVFSDHVLVGVSCC  557
             MRT+SALKFGWF + YLLHIGFCIFAA+APPI+F GKSL GIL AID+   H LVG+   
Sbjct  177   MRTDSALKFGWFLLAYLLHIGFCIFAAVAPPIVFKGKSLAGILPAIDLMGSHALVGIFY-  235

Query  556   N*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALLSLWVLQ  434
                                    +GFG FC+E+LLS+WV+Q
Sbjct  236   ----------------------FIGFGFFCVESLLSVWVIQ  254



>ref|XP_006350043.1| PREDICTED: putative secretory carrier-associated membrane protein 
1-like [Solanum tuberosum]
Length=308

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 195/306 (64%), Gaps = 47/306 (15%)
 Frame = -2

Query  1288  IMNRRNDPNPFDDEEQEVNPFSNGGN---------------------APGSKSRIPQMVA  1172
             +  R  + NPFD E QE N FS+ G                       P + SR+  +  
Sbjct  1     MAGRYYNDNPFD-EGQEDNAFSDQGTQGKGQSNYGSGPFYMMNPASVPPATNSRLSPLPH  59

Query  1171  NTLGFGQKHDATVDIPLDSLNDPKKKQKELAAWEADLKRREMDIKRREDAVAGAGVPVSD  992
                 + +   ATVDIPLD+  D K K+KEL A EA+LK+ E D+KRREDA+A AGV + +
Sbjct  60    EPADYDR--GATVDIPLDNPKDLKNKEKELQAKEAELKKLEQDLKRREDAIARAGVVIEE  117

Query  991   KNWPPFFPIIHHDIVNEIPVESQKMQYLAFASWLGIVLCLVYNIVAVTVCWIKGDGVKIF  812
             KNWPPFFPIIHHDI NEIP+  QK+QY+AF +WLG+  CL++N++AVT  WIKG+G+ I+
Sbjct  118   KNWPPFFPIIHHDIANEIPIHLQKLQYVAFFTWLGLAACLLWNLIAVTSAWIKGEGITIW  177

Query  811   LLAIIYALMGCPLSYVLWYRPLYNAMRTNSALKFGWFFMFYLLHIGFCifaaiappiiFH  632
             LLAIIY + G P +YVLWYRPLY AMRT+SALKFGWFF+ YL HIGFCI A +APPI F 
Sbjct  178   LLAIIYLISGVPGAYVLWYRPLYRAMRTDSALKFGWFFLCYLFHIGFCIIATVAPPIFFK  237

Query  631   GKSLTGILAAIDVFSDHVLVGVSCCN*HLPSSIYIFDIHIVYLQIFYLVGFGLFCLEALL  452
             GKSL GIL AID+   + LVGV                       FY +GF  FCLE+L 
Sbjct  238   GKSLAGILPAIDLLGWNGLVGV-----------------------FYFIGFAFFCLESLT  274

Query  451   SLWVLQ  434
             S+WV+Q
Sbjct  275   SIWVIQ  280



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4188676980598