BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4334

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803342.1|  PREDICTED: 50S ribosomal protein L18, chloro...    239   1e-75   Nicotiana sylvestris
ref|XP_010087086.1|  50S ribosomal protein L18                          237   3e-75   Morus notabilis
ref|XP_009353459.1|  PREDICTED: 50S ribosomal protein L18, chloro...    234   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_002509912.1|  50S ribosomal protein L18, chloroplast precu...    234   3e-74   Ricinus communis
ref|XP_008390247.1|  PREDICTED: 50S ribosomal protein L18, chloro...    234   5e-74   
ref|XP_012086779.1|  PREDICTED: 50S ribosomal protein L18, chloro...    233   1e-73   Jatropha curcas
ref|XP_006349873.1|  PREDICTED: 50S ribosomal protein L18, chloro...    233   1e-73   Solanum tuberosum [potatoes]
ref|XP_004252957.1|  PREDICTED: 50S ribosomal protein L18, chloro...    233   2e-73   
ref|XP_010244056.1|  PREDICTED: 50S ribosomal protein L18, chloro...    232   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_004297049.1|  PREDICTED: 50S ribosomal protein L18, chloro...    232   3e-73   Fragaria vesca subsp. vesca
gb|AFK34990.1|  unknown                                                 232   3e-73   Lotus japonicus
ref|XP_009631408.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   3e-73   Nicotiana tomentosiformis
ref|XP_009359828.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   3e-73   Pyrus x bretschneideri [bai li]
ref|XP_010043345.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   5e-73   Eucalyptus grandis [rose gum]
ref|XP_008369568.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   6e-73   Malus domestica [apple tree]
ref|XP_008439021.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   9e-73   Cucumis melo [Oriental melon]
ref|XP_010040376.1|  PREDICTED: 50S ribosomal protein L18, chloro...    231   1e-72   Eucalyptus grandis [rose gum]
ref|XP_004147640.1|  PREDICTED: 50S ribosomal protein L18, chloro...    230   2e-72   Cucumis sativus [cucumbers]
ref|XP_008222310.1|  PREDICTED: 50S ribosomal protein L18, chloro...    230   2e-72   Prunus mume [ume]
gb|KHN41509.1|  50S ribosomal protein L18, chloroplastic                229   3e-72   Glycine soja [wild soybean]
ref|XP_002270819.1|  PREDICTED: 50S ribosomal protein L18, chloro...    229   3e-72   Vitis vinifera
ref|XP_011093509.1|  PREDICTED: 50S ribosomal protein L18, chloro...    229   4e-72   Sesamum indicum [beniseed]
ref|XP_007225963.1|  hypothetical protein PRUPE_ppa012509mg             229   5e-72   Prunus persica
ref|XP_010999351.1|  PREDICTED: 50S ribosomal protein L18, chloro...    229   5e-72   Populus euphratica
ref|XP_006388561.1|  ribosomal protein L18                              228   9e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006478532.1|  PREDICTED: 50S ribosomal protein L18, chloro...    228   1e-71   Citrus sinensis [apfelsine]
gb|EPS74009.1|  hypothetical protein M569_00746                         226   1e-71   Genlisea aurea
ref|NP_001236805.1|  uncharacterized protein LOC100306308               228   1e-71   
gb|KCW85353.1|  hypothetical protein EUGRSUZ_B02183                     228   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010254629.1|  PREDICTED: 50S ribosomal protein L18, chloro...    226   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_007014073.1|  Ribosomal L18p/L5e family protein isoform 1        226   1e-70   
gb|KJB23403.1|  hypothetical protein B456_004G096600                    226   1e-70   Gossypium raimondii
gb|KDO46879.1|  hypothetical protein CISIN_1g030804mg                   225   1e-70   Citrus sinensis [apfelsine]
ref|XP_010479253.1|  PREDICTED: 50S ribosomal protein L18, chloro...    225   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010461649.1|  PREDICTED: 50S ribosomal protein L18, chloro...    225   2e-70   Camelina sativa [gold-of-pleasure]
gb|KFK36100.1|  hypothetical protein AALP_AA4G077300                    224   4e-70   Arabis alpina [alpine rockcress]
emb|CDY41837.1|  BnaA08g03320D                                          224   4e-70   Brassica napus [oilseed rape]
ref|XP_006441940.1|  hypothetical protein CICLE_v10022561mg             224   4e-70   Citrus clementina [clementine]
ref|XP_003546534.1|  PREDICTED: 50S ribosomal protein L18, chloro...    223   5e-70   Glycine max [soybeans]
ref|XP_009107364.1|  PREDICTED: 50S ribosomal protein L18, chloro...    224   5e-70   Brassica rapa
gb|KJB23404.1|  hypothetical protein B456_004G096600                    227   6e-70   Gossypium raimondii
ref|XP_010500357.1|  PREDICTED: 50S ribosomal protein L18, chloro...    223   8e-70   
emb|CDP18513.1|  unnamed protein product                                223   1e-69   Coffea canephora [robusta coffee]
ref|XP_002891426.1|  ribosomal protein L18 family protein               223   1e-69   
emb|CDX77315.1|  BnaC08g03600D                                          223   1e-69   
ref|NP_175268.1|  50S ribosomal protein L18/L5e family protein          223   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384139.1|  PREDICTED: 50S ribosomal protein L18, chloro...    223   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003595391.1|  50S ribosomal protein L18                          222   2e-69   Medicago truncatula
ref|XP_010694131.1|  PREDICTED: 50S ribosomal protein L18, chloro...    222   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914839.1|  PREDICTED: 50S ribosomal protein L18, chloro...    222   3e-69   Elaeis guineensis
ref|XP_007138590.1|  hypothetical protein PHAVU_009G221700g             221   6e-69   Phaseolus vulgaris [French bean]
ref|XP_006393423.1|  hypothetical protein EUTSA_v10011822mg             221   1e-68   Eutrema salsugineum [saltwater cress]
gb|ACJ84202.1|  unknown                                                 220   1e-68   Medicago truncatula
ref|XP_006306511.1|  hypothetical protein CARUB_v10012508mg             219   4e-68   Capsella rubella
ref|XP_010551121.1|  PREDICTED: 50S ribosomal protein L18, chloro...    217   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_006388235.1|  hypothetical protein POPTR_0271s00220g             217   3e-67   
ref|XP_010263172.1|  PREDICTED: 50S ribosomal protein L18, chloro...    219   6e-67   Nelumbo nucifera [Indian lotus]
ref|XP_006848386.2|  PREDICTED: 50S ribosomal protein L18, chloro...    214   4e-66   Amborella trichopoda
gb|ERN09967.1|  hypothetical protein AMTR_s00013p00209880               213   6e-66   Amborella trichopoda
gb|ABK23983.1|  unknown                                                 208   8e-64   Picea sitchensis
ref|XP_004488160.1|  PREDICTED: 50S ribosomal protein L18, chloro...    197   8e-60   Cicer arietinum [garbanzo]
dbj|BAK03461.1|  predicted protein                                      195   1e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF85829.1|  unknown                                                 194   2e-58   Zea mays [maize]
ref|NP_001151288.1|  50S ribosomal protein L18                          194   2e-58   Zea mays [maize]
gb|ACG30572.1|  50S ribosomal protein L18                               194   3e-58   Zea mays [maize]
ref|XP_004981146.1|  PREDICTED: 50S ribosomal protein L18, chloro...    193   4e-58   Setaria italica
ref|XP_003563357.1|  PREDICTED: 50S ribosomal protein L18, chloro...    193   5e-58   Brachypodium distachyon [annual false brome]
ref|XP_002463594.1|  hypothetical protein SORBIDRAFT_01g002610          193   5e-58   Sorghum bicolor [broomcorn]
ref|XP_006650835.1|  PREDICTED: 50S ribosomal protein L18, chloro...    192   2e-57   Oryza brachyantha
ref|NP_001051775.1|  Os03g0828100                                       190   6e-57   
gb|EAY92422.1|  hypothetical protein OsI_14156                          190   8e-57   Oryza sativa Indica Group [Indian rice]
gb|ABF99674.1|  50S ribosomal protein L18, chloroplast precursor,...    184   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982301.1|  hypothetical protein SELMODRAFT_116145             179   2e-53   
ref|XP_002966231.1|  hypothetical protein SELMODRAFT_143891             177   2e-52   
ref|XP_001778114.1|  predicted protein                                  176   5e-52   
gb|EMT20903.1|  50S ribosomal protein L18, chloroplastic                175   2e-51   
gb|EMS49249.1|  50S ribosomal protein L18, chloroplastic                172   7e-51   Triticum urartu
ref|XP_001767785.1|  predicted protein                                  173   2e-50   
ref|XP_001759681.1|  predicted protein                                  169   5e-49   
ref|WP_042353695.1|  50S ribosomal protein L18                          155   4e-44   Bacillus rubiinfantis
ref|WP_013074240.1|  50S ribosomal protein L18                          154   2e-43   Kyrpidia tusciae
ref|WP_038538497.1|  50S ribosomal protein L18                          153   5e-43   Bacillus sp. X1(2014)
ref|WP_011229635.1|  MULTISPECIES: 50S ribosomal protein L18            152   7e-43   Geobacillus
ref|WP_033020984.1|  MULTISPECIES: 50S ribosomal protein L18            152   7e-43   Geobacillus
ref|WP_029421864.1|  50S ribosomal protein L18                          151   2e-42   Alicyclobacillus macrosporangiidus
ref|WP_013522755.1|  50S ribosomal protein L18                          150   3e-42   Geobacillus sp. Y412MC52
ref|WP_033008681.1|  MULTISPECIES: 50S ribosomal protein L18            150   3e-42   Bacillaceae
ref|WP_003247604.1|  MULTISPECIES: 50S ribosomal protein L18            150   5e-42   Bacillaceae
ref|WP_032101418.1|  50S ribosomal protein L18                          150   7e-42   
ref|WP_029763937.1|  50S ribosomal protein L18                          150   8e-42   
ref|WP_017434006.1|  50S ribosomal protein L18                          149   1e-41   Bacillaceae
ref|WP_021095331.1|  MULTISPECIES: 50S ribosomal protein L18            149   1e-41   Anoxybacillus
ref|WP_041066903.1|  50S ribosomal protein L18                          149   1e-41   Cohnella kolymensis
ref|WP_042888370.1|  50S ribosomal protein L18                          149   1e-41   
ref|WP_004888689.1|  50S ribosomal protein L18                          149   1e-41   Anoxybacillus flavithermus
ref|WP_009361496.1|  MULTISPECIES: 50S ribosomal protein L18            149   2e-41   Bacillaceae
gb|ACJ32505.1|  Ribosomal protein L18                                   149   2e-41   Anoxybacillus flavithermus WK1
ref|WP_020958372.1|  50S ribosomal protein L18                          148   2e-41   Geobacillus genomosp. 3
ref|WP_012748895.1|  50S ribosomal protein L18                          148   3e-41   Bacillaceae
ref|WP_008881929.1|  MULTISPECIES: 50S ribosomal protein L18            148   3e-41   Geobacillus
gb|AAA22702.1|  ribosomal protein L18                                   148   3e-41   Geobacillus stearothermophilus
ref|WP_043903328.1|  50S ribosomal protein L18                          148   4e-41   Parageobacillus genomosp. 1
ref|WP_003397682.1|  MULTISPECIES: 50S ribosomal protein L18            148   4e-41   Anoxybacillus
ref|WP_027844106.1|  50S ribosomal protein L18                          148   4e-41   Mastigocoleus testarum
ref|WP_003354764.1|  50S ribosomal protein L18                          147   5e-41   Bacillus smithii
ref|WP_026574102.1|  50S ribosomal protein L18                          147   6e-41   Bacillus sp. UNC438CL73TsuS30
ref|WP_045516522.1|  50S ribosomal protein L18                          147   9e-41   Bacillus niacini
ref|WP_015253304.1|  50S ribosomal protein L18                          147   9e-41   Thermobacillus composti
ref|WP_044895208.1|  50S ribosomal protein L18                          147   9e-41   Bacillus alveayuensis
ref|WP_019722051.1|  50S ribosomal protein L18                          147   1e-40   Bacillus coagulans
ref|WP_015955692.1|  50S ribosomal protein L18                          147   1e-40   Cyanothece sp. PCC 7424
ref|WP_020155528.1|  50S ribosomal protein L18                          147   1e-40   Caldibacillus debilis
ref|WP_045670717.1|  50S ribosomal protein L18                          147   1e-40   Paenibacillus beijingensis
ref|WP_043931552.1|  50S ribosomal protein L18                          146   1e-40   Bacillus sp. EB01
ref|WP_007085274.1|  50S ribosomal protein L18                          146   2e-40   Bacillus bataviensis
emb|CEG25270.1|  50S ribosomal protein L18                              146   2e-40   Bacillus sp. B-jedd
ref|WP_040203257.1|  MULTISPECIES: 50S ribosomal protein L18            145   3e-40   Bacillus
ref|WP_015141078.1|  50S ribosomal protein L18                          145   3e-40   Nostoc sp. PCC 7524
ref|WP_015591974.1|  50S ribosomal protein L18                          145   3e-40   Bacillus sp. 1NLA3E
ref|WP_012676563.1|  50S ribosomal protein L18                          145   4e-40   Persephonella marina
ref|WP_026565537.1|  50S ribosomal protein L18                          145   4e-40   Bacillus sp. UNC41MFS5
ref|WP_027091984.1|  50S ribosomal protein L18                          145   4e-40   Cohnella thermotolerans
ref|WP_042453984.1|  50S ribosomal protein L18                          145   4e-40   Bacillus dielmoensis
ref|WP_027410249.1|  50S ribosomal protein L18                          145   4e-40   Anoxybacillus tepidamans
dbj|BAK26451.1|  50S ribosomal protein L18                              145   5e-40   Bacillus novalis
ref|XP_005850443.1|  hypothetical protein CHLNCDRAFT_142390             146   5e-40   Chlorella variabilis
ref|WP_018888237.1|  MULTISPECIES: 50S ribosomal protein L18            145   5e-40   Paenibacillus
ref|WP_034676115.1|  50S ribosomal protein L18                          145   6e-40   Bacillus niacini
ref|WP_011994282.1|  50S ribosomal protein L18                          145   7e-40   Fervidobacterium nodosum
ref|WP_044482509.1|  50S ribosomal protein L18                          145   8e-40   
ref|WP_034767053.1|  50S ribosomal protein L18                          144   8e-40   Bacillus
ref|WP_024027893.1|  50S ribosomal protein L18                          144   1e-39   Bacillus vireti
ref|WP_002479557.1|  50S ribosomal protein L18                          144   1e-39   Staphylococcus
ref|WP_019006404.1|  50S ribosomal protein L18                          144   1e-39   Cohnella laeviribosi
ref|WP_044880312.1|  50S ribosomal protein L18                          144   1e-39   Paenibacillus sp. IHBB 10380
ref|WP_027322642.1|  50S ribosomal protein L18                          144   1e-39   Bacillus sp. URHB0009
ref|WP_021252447.1|  MULTISPECIES: 50S ribosomal protein L18            144   1e-39   Paenibacillus
ref|WP_037589017.1|  50S ribosomal protein L18                          144   1e-39   Staphylococcus
ref|WP_023153268.1|  50S ribosomal protein L18                          144   1e-39   [Eubacterium] brachy
ref|WP_003178358.1|  MULTISPECIES: 50S ribosomal protein L18            144   2e-39   Bacillus
ref|WP_028543524.1|  50S ribosomal protein L18                          144   2e-39   Paenibacillus taiwanensis
ref|WP_026586058.1|  50S ribosomal protein L18                          144   2e-39   Bacillus
ref|WP_031503223.1|  50S ribosomal protein L18                          144   2e-39   Pseudothermotoga hypogea
ref|WP_015921933.1|  50S ribosomal protein L18                          144   2e-39   Thermomicrobium roseum
ref|WP_021974839.1|  50S ribosomal protein L18                          144   2e-39   
ref|WP_020449866.1|  MULTISPECIES: 50S ribosomal protein L18            144   2e-39   Bacillales
ref|WP_029141995.1|  50S ribosomal protein L18                          143   2e-39   Bacillus coagulans
ref|WP_010998338.1|  50S ribosomal protein L18                          143   2e-39   Nostocaceae
ref|WP_004034754.1|  50S ribosomal protein L18                          143   2e-39   Clostridium sp. ASF356
ref|WP_017554011.1|  50S ribosomal protein L18                          143   2e-39   Bacillus coagulans
ref|WP_040953109.1|  50S ribosomal protein L18                          143   2e-39   Gorillibacterium massiliense
ref|WP_044744049.1|  50S ribosomal protein L18                          143   2e-39   Anoxybacillus
ref|WP_026964688.1|  50S ribosomal protein L18                          143   2e-39   Alicyclobacillus pomorum
ref|WP_041076694.1|  50S ribosomal protein L18                          143   3e-39   Thermotoga caldifontis
ref|WP_021259844.1|  MULTISPECIES: 50S ribosomal protein L18            143   3e-39   Paenibacillus
ref|WP_045870360.1|  50S ribosomal protein L18                          143   3e-39   Nostocales
ref|WP_042739076.1|  50S ribosomal protein L18                          143   3e-39   Staphylococcus
ref|WP_010348806.1|  50S ribosomal protein L18                          143   4e-39   Paenibacillus peoriae
ref|WP_041048877.1|  50S ribosomal protein L18                          143   4e-39   Paenibacillus sp. VKM B-2647
ref|WP_015200867.1|  50S ribosomal protein L18                          143   4e-39   Calothrix parietina
ref|WP_026974621.1|  50S ribosomal protein L18                          142   5e-39   Alicyclobacillus contaminans
ref|WP_025906785.1|  50S ribosomal protein L18                          142   5e-39   Staphylococcus sciuri
ref|WP_006196729.1|  50S ribosomal protein L18                          142   5e-39   Nodularia spumigena
ref|WP_044907729.1|  50S ribosomal protein L18                          142   6e-39   Lachnospiraceae bacterium MC2017
ref|WP_015113416.1|  50S ribosomal protein L18                          142   7e-39   Nostocales
ref|WP_025729806.1|  50S ribosomal protein L18                          142   7e-39   Bacillus ginsengihumi
ref|WP_040285496.1|  50S ribosomal protein L18                          142   8e-39   Sporosarcina koreensis
ref|WP_044920980.1|  50S ribosomal protein L18                          142   8e-39   Lachnospiraceae bacterium MA2020
ref|WP_024095377.1|  50S ribosomal protein L18                          142   8e-39   Paenibacillus larvae
ref|WP_043925511.1|  50S ribosomal protein L18                          142   8e-39   Bacillus haynesii
ref|WP_009382772.1|  50S ribosomal protein L18                          142   9e-39   Staphylococcus massiliensis
ref|WP_013858094.1|  50S ribosomal protein L18                          142   9e-39   Bacillus coagulans
gb|AEJ44910.1|  ribosomal protein L18                                   142   9e-39   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
ref|WP_015218383.1|  50S ribosomal protein L18                          142   1e-38   Cyanobacterium aponinum
ref|WP_045165000.1|  50S ribosomal protein L18                          142   1e-38   
ref|WP_041695510.1|  50S ribosomal protein L18                          142   1e-38   Alicyclobacillus acidocaldarius
ref|WP_044359548.1|  50S ribosomal protein L18                          141   1e-38   Staphylococcus
ref|WP_016839384.1|  50S ribosomal protein L18                          141   1e-38   Ureibacillus thermosphaericus
ref|WP_002482628.1|  50S ribosomal protein L18                          141   1e-38   Staphylococcus
ref|WP_025685932.1|  50S ribosomal protein L18                          141   1e-38   Paenibacillus sp. 1-49
ref|WP_015900963.1|  50S ribosomal protein L18                          141   1e-38   Staphylococcus carnosus
ref|XP_006586621.1|  PREDICTED: uncharacterized protein LOC100306...    142   1e-38   
ref|WP_007432568.1|  MULTISPECIES: 50S ribosomal protein L18            141   1e-38   Paenibacillus
ref|WP_045851866.1|  50S ribosomal protein L18                          141   1e-38   Domibacillus enclensis
ref|WP_016859433.1|  50S ribosomal protein L18                          141   1e-38   Fischerella muscicola
ref|WP_011302601.1|  50S ribosomal protein L18                          141   2e-38   Staphylococcus
ref|WP_002471319.1|  50S ribosomal protein L18                          141   2e-38   Staphylococcus
ref|WP_016868078.1|  50S ribosomal protein L18                          141   2e-38   Fischerella muscicola
ref|WP_006640331.1|  50S ribosomal protein L18                          141   2e-38   Bacillus sonorensis
ref|WP_027114576.1|  50S ribosomal protein L18                          141   2e-38   Lachnospiraceae bacterium NK4A144
ref|WP_039234442.1|  50S ribosomal protein L18                          141   2e-38   Quasibacillus thermotolerans
ref|WP_007132555.1|  MULTISPECIES: 50S ribosomal protein L18            141   2e-38   Bacillales
ref|WP_005583490.1|  50S ribosomal protein L18                          141   2e-38   
ref|WP_033100600.1|  50S ribosomal protein L18                          141   2e-38   Thermoactinomyces daqus
ref|WP_006676506.1|  50S ribosomal protein L18                          141   2e-38   Paenibacillus
ref|WP_029523395.1|  50S ribosomal protein L18                          140   3e-38   Persephonella sp. KM09-Lau-8
ref|WP_023626415.1|  MULTISPECIES: 50S ribosomal protein L18            140   3e-38   Bacillus
ref|WP_010469301.1|  50S ribosomal protein L18                          140   3e-38   Acaryochloris sp. CCMEE 5410
ref|WP_014096492.1|  50S ribosomal protein L18                          140   3e-38   Bacillus coagulans
ref|WP_011317571.1|  50S ribosomal protein L18                          140   3e-38   Trichormus variabilis
ref|WP_009455540.1|  MULTISPECIES: 50S ribosomal protein L18            140   3e-38   Fischerella
ref|WP_014278306.1|  50S ribosomal protein L18                          140   3e-38   Paenibacillus terrae
ref|WP_034931942.1|  50S ribosomal protein L18                          140   3e-38   Erysipelotrichaceae bacterium NK3D112
ref|WP_019420711.1|  50S ribosomal protein L18                          140   3e-38   Paenibacillus sp. OSY-SE
ref|WP_011522046.1|  50S ribosomal protein L18                          140   3e-38   Candidatus Koribacter versatilis
ref|WP_003225816.1|  MULTISPECIES: 50S ribosomal protein L18            140   4e-38   Bacillales
ref|WP_024860940.1|  50S ribosomal protein L18                          140   4e-38   Ruminococcus flavefaciens
ref|WP_002506977.1|  MULTISPECIES: 50S ribosomal protein L18            140   4e-38   Staphylococcus
ref|WP_003328274.1|  MULTISPECIES: 50S ribosomal protein L18            140   4e-38   Bacillus subtilis group
ref|WP_010332778.1|  50S ribosomal protein L18                          140   4e-38   Bacillus mojavensis
ref|WP_010279626.1|  50S ribosomal protein L18                          140   4e-38   Paenibacillus senegalensis
ref|WP_008339761.1|  50S ribosomal protein L18                          140   4e-38   Alicyclobacillus acidocaldarius
ref|WP_012164970.1|  50S ribosomal protein L18                          140   4e-38   Acaryochloris marina
ref|WP_044747035.1|  50S ribosomal protein L18                          140   4e-38   Bacillus alveayuensis
ref|WP_029520171.1|  50S ribosomal protein L18                          140   4e-38   Persephonella sp. IF05-L8
ref|WP_012548289.1|  50S ribosomal protein L18                          140   5e-38   Dictyoglomus thermophilum
ref|WP_006284360.1|  50S ribosomal protein L18                          140   5e-38   Paenibacillus popilliae
ref|WP_033827273.1|  50S ribosomal protein L18                          140   5e-38   Bacillus andreraoultii
ref|WP_017722934.1|  50S ribosomal protein L18                          140   5e-38   Staphylococcus
ref|WP_036835550.1|  50S ribosomal protein L18                          140   5e-38   Pontibacillus litoralis
ref|WP_018759697.1|  50S ribosomal protein L18                          140   5e-38   Paenibacillus terrigena
ref|WP_019167903.1|  50S ribosomal protein L18                          140   5e-38   Staphylococcus intermedius
ref|WP_011612507.1|  50S ribosomal protein L18                          140   6e-38   Trichodesmium erythraeum
ref|WP_018663945.1|  50S ribosomal protein L18                          140   6e-38   Bacillus acidiproducens
ref|WP_003241994.1|  MULTISPECIES: 50S ribosomal protein L18            140   6e-38   Bacillus
ref|WP_028595144.1|  50S ribosomal protein L18                          140   6e-38   Paenibacillus assamensis
ref|WP_032120412.1|  50S ribosomal protein L18                          140   6e-38   Clostridium amazonitimonense
gb|EES53072.1|  ribosomal protein L18                                   139   6e-38   Leptospirillum ferrodiazotrophum
ref|WP_036652519.1|  50S ribosomal protein L18                          140   6e-38   Paenibacillus pini
ref|WP_003348593.1|  50S ribosomal protein L18                          139   6e-38   Bacillus methanolicus
ref|WP_022337785.1|  50S ribosomal protein L18                          139   6e-38   
ref|WP_034304989.1|  50S ribosomal protein L18                          139   7e-38   Bacillus
dbj|BAK26514.1|  50S ribosomal protein L18                              139   7e-38   Bacillus subtilis
emb|CEG24406.1|  50S ribosomal protein L18                              139   7e-38   Planococcus massiliensis
ref|WP_017310479.1|  MULTISPECIES: 50S ribosomal protein L18            139   7e-38   Hapalosiphonaceae
ref|WP_031537909.1|  50S ribosomal protein L18                          139   7e-38   Bacillus
ref|WP_040735558.1|  50S ribosomal protein L18                          139   7e-38   
ref|WP_044153410.1|  50S ribosomal protein L18                          139   7e-38   Bacillus
ref|WP_009984976.1|  50S ribosomal protein L18                          139   7e-38   Ruminococcus flavefaciens
ref|WP_029196452.1|  50S ribosomal protein L18                          139   8e-38   Paenibacillus alginolyticus
ref|WP_028881012.1|  50S ribosomal protein L18                          139   8e-38   
ref|WP_028552001.1|  50S ribosomal protein L18                          139   8e-38   Paenibacillus sp. UNC451MF
ref|WP_039043306.1|  50S ribosomal protein L18                          139   8e-38   Bacillales
ref|WP_039764309.1|  MULTISPECIES: 50S ribosomal protein L18            139   9e-38   
sp|A4XLR4.2|RL18_CALS8  RecName: Full=50S ribosomal protein L18         139   9e-38   Caldicellulosiruptor saccharolyticus DSM 8903
ref|WP_031471907.1|  50S ribosomal protein L18 [                        139   9e-38   [Clostridium] aminophilum
ref|WP_025640188.1|  50S ribosomal protein L18                          139   1e-37   [Clostridium] ultunense
ref|WP_028988526.1|  50S ribosomal protein L18                          139   1e-37   Thermicanus aegyptius
ref|WP_031563410.1|  50S ribosomal protein L18                          139   1e-37   Ruminococcus flavefaciens
ref|WP_014112347.1|  50S ribosomal protein L18                          139   1e-37   Bacillus
ref|WP_014613228.1|  MULTISPECIES: 50S ribosomal protein L18            139   1e-37   Staphylococcus
ref|WP_038038895.1|  50S ribosomal protein L18                          139   1e-37   Thermorudis peleae
ref|WP_044647212.1|  50S ribosomal protein L18                          139   1e-37   Paenibacillus terrae
ref|WP_015208457.1|  50S ribosomal protein L18                          139   1e-37   Cylindrospermum stagnale
gb|KJJ42668.1|  50S ribosomal protein L18                               139   1e-37   Bacillus subtilis
ref|WP_015195218.1|  50S ribosomal protein L18                          139   1e-37   Stanieria cyanosphaera
dbj|BAK26459.1|  50S ribosomal protein L18                              139   1e-37   Bacillus simplex NBRC 15720 = DSM 1321
ref|WP_015215926.1|  50S ribosomal protein L18                          139   1e-37   Anabaena cylindrica
ref|WP_033542785.1|  50S ribosomal protein L18                          139   1e-37   Planococcus sp. CAU13
ref|WP_025783848.1|  50S ribosomal protein L18                          139   1e-37   Sporosarcina sp. D27
ref|WP_013191484.1|  50S ribosomal protein L18                          139   1e-37   Trichormus azollae
ref|WP_008298864.1|  50S ribosomal protein L18                          139   2e-37   Bhargavaea cecembensis
ref|WP_026652521.1|  50S ribosomal protein L18                          139   2e-37   Butyrivibrio proteoclasticus
ref|WP_019244392.1|  50S ribosomal protein L18                          139   2e-37   Bacillus massilioanorexius
dbj|BAQ65779.1|  LSU ribosomal protein L18p                             139   2e-37   Geminocystis sp. NIES-3709
ref|WP_039076398.1|  50S ribosomal protein L18                          138   2e-37   Bacillus
ref|WP_022341217.1|  50S ribosomal protein L18                          138   2e-37   
ref|WP_027087367.1|  50S ribosomal protein L18                          138   2e-37   Cohnella panacarvi
ref|WP_002450515.1|  MULTISPECIES: 50S ribosomal protein L18            138   2e-37   Bacteria
ref|WP_015941722.1|  50S ribosomal protein L18                          138   2e-37   Chloroflexus aggregans
ref|WP_009676825.1|  MULTISPECIES: 50S ribosomal protein L18            138   2e-37   Paenibacillus
ref|WP_028598211.1|  50S ribosomal protein L18                          138   2e-37   Paenibacillus pasadenensis
ref|WP_041727162.1|  MULTISPECIES: 50S ribosomal protein L18            138   2e-37   
gb|KKB75743.1|  50S ribosomal protein L18                               138   2e-37   Bacillus sp. TH008
ref|WP_012656121.1|  50S ribosomal protein L18                          138   2e-37   Terrabacteria group
gb|ACM60823.1|  ribosomal protein L18                                   138   2e-37   Caldicellulosiruptor bescii DSM 6725
ref|WP_018395170.1|  MULTISPECIES: 50S ribosomal protein L18            138   2e-37   Bacillaceae
ref|WP_009344498.1|  50S ribosomal protein L18                          138   2e-37   Aphanizomenonaceae
ref|WP_041605721.1|  50S ribosomal protein L18                          138   3e-37   Halothermothrix orenii
ref|WP_017638510.1|  MULTISPECIES: 50S ribosomal protein L18            138   3e-37   
gb|ACL68894.1|  ribosomal protein L18                                   138   3e-37   
ref|WP_010881067.1|  50S ribosomal protein L18                          138   3e-37   
gb|KDE49716.1|  50S ribosomal protein L18                               138   3e-37   
ref|WP_037574779.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_045169219.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_040348159.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_042235537.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_035162239.1|  50S ribosomal protein L18                          138   3e-37   
gb|ADQ41233.1|  ribosomal protein L18                                   138   3e-37   
ref|WP_036787742.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_019468654.1|  MULTISPECIES: 50S ribosomal protein L18            138   3e-37   
ref|WP_008497443.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_006037930.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_016285748.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_018249340.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_013402933.1|  MULTISPECIES: 50S ribosomal protein L18            138   3e-37   
ref|WP_020376682.1|  50S ribosomal protein L18                          138   3e-37   
ref|WP_015129708.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_042131220.1|  MULTISPECIES: 50S ribosomal protein L18            138   4e-37   
ref|WP_023964939.1|  50S ribosomal protein L18                          138   4e-37   
ref|WP_037997828.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_019680113.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_003331713.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_027428433.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_026732529.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_036680564.1|  MULTISPECIES: 50S ribosomal protein L18            137   4e-37   
ref|WP_015167573.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_027104282.1|  50S ribosomal protein L18                          137   4e-37   
ref|WP_016998815.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_007505911.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_043097225.1|  50S ribosomal protein L18                          138   5e-37   
ref|WP_040056348.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_035636913.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_035209551.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_029635496.1|  50S ribosomal protein L18 [                        137   5e-37   
ref|WP_009083087.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_027869908.1|  50S ribosomal protein L18                          137   5e-37   
gb|ADQ05018.1|  ribosomal protein L18                                   137   5e-37   
ref|WP_028559492.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_029683942.1|  50S ribosomal protein L18                          137   5e-37   
ref|WP_041737639.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_029451396.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_009165409.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_002509262.1|  MULTISPECIES: 50S ribosomal protein L18            137   6e-37   
ref|WP_017303359.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_034443860.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_019415638.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_008432519.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_006276969.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_026801466.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_039644463.1|  50S ribosomal protein L18                          137   6e-37   
ref|WP_009589217.1|  MULTISPECIES: 50S ribosomal protein L18            137   6e-37   
ref|WP_024865227.1|  50S ribosomal protein L18                          137   6e-37   
ref|XP_002948447.1|  plastid/chloroplast ribosomal protein L18          138   7e-37   
ref|WP_016426363.1|  50S ribosomal protein L18                          137   7e-37   
ref|WP_008681173.1|  50S ribosomal protein L18                          137   7e-37   
ref|WP_020620152.1|  50S ribosomal protein L18                          137   7e-37   
ref|WP_044393890.1|  50S ribosomal protein L18                          137   7e-37   
gb|ACD82754.1|  Ribosomal protein L18                                   137   7e-37   
ref|WP_038701924.1|  50S ribosomal protein L18                          137   7e-37   
ref|WP_016911108.1|  50S ribosomal protein L18                          137   7e-37   
ref|WP_021681250.1|  50S ribosomal protein L18                          137   8e-37   
ref|WP_006828944.1|  50S ribosomal protein L18                          137   8e-37   
ref|WP_042992397.1|  50S ribosomal protein L18                          137   8e-37   
ref|WP_016204572.1|  50S ribosomal protein L18                          137   8e-37   
ref|WP_038267308.1|  50S ribosomal protein L18 [                        137   8e-37   
ref|WP_025697565.1|  50S ribosomal protein L18                          137   8e-37   
ref|WP_005539247.1|  50S ribosomal protein L18                          137   9e-37   
ref|WP_027726446.1|  50S ribosomal protein L18                          137   9e-37   
ref|WP_006212906.1|  MULTISPECIES: 50S ribosomal protein L18            137   9e-37   
ref|WP_039754635.1|  50S ribosomal protein L18                          137   1e-36   
dbj|BAA10982.1|  ribosomal protein L18                                  137   1e-36   
ref|WP_013977734.1|  50S ribosomal protein L18                          137   1e-36   
ref|WP_037567125.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_028557479.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_035809680.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_003497822.1|  MULTISPECIES: 50S ribosomal protein L18            136   1e-36   
ref|WP_013290165.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_044974844.1|  50S ribosomal protein L18                          136   1e-36   
dbj|GAK43048.1|  5S ribosomal protein L18                               136   1e-36   
ref|WP_040372566.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_032117039.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_041083298.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_013932035.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_015187427.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_028089025.1|  50S ribosomal protein L18                          136   1e-36   
ref|WP_022345137.1|  50S ribosomal protein L18                          136   1e-36   
gb|EFD24209.1|  ribosomal protein L18                                   136   1e-36   
ref|WP_022266294.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_009524367.1|  MULTISPECIES: 50S ribosomal protein L18            136   2e-36   
ref|WP_008288637.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_013054943.1|  MULTISPECIES: 50S ribosomal protein L18            136   2e-36   
ref|WP_026490022.1|  MULTISPECIES: 50S ribosomal protein L18            136   2e-36   
ref|WP_021937674.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_042353160.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_002432656.1|  MULTISPECIES: 50S ribosomal protein L18            136   2e-36   
ref|WP_041101751.1|  50S ribosomal protein L18                          136   2e-36   
sp|Q9ZI37.1|RL18_AQUPY  RecName: Full=50S ribosomal protein L18         136   2e-36   
ref|WP_028085246.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_016205886.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_014296352.1|  50S ribosomal protein L18                          136   2e-36   
ref|WP_010191509.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_025693033.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_013119223.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_041054719.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_003156492.1|  MULTISPECIES: 50S ribosomal protein L18            135   2e-36   
ref|WP_005583202.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_022411545.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_031547066.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_006838996.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_035433703.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_017296428.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_041725765.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_027402092.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_008191189.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_015051604.1|  50S ribosomal protein L18                          135   2e-36   
ref|WP_035381004.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_022014874.1|  50S ribosomal protein L18                          135   3e-36   
gb|AEM73775.1|  ribosomal protein L18                                   135   3e-36   
ref|WP_011983259.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_036619534.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_021876955.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_002488605.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_008372552.1|  MULTISPECIES: 50S ribosomal protein L18            135   3e-36   
ref|WP_013274978.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_012674699.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_002448369.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_017174843.1|  MULTISPECIES: 50S ribosomal protein L18            135   3e-36   
ref|WP_021857497.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_033124787.1|  50S ribosomal protein L18                          135   3e-36   
emb|CDN41024.1|  50S ribosomal protein L18                              135   3e-36   
ref|WP_012258247.1|  MULTISPECIES: 50S ribosomal protein L18            135   3e-36   
ref|WP_035406832.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_015847208.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_038281342.1|  50S ribosomal protein L18 [                        135   3e-36   
gb|KJB23405.1|  hypothetical protein B456_004G096600                    135   3e-36   
ref|WP_016953006.1|  50S ribosomal protein L18                          135   3e-36   
ref|WP_022769976.1|  MULTISPECIES: 50S ribosomal protein L18            135   4e-36   
ref|WP_019157100.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_022778100.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_044106038.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_025694124.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_026583676.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_025231338.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_013280012.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_028829996.1|  50S ribosomal protein L18                          135   4e-36   
ref|XP_007014074.1|  Ribosomal L18p/L5e family protein isoform 2        135   4e-36   
ref|WP_036172465.1|  50S ribosomal protein L18                          135   4e-36   
ref|WP_027446522.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_042171420.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_022224483.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_022025530.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_004836726.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_002486248.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_038565223.1|  50S ribosomal protein L18                          135   5e-36   
gb|AEA77220.1|  LSU ribosomal protein L18p                              135   5e-36   
ref|WP_035332285.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_026561235.1|  50S ribosomal protein L18                          134   5e-36   
ref|WP_015838543.1|  50S ribosomal protein L18                          135   5e-36   
ref|WP_007791381.1|  MULTISPECIES: 50S ribosomal protein L18            135   6e-36   
ref|WP_003351411.1|  50S ribosomal protein L18                          134   6e-36   
ref|WP_005367759.1|  50S ribosomal protein L18 [                        134   6e-36   
ref|WP_025909741.1|  50S ribosomal protein L18                          134   6e-36   
ref|WP_035440815.1|  50S ribosomal protein L18                          134   6e-36   
ref|WP_019394054.1|  50S ribosomal protein L18                          134   6e-36   
ref|WP_028397293.1|  50S ribosomal protein L18                          134   6e-36   
ref|WP_010896333.1|  50S ribosomal protein L18                          134   6e-36   
gb|KIZ07935.1|  50S ribosomal protein L18                               135   6e-36   
ref|WP_041120844.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_026516587.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_034424906.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_044340530.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_044039372.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_018753979.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_003454424.1|  50S ribosomal protein L18                          134   7e-36   
ref|WP_028539490.1|  MULTISPECIES: 50S ribosomal protein L18            134   7e-36   
gb|EES71467.1|  ribosomal protein L18                                   134   8e-36   
ref|WP_012410710.1|  50S ribosomal protein L18                          134   8e-36   
ref|WP_009336596.1|  MULTISPECIES: 50S ribosomal protein L18            134   8e-36   
ref|WP_042679535.1|  50S ribosomal protein L18                          134   8e-36   
ref|WP_017754848.1|  50S ribosomal protein L18                          134   8e-36   
ref|WP_018978353.1|  50S ribosomal protein L18                          134   8e-36   
ref|WP_041071976.1|  50S ribosomal protein L18                          134   9e-36   
ref|XP_003595392.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_034551726.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_034323204.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_029488055.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_034765960.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_012002642.1|  MULTISPECIES: 50S ribosomal protein L18            134   9e-36   
ref|WP_027825728.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_021873232.1|  50S ribosomal protein L18                          134   9e-36   
ref|XP_001776099.1|  predicted protein                                  134   9e-36   
ref|WP_008592554.1|  50S ribosomal protein L18                          134   9e-36   
ref|WP_002457942.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_025706583.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_022211996.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_039832602.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_002494668.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_017651208.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_035724107.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_017381504.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_010498856.1|  MULTISPECIES: 50S ribosomal protein L18            134   1e-35   
ref|WP_022794483.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_001829747.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_019535606.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_016303558.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_022764366.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_028400871.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_013350816.1|  MULTISPECIES: 50S ribosomal protein L18            134   1e-35   
ref|WP_008396314.1|  MULTISPECIES: 50S ribosomal protein L18            134   1e-35   
ref|WP_002496107.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_040105336.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_028390446.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_015223446.1|  50S ribosomal protein L18                          134   1e-35   
ref|WP_010307931.1|  50S ribosomal protein L18                          133   1e-35   
ref|WP_005957497.1|  50S ribosomal protein L18                          133   2e-35   
ref|WP_022847336.1|  50S ribosomal protein L18                          134   2e-35   
ref|WP_029503014.1|  50S ribosomal protein L18                          134   2e-35   
ref|WP_039806308.1|  50S ribosomal protein L18                          133   2e-35   
ref|WP_000628816.1|  MULTISPECIES: 50S ribosomal protein L18            133   2e-35   



>ref|XP_009803342.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nicotiana 
sylvestris]
Length=207

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 12/172 (7%)
 Frame = +3

Query  48   CLEMSCNLIHssflhassssVGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRI  227
            C  +S + +H+           C     L    SF+ ++ TS RPL V+A++ TRREDR 
Sbjct  48   CTSLSLSFLHN----------ACADNKQL--TLSFRTKLVTSARPLTVEAKATTRREDRT  95

Query  228  ARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSG  407
            ARH RIRKKVEGTPERPRL VFRSNKH+YVQVIDD+KMHTLA+ STMQK ISEEF+YS+G
Sbjct  96   ARHVRIRKKVEGTPERPRLCVFRSNKHIYVQVIDDSKMHTLASASTMQKPISEEFDYSAG  155

Query  408  PTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            PT +VA+KVGEVIAK+CLEKGI+KVAFDRGGYPYHGRIEA+ADAARE+GLQF
Sbjct  156  PTTDVAKKVGEVIAKACLEKGITKVAFDRGGYPYHGRIEALADAAREHGLQF  207



>ref|XP_010087086.1| 50S ribosomal protein L18 [Morus notabilis]
 gb|EXB26141.1| 50S ribosomal protein L18 [Morus notabilis]
Length=161

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+A+++TR+EDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKM TLAA S
Sbjct  35   LVVEAKAKTRQEDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMRTLAAAS  94

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQKAISEEF+Y+SGPT+EVA+K+GEVIAK+CLEKGI+KVAFDRGGYPYHGR+EAIADAA
Sbjct  95   TMQKAISEEFSYTSGPTLEVAKKIGEVIAKTCLEKGITKVAFDRGGYPYHGRVEAIADAA  154

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  155  REHGLKF  161



>ref|XP_009353459.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Pyrus x 
bretschneideri]
Length=162

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  168  TSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHT  347
            T +R L+V+A++ T+REDR ARH+RIRKKVEGTPERPRL+VFRS+KH+YVQVIDDTKMHT
Sbjct  31   TQSRSLVVEAKATTKREDRTARHTRIRKKVEGTPERPRLAVFRSHKHIYVQVIDDTKMHT  90

Query  348  LAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEA  527
            LA+ STMQK ISEEF+Y+SGPT+EVA+KVGEVIAKSCLEKGISKVAFDRGGYPYHGR++A
Sbjct  91   LASASTMQKPISEEFDYTSGPTVEVAKKVGEVIAKSCLEKGISKVAFDRGGYPYHGRVQA  150

Query  528  IADAARENGLQF  563
            +ADAARE+GLQF
Sbjct  151  LADAAREHGLQF  162



>ref|XP_002509912.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF51299.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus 
communis]
Length=164

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 125/136 (92%), Gaps = 3/136 (2%)
 Frame = +3

Query  165  PTSTRP---LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDT  335
            PT  +P   L ++A ++TRRE+R ARH RIRKKVEGTPERPRLSVFRSNKHLYVQVIDD+
Sbjct  29   PTPIQPPRFLRIEANTKTRRENRTARHVRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDS  88

Query  336  KMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHG  515
            KMHTLA+ STMQK ISEEF+YSSGPT+EVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHG
Sbjct  89   KMHTLASASTMQKPISEEFDYSSGPTLEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHG  148

Query  516  RIEAIADAARENGLQF  563
            RIEA+ADAARENGLQF
Sbjct  149  RIEALADAARENGLQF  164



>ref|XP_008390247.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Malus 
domestica]
Length=162

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  168  TSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHT  347
            T +R L+V+A++ T+REDR ARH+RIRKKVEGTPERPRL++FRS+KH+YVQVIDDTKMHT
Sbjct  31   TQSRSLVVEAKAXTKREDRTARHTRIRKKVEGTPERPRLAIFRSHKHIYVQVIDDTKMHT  90

Query  348  LAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEA  527
            LA+ STMQK ISEEF+Y+SGPT+EVA+KVGEVIAKSCLEKGISKVAFDRGGYPYHGR++A
Sbjct  91   LASASTMQKPISEEFDYTSGPTVEVAKKVGEVIAKSCLEKGISKVAFDRGGYPYHGRVQA  150

Query  528  IADAARENGLQF  563
            +ADAARE+GLQF
Sbjct  151  LADAAREHGLQF  162



>ref|XP_012086779.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Jatropha 
curcas]
 gb|KDP25342.1| hypothetical protein JCGZ_20498 [Jatropha curcas]
Length=159

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 4/152 (3%)
 Frame = +3

Query  108  VGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLS  287
            +GC+QQL L  V +     P   R   ++A++RTRR++RIARH RIRKKVEGTPERPRLS
Sbjct  12   LGCRQQL-LAPVIAMPNSSPAFVR---IEAKTRTRRDNRIARHVRIRKKVEGTPERPRLS  67

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDD+KMHTLA+ ST QK +SEE +YSSGPT+EVA+KVGEVIAK+CLEK
Sbjct  68   VFRSNKHLYVQVIDDSKMHTLASASTKQKPVSEELDYSSGPTLEVAKKVGEVIAKTCLEK  127

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGG+PYHGRI+A+ADAARENGLQF
Sbjct  128  GITKVAFDRGGFPYHGRIQALADAARENGLQF  159



>ref|XP_006349873.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Solanum 
tuberosum]
Length=162

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  144  FSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQV  323
            F F+ ++ T  R L V+A+++TRREDR ARH RIRKKVEGTPERPR+ VFRSNKH+YVQV
Sbjct  23   FQFRPKLVTPIRVLTVEAKAKTRREDRTARHIRIRKKVEGTPERPRMCVFRSNKHIYVQV  82

Query  324  IDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGY  503
            IDD+KMHTLA+ STMQK ISEEF+YS+GPT EVA+KVGEVIAK+CLEKGI+KVAFDRGGY
Sbjct  83   IDDSKMHTLASASTMQKPISEEFDYSAGPTAEVAKKVGEVIAKACLEKGITKVAFDRGGY  142

Query  504  PYHGRIEAIADAARENGLQF  563
            PYHGRIEA+ADAARE+GLQF
Sbjct  143  PYHGRIEALADAAREHGLQF  162



>ref|XP_004252957.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Solanum 
lycopersicum]
Length=162

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  144  FSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQV  323
            F F+ ++ T  R L V+A+++TRREDR ARH RIRKKVEGTPERPR+ VFRSNKH+YVQV
Sbjct  23   FQFRPKLVTPIRVLTVEAKAKTRREDRTARHIRIRKKVEGTPERPRMCVFRSNKHIYVQV  82

Query  324  IDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGY  503
            IDD+KMHTLA+ STMQK ISEEF+YS+GPT EVA+KVGEVIAK+CLEKGI+KVAFDRGGY
Sbjct  83   IDDSKMHTLASASTMQKPISEEFDYSAGPTAEVAKKVGEVIAKACLEKGITKVAFDRGGY  142

Query  504  PYHGRIEAIADAARENGLQF  563
            PYHGRIEA+ADAARE+GLQF
Sbjct  143  PYHGRIEALADAAREHGLQF  162



>ref|XP_010244056.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nelumbo 
nucifera]
Length=159

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 4/148 (3%)
 Frame = +3

Query  120  QQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRS  299
            QQL L   F      P+    L+++A++ TRREDR+ARH+RIRKKVEGTPERPRLSVFRS
Sbjct  16   QQLTLGPKFIAAKASPS----LVIEAKATTRREDRLARHARIRKKVEGTPERPRLSVFRS  71

Query  300  NKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISK  479
            NKH+YVQVIDDTKMHTLA+ STMQK ISEEF+YSSGPT+EVA+++GE+IAK+CLEKGI K
Sbjct  72   NKHIYVQVIDDTKMHTLASASTMQKPISEEFDYSSGPTVEVAKRIGEIIAKNCLEKGIKK  131

Query  480  VAFDRGGYPYHGRIEAIADAARENGLQF  563
            VAFDRGGYPYHGR+EA+A+AARE+GLQF
Sbjct  132  VAFDRGGYPYHGRVEALANAAREHGLQF  159



>ref|XP_004297049.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=159

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  VGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLS  287
            VG  QQL +   F         ++ L+++A++ T+REDR ARH RIRKKVEGT ERPRL 
Sbjct  8    VGSSQQLWMRPKFVGVSAPKPQSQSLVIEAKATTKREDRTARHIRIRKKVEGTTERPRLC  67

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEK
Sbjct  68   VFRSNKHLYVQVIDDTKMHTLASASTMQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEK  127

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGR+EA+A+AARENGLQF
Sbjct  128  GITKVAFDRGGYPYHGRVEALANAARENGLQF  159



>gb|AFK34990.1| unknown [Lotus japonicus]
 gb|AFK35950.1| unknown [Lotus japonicus]
Length=162

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  180  PLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAV  359
            P +V+A+SRTR +DR ARH+RIRKKVEGTPERPRL+VFRSNKHL VQVIDDTKMHTLA+ 
Sbjct  35   PFVVEAKSRTRTDDRTARHARIRKKVEGTPERPRLAVFRSNKHLAVQVIDDTKMHTLASA  94

Query  360  STMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADA  539
            STMQKAI+EEF+Y++GPTIEVA+KVGE+IAKSCLEKGI+KVAFDRGGYPYHGR++A+ADA
Sbjct  95   STMQKAIAEEFSYTAGPTIEVAKKVGEIIAKSCLEKGITKVAFDRGGYPYHGRVQALADA  154

Query  540  ARENGLQF  563
            ARENGL F
Sbjct  155  ARENGLDF  162



>ref|XP_009631408.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Nicotiana 
tomentosiformis]
Length=162

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 137/172 (80%), Gaps = 12/172 (7%)
 Frame = +3

Query  48   CLEMSCNLIHssflhassssVGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRI  227
            C  +S + +H++            +QL L     F+ ++ T   PL V+A++ TRREDR 
Sbjct  3    CTSLSLSFLHNACAD--------NKQLSL----PFRTKLVTLALPLTVEAKATTRREDRT  50

Query  228  ARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSG  407
            ARH RIRKKVEGTPERPRL VFRSNKH+YVQVIDD+KMHTLA+ STMQK ISEEF+YS+G
Sbjct  51   ARHVRIRKKVEGTPERPRLCVFRSNKHIYVQVIDDSKMHTLASASTMQKPISEEFDYSAG  110

Query  408  PTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            PT +VA+KVGEVIAK+CLEKGI+KVAFDRGGYPYHGRIEA+ADAARE+GLQF
Sbjct  111  PTADVAKKVGEVIAKACLEKGITKVAFDRGGYPYHGRIEALADAAREHGLQF  162



>ref|XP_009359828.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Pyrus 
x bretschneideri]
Length=162

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            +R L+V+A++ T+REDR ARH+RIRKKVEGTPERPRL+VFRS+KH+YVQVIDD+KMHTLA
Sbjct  33   SRSLVVEAKATTKREDRTARHTRIRKKVEGTPERPRLAVFRSHKHIYVQVIDDSKMHTLA  92

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + STMQK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGISKVAFDRGGYPYHGR++A+A
Sbjct  93   SASTMQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGISKVAFDRGGYPYHGRVQALA  152

Query  534  DAARENGLQF  563
            DAARE+GLQF
Sbjct  153  DAAREHGLQF  162



>ref|XP_010043345.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85352.1| hypothetical protein EUGRSUZ_B02183 [Eucalyptus grandis]
Length=173

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  159  RVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTK  338
            R P    P  V+A  +TRREDR+ARHSRIRKKV+GTPERPRL VFRSNKHLYVQVIDDTK
Sbjct  39   RPPQRQPPFAVEARVKTRREDRLARHSRIRKKVQGTPERPRLCVFRSNKHLYVQVIDDTK  98

Query  339  MHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGR  518
            MHTLAAVSTMQK +SEE +YSSGPTIEVA++VGE+IAKSCLEKGI+KVAFDRGGYPYHGR
Sbjct  99   MHTLAAVSTMQKLVSEESDYSSGPTIEVAKRVGEIIAKSCLEKGITKVAFDRGGYPYHGR  158

Query  519  IEAIADAARENGLQF  563
            +EA+A+AARE+GLQF
Sbjct  159  VEALAEAAREHGLQF  173



>ref|XP_008369568.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Malus 
domestica]
Length=162

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            +R L+V+A++ T+REDR ARH+RIRK VEGTPERPRL+VFRS+KHLYVQVIDD+KMHTLA
Sbjct  33   SRSLVVEAKATTKREDRTARHTRIRKTVEGTPERPRLAVFRSHKHLYVQVIDDSKMHTLA  92

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + STMQK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGISKVAFDRGGYPYHGR++A+A
Sbjct  93   SASTMQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGISKVAFDRGGYPYHGRVQALA  152

Query  534  DAARENGLQF  563
            DAARE+GLQF
Sbjct  153  DAAREHGLQF  162



>ref|XP_008439021.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Cucumis 
melo]
Length=170

 Score =   231 bits (588),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+A++ TRREDR ARHSRIRKKVEGT ERPRLSVFRSNKHLYVQVIDD+KMHTLAAVS
Sbjct  44   LVVEAKATTRREDRAARHSRIRKKVEGTTERPRLSVFRSNKHLYVQVIDDSKMHTLAAVS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK+ISE  +YS+GPTIEVA+KVGE IAKSCLEKGI+KVAFDRGGYPYHGR+EA+ADAA
Sbjct  104  TMQKSISEGLDYSAGPTIEVAKKVGEAIAKSCLEKGITKVAFDRGGYPYHGRVEALADAA  163

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  164  REHGLQF  170



>ref|XP_010040376.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45272.1| hypothetical protein EUGRSUZ_L01079 [Eucalyptus grandis]
Length=173

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  159  RVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTK  338
            R P       V+A ++TRREDR+ARHSRIRKKVEGTPERPRL VFRSNKHLYVQVIDDTK
Sbjct  39   RPPQRQPSFAVEARAKTRREDRLARHSRIRKKVEGTPERPRLCVFRSNKHLYVQVIDDTK  98

Query  339  MHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGR  518
            MHTLAAVSTMQK +SEE +YSSGPTIEVA++VGE+IAKSCLEKGI+KVAFDRGGYPYHGR
Sbjct  99   MHTLAAVSTMQKLVSEESDYSSGPTIEVAKRVGEIIAKSCLEKGITKVAFDRGGYPYHGR  158

Query  519  IEAIADAARENGLQF  563
            +EA+A+AARE+GLQF
Sbjct  159  VEALAEAAREHGLQF  173



>ref|XP_004147640.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Cucumis 
sativus]
 gb|KGN57222.1| hypothetical protein Csa_3G171790 [Cucumis sativus]
Length=170

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+A++ TRREDR ARHSRIRKKVEGT ERPRLSVFRSNKHLYVQVIDD+KMHTLAAVS
Sbjct  44   LVVEAKATTRREDRTARHSRIRKKVEGTTERPRLSVFRSNKHLYVQVIDDSKMHTLAAVS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK+ISE  +YS+GPTIEVA+K+GE IAKSCLEKGI+KVAFDRGGYPYHGR+EA+ADAA
Sbjct  104  TMQKSISEGLDYSAGPTIEVAKKIGEAIAKSCLEKGITKVAFDRGGYPYHGRVEALADAA  163

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  164  REHGLQF  170



>ref|XP_008222310.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Prunus mume]
Length=166

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            ++ L+V+A++ T+REDR ARH RIRKKVEGTPERPRL+VFRSNKH+Y QVIDDTKMHTLA
Sbjct  37   SQSLVVEAKATTKREDRTARHIRIRKKVEGTPERPRLAVFRSNKHIYAQVIDDTKMHTLA  96

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + STMQK +SEEF+Y++GPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGR+EA+A
Sbjct  97   SASTMQKPVSEEFDYTAGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRVEALA  156

Query  534  DAARENGLQF  563
            DAARE+GLQF
Sbjct  157  DAAREHGLQF  166



>gb|KHN41509.1| 50S ribosomal protein L18, chloroplastic [Glycine soja]
Length=160

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  165  PTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMH  344
            P+ + P +++A+ RTRREDR ARH+RIRKKVEGTPERPRLSVFRSNKHL VQVIDDTKMH
Sbjct  28   PSHSLPFVLEAKDRTRREDRSARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTKMH  87

Query  345  TLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIE  524
            TLA++STMQK ++EEFNYS+GPT+EVA+++GE+IAKSCLEKGI+KVAFDRGGYPYHGR++
Sbjct  88   TLASISTMQKTVAEEFNYSAGPTLEVAKRMGEIIAKSCLEKGITKVAFDRGGYPYHGRVQ  147

Query  525  AIADAARENGLQF  563
            A+A+AARE+GL F
Sbjct  148  ALAEAAREHGLDF  160



>ref|XP_002270819.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Vitis vinifera]
 pdb|3BBO|Q Chain Q, Homology Model For The Spinach Chloroplast 50s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 emb|CAN83428.1| hypothetical protein VITISV_034871 [Vitis vinifera]
 emb|CBI26042.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 12/153 (8%)
 Frame = +3

Query  120  QQLPLCNVFSFKLRVPTSTRPL-----IVQAESRTRREDRIARHSRIRKKVEGTPERPRL  284
            QQLPL   F+       + +PL     I++A+++TRREDR ARH RIRKKVEGTPERPRL
Sbjct  16   QQLPLLPKFA-------AAKPLLPSFPIIEAKAKTRREDRTARHVRIRKKVEGTPERPRL  68

Query  285  SVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLE  464
             VFRSNKHLYVQVIDD+KMHTLA+ STMQK+ISEE +YSS PTIEVA+KVGEVIA +CLE
Sbjct  69   CVFRSNKHLYVQVIDDSKMHTLASASTMQKSISEELDYSSSPTIEVAKKVGEVIASACLE  128

Query  465  KGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            KGI+KVAFDRGGYPYHGR++A+ADAARE GLQF
Sbjct  129  KGITKVAFDRGGYPYHGRVKALADAAREKGLQF  161



>ref|XP_011093509.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Sesamum 
indicum]
Length=168

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  RPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAA  356
            R L+V+A+SRTR +DR ARH+RIRKKVEGTPERPRL VFRSNKH+Y QVIDD+KMHTLA+
Sbjct  40   RRLVVEAKSRTRTQDRTARHARIRKKVEGTPERPRLCVFRSNKHIYAQVIDDSKMHTLAS  99

Query  357  VSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIAD  536
             STMQK ISEEF+YSSGPTI+VA+KVGE++AK+CLEKGI+KVAFDRGGYPYHGRIEA+AD
Sbjct  100  ASTMQKPISEEFDYSSGPTIDVAKKVGEILAKTCLEKGITKVAFDRGGYPYHGRIEALAD  159

Query  537  AARENGLQF  563
            AARE+GLQF
Sbjct  160  AAREHGLQF  168



>ref|XP_007225963.1| hypothetical protein PRUPE_ppa012509mg [Prunus persica]
 gb|EMJ27162.1| hypothetical protein PRUPE_ppa012509mg [Prunus persica]
Length=166

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            ++ L+V+A++ T+REDR ARH RIRKKVEGTPERPRL+VFRSNKH+Y QVIDDTKMHTLA
Sbjct  37   SQSLVVEAKATTKREDRTARHIRIRKKVEGTPERPRLAVFRSNKHIYAQVIDDTKMHTLA  96

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + STMQK +S+EF+Y++GPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGR+EA+A
Sbjct  97   SASTMQKPVSDEFDYTAGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRVEALA  156

Query  534  DAARENGLQF  563
            DAARE+GLQF
Sbjct  157  DAAREHGLQF  166



>ref|XP_010999351.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Populus 
euphratica]
 ref|XP_011007071.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Populus 
euphratica]
Length=165

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  VGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLS  287
            +G   Q    +V + K R   S   + V+A+++TRREDR ARH RIRKKVEGTP+RPRL 
Sbjct  14   LGSGGQQLRASVAAAKQRASPSLSFVTVEAKAKTRREDRTARHIRIRKKVEGTPDRPRLC  73

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK  +++F+YSSGPTIEVA+KVGEVIAKSCLEK
Sbjct  74   VFRSNKHLYVQVIDDTKMHTLASASTMQKPFAQDFDYSSGPTIEVAKKVGEVIAKSCLEK  133

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGR+ A+ADAARENGLQF
Sbjct  134  GITKVAFDRGGYPYHGRVAALADAARENGLQF  165



>ref|XP_006388561.1| ribosomal protein L18 [Populus trichocarpa]
 gb|ABK95541.1| unknown [Populus trichocarpa]
 gb|ERP47475.1| ribosomal protein L18 [Populus trichocarpa]
Length=165

 Score =   228 bits (581),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  VGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLS  287
            +G   Q    +V + K R   S   + V+A+++TRREDR ARH RIRKKVEGTP+RPRL 
Sbjct  14   LGSGGQQLRASVAAVKQRTSPSLSFVTVEAKAKTRREDRTARHIRIRKKVEGTPDRPRLC  73

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK  +++F+YSSGPTI+VA+KVGEVIAKSCLEK
Sbjct  74   VFRSNKHLYVQVIDDTKMHTLASASTMQKPFAQDFDYSSGPTIDVAKKVGEVIAKSCLEK  133

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGR+ A+ADAARENGLQF
Sbjct  134  GITKVAFDRGGYPYHGRVAALADAARENGLQF  165



>ref|XP_006478532.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Citrus 
sinensis]
Length=171

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 128/152 (84%), Gaps = 9/152 (6%)
 Frame = +3

Query  135  CNVFSFKLRVPTSTRP-------LIVQAESR--TRREDRIARHSRIRKKVEGTPERPRLS  287
            C   S   ++  S+RP        IV+A +R  T+REDR ARHSRIRKK++GTPERPRL 
Sbjct  20   CQQLSSVSKLVASSRPGPVPPSLFIVEASTRPRTKREDRTARHSRIRKKIDGTPERPRLC  79

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK ISEE +YSSGPTIEVA+KVGE+IAKSCLEK
Sbjct  80   VFRSNKHLYVQVIDDTKMHTLASASTMQKPISEELDYSSGPTIEVAKKVGEMIAKSCLEK  139

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGRI+A+ADAARE+GLQF
Sbjct  140  GITKVAFDRGGYPYHGRIQALADAAREHGLQF  171



>gb|EPS74009.1| hypothetical protein M569_00746, partial [Genlisea aurea]
Length=125

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  189  VQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTM  368
            V A+SRTRREDR ARHSRIRKKVEGTPERPRLSVFRSNKHLY QVIDD+KMHTLA+ ST+
Sbjct  1    VAAQSRTRREDRAARHSRIRKKVEGTPERPRLSVFRSNKHLYAQVIDDSKMHTLASASTV  60

Query  369  QKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARE  548
            QK +S+EF+YSSGPTIEVA++VGEVIAKSC+EKGI KVAFDRGGYPYHGRIEA+ADAARE
Sbjct  61   QKPVSDEFDYSSGPTIEVAKRVGEVIAKSCIEKGIRKVAFDRGGYPYHGRIEALADAARE  120

Query  549  NGLQF  563
             GL+F
Sbjct  121  QGLEF  125



>ref|NP_001236805.1| uncharacterized protein LOC100306308 [Glycine max]
 gb|ACU14426.1| unknown [Glycine max]
Length=160

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  165  PTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMH  344
            P+ + P +++A+ RTRREDR ARH+RIRKKVEGTPERPRLSVFRSNKHL VQVIDDTKMH
Sbjct  28   PSHSLPFVLEAKDRTRREDRSARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTKMH  87

Query  345  TLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIE  524
            TLA++STMQK ++EEFNYS+GPT+EVA+++GE+IAKSCLEKGI+KVAFD+GGYPYHGR++
Sbjct  88   TLASISTMQKTVAEEFNYSAGPTLEVAKRMGEIIAKSCLEKGITKVAFDQGGYPYHGRVQ  147

Query  525  AIADAARENGLQF  563
            A+A+AARE+GL F
Sbjct  148  ALAEAAREHGLDF  160



>gb|KCW85353.1| hypothetical protein EUGRSUZ_B02183 [Eucalyptus grandis]
Length=173

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  159  RVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTK  338
            R P    P  V+A  +TRREDR+ARHSRIRKKV+GTPERPRL VFRSNKHLYVQVIDDTK
Sbjct  39   RPPQRQPPFAVEARVKTRREDRLARHSRIRKKVQGTPERPRLCVFRSNKHLYVQVIDDTK  98

Query  339  MHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGR  518
            MHTLAAVSTMQK +SEE +YSSGPTI +A++VGE+IAKSCLEKGI+KVAFDRGGYPYHGR
Sbjct  99   MHTLAAVSTMQKLVSEESDYSSGPTIVMAKRVGEIIAKSCLEKGITKVAFDRGGYPYHGR  158

Query  519  IEAIADAARENGLQF  563
            +EA+A+AARE+GLQF
Sbjct  159  VEALAEAAREHGLQF  173



>ref|XP_010254629.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nelumbo 
nucifera]
Length=159

 Score =   226 bits (577),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  120  QQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRS  299
            QQL L   F      P+    L+++A++ TRREDR+ARH+RIRKKVEGTPERPRLSVFRS
Sbjct  16   QQLTLGPKFVAAKASPS----LVIEAKATTRREDRLARHARIRKKVEGTPERPRLSVFRS  71

Query  300  NKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISK  479
            NKH+YVQVIDDTKMHTLA+ STMQK ISEEF+YSSGPT+EVA++VGE+IAK+CLEKGI+K
Sbjct  72   NKHIYVQVIDDTKMHTLASASTMQKPISEEFDYSSGPTVEVAKRVGEIIAKNCLEKGITK  131

Query  480  VAFDRGGYPYHGRIEAIADAARENGLQF  563
            VAFDR  YPYHGR+EA+A+AARE+GLQF
Sbjct  132  VAFDRCDYPYHGRVEALANAAREHGLQF  159



>ref|XP_007014073.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao]
 gb|EOY31692.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao]
Length=176

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  FSFKLRVPTSTRPLI---VQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLY  314
             S +L  P  + P I   VQA++RTRRED  ARHSRIRKKVEGTP+RPRL VFRSNKHLY
Sbjct  34   LSPRLPCPHPSLPSILLNVQAKARTRREDCQARHSRIRKKVEGTPDRPRLCVFRSNKHLY  93

Query  315  VQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDR  494
            VQVIDD+KMHTLA+ STMQK I EEF+YSSGPTIEVA+K+GE IAKSCLE+GI+KVAFDR
Sbjct  94   VQVIDDSKMHTLASASTMQKPICEEFDYSSGPTIEVAKKIGECIAKSCLEQGITKVAFDR  153

Query  495  GGYPYHGRIEAIADAARENGLQF  563
            GGYPYHGRIEA+AD+ARE+GLQF
Sbjct  154  GGYPYHGRIEALADSAREHGLQF  176



>gb|KJB23403.1| hypothetical protein B456_004G096600 [Gossypium raimondii]
Length=176

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L VQA++RTR EDR ARHSRIRKK+EGTP+RPRL VFRSNKHLYVQVIDD+KMHTLA+ S
Sbjct  50   LNVQAKARTRTEDREARHSRIRKKIEGTPDRPRLCVFRSNKHLYVQVIDDSKMHTLASAS  109

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK I EEFNY+SGPTIEVA+KVGE IAKSCLEKGI+KVAFDRGGYPYHGR++A+AD+A
Sbjct  110  TMQKPICEEFNYTSGPTIEVAKKVGEFIAKSCLEKGITKVAFDRGGYPYHGRVQALADSA  169

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  170  REHGLQF  176



>gb|KDO46879.1| hypothetical protein CISIN_1g030804mg [Citrus sinensis]
Length=171

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +3

Query  114  CKQQLPLCNVFSFKLRVPTSTRPLIVQAESR--TRREDRIARHSRIRKKVEGTPERPRLS  287
            C+Q   +  + + +   P      IV+A +R  T+REDR ARHSRIRKK++GTPERPRL 
Sbjct  20   CQQLSSVSKLVASRRPRPAPPSLFIVEASTRPRTKREDRTARHSRIRKKIDGTPERPRLC  79

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK ISEE +YSSGPTIEV++KVGE+IAKSCLEK
Sbjct  80   VFRSNKHLYVQVIDDTKMHTLASASTMQKPISEELDYSSGPTIEVSKKVGEMIAKSCLEK  139

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGRI+A+ADAARE GLQF
Sbjct  140  GITKVAFDRGGYPYHGRIQALADAAREYGLQF  171



>ref|XP_010479253.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Camelina 
sativa]
Length=171

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            +RP++V+++++T  EDR ARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA
Sbjct  42   SRPMVVESKTKTSTEDRTARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLA  101

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + ST QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A
Sbjct  102  SASTKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALA  161

Query  534  DAARENGLQF  563
             AARE+GLQF
Sbjct  162  AAAREHGLQF  171



>ref|XP_010461649.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Camelina 
sativa]
Length=174

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            +RP++V+++++T  EDR ARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA
Sbjct  45   SRPMVVESKTKTSTEDRTARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLA  104

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + ST QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A
Sbjct  105  SASTKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALA  164

Query  534  DAARENGLQF  563
             AARE+GLQF
Sbjct  165  AAAREHGLQF  174



>gb|KFK36100.1| hypothetical protein AALP_AA4G077300 [Arabis alpina]
Length=168

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  42   LVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASAS  101

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  102  TKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  161

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  162  REHGLQF  168



>emb|CDY41837.1| BnaA08g03320D [Brassica napus]
Length=171

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  141  VFSFKLRVPTSTRP--LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLY  314
            VF      P+  +P  L+V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLY
Sbjct  29   VFLKPWSPPSLLKPGSLVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLY  88

Query  315  VQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDR  494
            VQVIDDTKMHTLA+ ST QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDR
Sbjct  89   VQVIDDTKMHTLASASTKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDR  148

Query  495  GGYPYHGRIEAIADAARENGLQF  563
            GGYPYHGRIEA+A AARE+GLQF
Sbjct  149  GGYPYHGRIEALAAAAREHGLQF  171



>ref|XP_006441940.1| hypothetical protein CICLE_v10022561mg [Citrus clementina]
 gb|ESR55180.1| hypothetical protein CICLE_v10022561mg [Citrus clementina]
Length=171

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +3

Query  114  CKQQLPLCNVFSFKLRVPTSTRPLIVQAESR--TRREDRIARHSRIRKKVEGTPERPRLS  287
            C+Q   +  + + +   P      IV+A +R  T+REDR ARHSRIRKK++GTPERPRL 
Sbjct  20   CQQLSSVSKLVASRRPRPAPPSLFIVEASTRPRTKREDRTARHSRIRKKIDGTPERPRLC  79

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLYVQVIDDTKMHTLA+ STMQK IS+E +YSSGPTIEV++KVGE+IAKSCLEK
Sbjct  80   VFRSNKHLYVQVIDDTKMHTLASASTMQKPISDELDYSSGPTIEVSKKVGEMIAKSCLEK  139

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KVAFDRGGYPYHGRI+A+ADAARE GLQF
Sbjct  140  GITKVAFDRGGYPYHGRIQALADAAREYGLQF  171



>ref|XP_003546534.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Glycine 
max]
 gb|KHN44312.1| 50S ribosomal protein L18, chloroplastic [Glycine soja]
Length=162

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  165  PTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMH  344
            P+   P +V+A+ RTRREDR ARH+RIRKKVEGTPERPRLSVFRSNKHL VQVIDDT M 
Sbjct  30   PSHFLPFVVEAKDRTRREDRTARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTAMR  89

Query  345  TLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIE  524
            TLA+VSTMQK +++EFNYS+GPT+EVA+++GE+IAKSCLEKGI+KVAFDRGGYPYHGR++
Sbjct  90   TLASVSTMQKTVADEFNYSAGPTVEVAKRMGEIIAKSCLEKGITKVAFDRGGYPYHGRVQ  149

Query  525  AIADAARENGLQF  563
            A+A+AARE+GL F
Sbjct  150  ALAEAAREHGLDF  162



>ref|XP_009107364.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Brassica 
rapa]
Length=171

 Score =   224 bits (570),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  45   LVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASAS  104

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  105  TKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  164

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  165  REHGLQF  171



>gb|KJB23404.1| hypothetical protein B456_004G096600 [Gossypium raimondii]
Length=256

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L VQA++RTR EDR ARHSRIRKK+EGTP+RPRL VFRSNKHLYVQVIDD+KMHTLA+ S
Sbjct  130  LNVQAKARTRTEDREARHSRIRKKIEGTPDRPRLCVFRSNKHLYVQVIDDSKMHTLASAS  189

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK I EEFNY+SGPTIEVA+KVGE IAKSCLEKGI+KVAFDRGGYPYHGR++A+AD+A
Sbjct  190  TMQKPICEEFNYTSGPTIEVAKKVGEFIAKSCLEKGITKVAFDRGGYPYHGRVQALADSA  249

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  250  REHGLQF  256



>ref|XP_010500357.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Camelina 
sativa]
Length=173

 Score =   223 bits (569),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  TRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLA  353
            +RP++V+++++T  EDR ARHSRIRKK  GT ERPRL VFRSNKHLYVQVIDDTKMHTLA
Sbjct  44   SRPMVVESKTKTSTEDRTARHSRIRKKANGTTERPRLCVFRSNKHLYVQVIDDTKMHTLA  103

Query  354  AVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIA  533
            + ST QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A
Sbjct  104  SASTKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALA  163

Query  534  DAARENGLQF  563
             AARE+GLQF
Sbjct  164  AAAREHGLQF  173



>emb|CDP18513.1| unnamed protein product [Coffea canephora]
Length=168

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L ++A++ TRR DR ARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDD+KMHTLA+ S
Sbjct  42   LSIEAKAGTRRVDRTARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDSKMHTLASAS  101

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK IS++ NYSS PTI+VA+KVG+ IAKSCLEKGI+KVAFDRGGYPYHGRIEA+ADAA
Sbjct  102  TMQKPISDDLNYSSAPTIDVAKKVGKAIAKSCLEKGITKVAFDRGGYPYHGRIEALADAA  161

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  162  REHGLQF  168



>ref|XP_002891426.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67685.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=170

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  44   MVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  104  TKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  163

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  164  REHGLQF  170



>emb|CDX77315.1| BnaC08g03600D [Brassica napus]
Length=171

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  45   MVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASAS  104

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  105  TKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  164

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  165  REHGLQF  171



>ref|NP_175268.1| 50S ribosomal protein L18/L5e family protein [Arabidopsis thaliana]
 sp|Q9SX68.1|RK18_ARATH RecName: Full=50S ribosomal protein L18, chloroplastic; AltName: 
Full=CL18; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD49760.1|AC007932_8 Similar to 50S Ribosomal protein L18 from Thermotoga maritima 
gb|AE001798. ESTs gb|AI993387, gb|T75951 and gb|T22182 come 
from this gene [Arabidopsis thaliana]
 gb|AAG54003.1|AF336922_1 putative ribosomal protein L18 [Arabidopsis thaliana]
 dbj|BAE98573.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32277.1| 50S ribosomal protein L18/L5e family protein [Arabidopsis thaliana]
Length=170

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++V+A+++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  44   MVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLASAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  104  TKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  163

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  164  REHGLQF  170



>ref|XP_009384139.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=186

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  147  SFKLRVPTSTR-PLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQV  323
            S  +  PT+TR P  ++A+  TRRE+R  RH R+RKKV GTPERPR+SVFRSNKHLYVQV
Sbjct  47   SSAMACPTTTRRPSFIEAKVVTRRENRTFRHERLRKKVTGTPERPRMSVFRSNKHLYVQV  106

Query  324  IDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGY  503
            IDDTKMHTLA+ STMQK +SEEF+ SSGPT++VA+KVGEVIAKSCLEKGI++VAFDRGGY
Sbjct  107  IDDTKMHTLASASTMQKPVSEEFDCSSGPTVDVAKKVGEVIAKSCLEKGITRVAFDRGGY  166

Query  504  PYHGRIEAIADAARENGLQF  563
            PYHGRIEA+A+AARENGL+F
Sbjct  167  PYHGRIEALANAARENGLEF  186



>ref|XP_003595391.1| 50S ribosomal protein L18 [Medicago truncatula]
 gb|ABN08339.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES65642.1| 50S ribosomal protein L18 [Medicago truncatula]
 gb|AFK47933.1| unknown [Medicago truncatula]
Length=166

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 119/127 (94%), Gaps = 2/127 (2%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
             +VQA   TRREDRIARH R+RKK+EGTPERPRLSVFRSNKHL+VQVIDDTKMHTLA+ S
Sbjct  42   FVVQAT--TRREDRIARHVRLRKKIEGTPERPRLSVFRSNKHLFVQVIDDTKMHTLASAS  99

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQKAI+EE N++SGPTIEVA++VGE+IAKSCLEKGI+KV FDRGGYPYHGR++AIADAA
Sbjct  100  TMQKAIAEELNFTSGPTIEVAKRVGEIIAKSCLEKGITKVVFDRGGYPYHGRVKAIADAA  159

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  160  REHGLEF  166



>ref|XP_010694131.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  186  IVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVST  365
            ++QA++ TRREDR ARH R+RKKVEGTPERPRL VFRSNKHLYVQVIDDTKMHTLA+ ST
Sbjct  42   LIQAKAHTRREDRTARHVRVRKKVEGTPERPRLCVFRSNKHLYVQVIDDTKMHTLASAST  101

Query  366  MQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAAR  545
            MQK ISEE +++SGPT+EVA+KVGE+IAKSCL+KGI+KVAFDRGGYPYHGR++A+ADAAR
Sbjct  102  MQKPISEEASFTSGPTVEVAQKVGEMIAKSCLDKGITKVAFDRGGYPYHGRVQALADAAR  161

Query  546  ENGLQF  563
            E+GLQF
Sbjct  162  EHGLQF  167



>ref|XP_010914839.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Elaeis 
guineensis]
Length=177

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 125/150 (83%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  CKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVF  293
            C Q+LPL        R     R  +++A++ TRRE+R ARH RIR+KVEGTPERPR+SVF
Sbjct  32   CGQRLPL----PAPARTWALARRPVIEAKAVTRRENRAARHQRIRRKVEGTPERPRMSVF  87

Query  294  RSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGI  473
            RSNKHLYVQVIDDTKMHTLA+ STMQK++ EE  Y+SGPTIEVA+KVGE IAKSCLEKGI
Sbjct  88   RSNKHLYVQVIDDTKMHTLASASTMQKSVLEEVEYTSGPTIEVAKKVGEAIAKSCLEKGI  147

Query  474  SKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +KVAFDRGGY YHGR+EA+A+AARENGLQF
Sbjct  148  TKVAFDRGGYLYHGRMEALANAARENGLQF  177



>ref|XP_007138590.1| hypothetical protein PHAVU_009G221700g [Phaseolus vulgaris]
 gb|ESW10584.1| hypothetical protein PHAVU_009G221700g [Phaseolus vulgaris]
Length=161

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  RPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAA  356
            +P +V+A+ RTRREDR ARH+RIRKKVEGTPERPRLSVFRSNKHL VQVIDDT M TLA+
Sbjct  33   KPFMVEAKVRTRREDRTARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTAMCTLAS  92

Query  357  VSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIAD  536
             STMQK I+EEF+YS+GPT+EVA+++GE+IAKSCLEKGI KVAFDRGGYPYHGR++A+AD
Sbjct  93   ASTMQKTIAEEFSYSAGPTVEVAKRIGEIIAKSCLEKGIKKVAFDRGGYPYHGRVQALAD  152

Query  537  AARENGLQF  563
            AARE+GL F
Sbjct  153  AAREHGLDF  161



>ref|XP_006393423.1| hypothetical protein EUTSA_v10011822mg [Eutrema salsugineum]
 gb|ESQ30709.1| hypothetical protein EUTSA_v10011822mg [Eutrema salsugineum]
Length=173

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+V+++++T  EDRIARHSRIRKKV GT ERPR+ VFRSNKHLYVQVIDDTKMHTLA+ S
Sbjct  47   LVVESKTKTSSEDRIARHSRIRKKVNGTTERPRMCVFRSNKHLYVQVIDDTKMHTLASAS  106

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK ISE+F+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AA
Sbjct  107  TKQKPISEDFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAA  166

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  167  REHGLQF  173



>gb|ACJ84202.1| unknown [Medicago truncatula]
Length=166

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 118/127 (93%), Gaps = 2/127 (2%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
             +VQA   TRREDRIARH R+RKK+EGTPERPRLSVFRSNKHL+VQVIDDTKMHTLA+ S
Sbjct  42   FVVQAT--TRREDRIARHVRLRKKIEGTPERPRLSVFRSNKHLFVQVIDDTKMHTLASAS  99

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQKAI+EE N++SGPTIEVA++VGE+IAKSCLEKGI+KV FDRGGYPYHGR++ IADAA
Sbjct  100  TMQKAIAEELNFTSGPTIEVAKRVGEIIAKSCLEKGITKVVFDRGGYPYHGRVKTIADAA  159

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  160  REHGLEF  166



>ref|XP_006306511.1| hypothetical protein CARUB_v10012508mg [Capsella rubella]
 gb|EOA39409.1| hypothetical protein CARUB_v10012508mg [Capsella rubella]
Length=171

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +3

Query  186  IVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVST  365
            +V+++++T  EDRIARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDD+KMHTLA+ ST
Sbjct  46   VVESKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDSKMHTLASAST  105

Query  366  MQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAAR  545
             QK ISEEF+Y+SGPTIEVA+KVGEVIAKSCLEKGI+KVAFDRGGYPYHGRIEA+A AAR
Sbjct  106  KQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAR  165

Query  546  ENGLQF  563
            E+GLQF
Sbjct  166  EHGLQF  171



>ref|XP_010551121.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Tarenaya 
hassleriana]
Length=169

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++V A++RTR +DR ARHSRIRKKV GT ERPRL VFRSNKHLYVQVIDDTKMHT+A+ S
Sbjct  43   IVVAAKARTRGDDRTARHSRIRKKVSGTTERPRLCVFRSNKHLYVQVIDDTKMHTIASAS  102

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T QK +SEEF++++GPTIEVA++VGEVIAKSCLEKG++KVAFDRGGYPYHGR+EA+ADAA
Sbjct  103  TKQKPVSEEFDFTAGPTIEVAKRVGEVIAKSCLEKGVTKVAFDRGGYPYHGRVEALADAA  162

Query  543  RENGLQF  563
            RE+GLQF
Sbjct  163  REHGLQF  169



>ref|XP_006388235.1| hypothetical protein POPTR_0271s00220g, partial [Populus trichocarpa]
 gb|ERP47149.1| hypothetical protein POPTR_0271s00220g, partial [Populus trichocarpa]
Length=195

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  108  VGCKQQLPLCNVFSFKLRVPTSTRPLIVQAESRTRREDRIARHSRIRKKV---------E  260
            +G   Q    +V + K R   S   + V+A+++TRREDR ARH RIRKKV         +
Sbjct  35   LGSGGQQLRASVAAAKQRTSPSLSFVTVEAKAKTRREDRTARHIRIRKKVSLSLHFFMWK  94

Query  261  GTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGE  440
            GTP+RPRL VFRSNKHLYVQVIDDTKMHTLA+ STMQK  +++F+YSSGPTI+VA+KVGE
Sbjct  95   GTPDRPRLCVFRSNKHLYVQVIDDTKMHTLASASTMQKPFAQDFDYSSGPTIDVAKKVGE  154

Query  441  VIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            VIAKSCLEKGI+KVAFDRGGYPYHGR+ A+ADAARENGLQF
Sbjct  155  VIAKSCLEKGITKVAFDRGGYPYHGRVAALADAARENGLQF  195



>ref|XP_010263172.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Nelumbo 
nucifera]
Length=267

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 121/129 (94%), Gaps = 2/129 (2%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L+++A++ TRREDR+ARH+RIRKKVE TPERPRLSVF SNKH+YVQVIDDTKMHTLA+ S
Sbjct  139  LVIEAKATTRREDRLARHARIRKKVEWTPERPRLSVFHSNKHIYVQVIDDTKMHTLASTS  198

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGR--IEAIAD  536
            TMQK ISEEF+YS GPT+EVA++VGE+IAK+CLEKG++KVAFD+GGYPYHGR  +EA+A+
Sbjct  199  TMQKPISEEFDYSPGPTVEVAKRVGEIIAKNCLEKGMTKVAFDQGGYPYHGRVGVEALAN  258

Query  537  AARENGLQF  563
            AARE+GLQF
Sbjct  259  AAREHGLQF  267



>ref|XP_006848386.2| PREDICTED: 50S ribosomal protein L18, chloroplastic [Amborella 
trichopoda]
Length=167

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = +3

Query  180  PLI-VQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAA  356
            PL+ + A++ TRRE+R+ARH RIRKKVEG+PERPRL VFRSNKH+YVQVIDD+KMHTLAA
Sbjct  39   PLLRIDAKAATRRENRVARHERIRKKVEGSPERPRLCVFRSNKHMYVQVIDDSKMHTLAA  98

Query  357  VSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIAD  536
             STMQK + +E ++SSGPTIEVA+K+GE IAK+CLEKGI+KVAFDRGG+PYHGR+EA+AD
Sbjct  99   ASTMQKPLRDEIDFSSGPTIEVAKKIGEAIAKACLEKGITKVAFDRGGFPYHGRVEALAD  158

Query  537  AARENGLQF  563
            AARE+GL+F
Sbjct  159  AAREHGLEF  167



>gb|ERN09967.1| hypothetical protein AMTR_s00013p00209880 [Amborella trichopoda]
Length=164

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = +3

Query  180  PLI-VQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAA  356
            PL+ + A++ TRRE+R+ARH RIRKKVEG+PERPRL VFRSNKH+YVQVIDD+KMHTLAA
Sbjct  36   PLLRIDAKAATRRENRVARHERIRKKVEGSPERPRLCVFRSNKHMYVQVIDDSKMHTLAA  95

Query  357  VSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIAD  536
             STMQK + +E ++SSGPTIEVA+K+GE IAK+CLEKGI+KVAFDRGG+PYHGR+EA+AD
Sbjct  96   ASTMQKPLRDEIDFSSGPTIEVAKKIGEAIAKACLEKGITKVAFDRGGFPYHGRVEALAD  155

Query  537  AARENGLQF  563
            AARE+GL+F
Sbjct  156  AAREHGLEF  164



>gb|ABK23983.1| unknown [Picea sitchensis]
 gb|ABK25055.1| unknown [Picea sitchensis]
Length=178

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            L ++A  +T RE+RIARH RIRKKVEGTPERPRL+VFRSNKHLY QVIDDTKMHTLA+ S
Sbjct  52   LKIEAAEKTSRENRIARHVRIRKKVEGTPERPRLAVFRSNKHLYCQVIDDTKMHTLASAS  111

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TMQK +SEE + +SGPTIE ARKVGE IAK+CLEKGI+KVAFDRGG+ YHGRI+A+AD+A
Sbjct  112  TMQKPLSEELDLTSGPTIEAARKVGETIAKACLEKGINKVAFDRGGFKYHGRIKALADSA  171

Query  543  RENGLQF  563
            RE GL F
Sbjct  172  REQGLDF  178



>ref|XP_004488160.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Cicer 
arietinum]
Length=146

 Score =   197 bits (500),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 113/149 (76%), Gaps = 20/149 (13%)
 Frame = +3

Query  135  CNVFSFKLRVPT------STRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFR  296
            C   S  L +PT      S+   +V+A+S TRREDR ARH RIRKKVEGTPERP      
Sbjct  12   CAFPSSSLTIPTPNPNSNSSLSFVVEAKSTTRREDRTARHVRIRKKVEGTPERP------  65

Query  297  SNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGIS  476
                    +IDDTKMHTLA+ STMQK I+EE NY+SGPTIEVA+KVGE+IAKSCLEKGI+
Sbjct  66   --------MIDDTKMHTLASASTMQKTIAEELNYTSGPTIEVAKKVGEIIAKSCLEKGIT  117

Query  477  KVAFDRGGYPYHGRIEAIADAARENGLQF  563
            KVAFDRGGYPYHGR++AIADAARENGL F
Sbjct  118  KVAFDRGGYPYHGRVKAIADAARENGLDF  146



>dbj|BAK03461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=170

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ +A+  T   DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ S
Sbjct  44   VLAKAKVSTPNADRIARHDRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLASAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S+E  YS+GPT EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAA
Sbjct  104  TMHKSLSKELEYSAGPTTEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAA  163

Query  543  RENGLQF  563
            RENGL+F
Sbjct  164  RENGLEF  170



>gb|ACF85829.1| unknown [Zea mays]
 gb|ACN33959.1| unknown [Zea mays]
 gb|ACR38645.1| unknown [Zea mays]
 tpg|DAA52306.1| TPA: 50S ribosomal protein L18 [Zea mays]
Length=165

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T ++DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ S
Sbjct  39   VVAKVKVATPQDDRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKQCTLASAS  98

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S+EF YS+GPTIE+A+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+AD+A
Sbjct  99   TMHKSLSKEFEYSAGPTIEIAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADSA  158

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  159  REHGLEF  165



>ref|NP_001151288.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG42248.1| 50S ribosomal protein L18 [Zea mays]
Length=165

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T ++DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ S
Sbjct  39   VVAKVKVATPQDDRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKQCTLASAS  98

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S+EF YS+GPTIE+A+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+AD+A
Sbjct  99   TMHKSLSKEFEYSAGPTIEIAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADSA  158

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  159  REHGLEF  165



>gb|ACG30572.1| 50S ribosomal protein L18 [Zea mays]
 gb|ACG39456.1| 50S ribosomal protein L18 [Zea mays]
Length=165

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T ++DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ S
Sbjct  39   VVAKVKVATPQDDRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKQCTLASAS  98

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S+EF YS+GPTIE+A+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+AD+A
Sbjct  99   TMHKSLSKEFEYSAGPTIEIAQKIGEVIAKSCLEKGINKVVFDRGGFLYHGRIKALADSA  158

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  159  REHGLEF  165



>ref|XP_004981146.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Setaria 
italica]
Length=169

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 117/152 (77%), Gaps = 13/152 (9%)
 Frame = +3

Query  147  SFKLRVPTSTRP-------------LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLS  287
            S  LR+P  + P             ++ + +  T ++DRIARH R+RKKV GT ERPRLS
Sbjct  18   SGNLRIPLPSVPAPSPTPARRAALSVVAKVKVSTPQDDRIARHVRLRKKVSGTTERPRLS  77

Query  288  VFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEK  467
            VFRSNKHLY QVIDDTK  TLA+ STM K++S+E  YS+GPTIEVA+K+GEVIAKSCLEK
Sbjct  78   VFRSNKHLYAQVIDDTKQCTLASASTMHKSLSKELEYSAGPTIEVAQKIGEVIAKSCLEK  137

Query  468  GISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GI+KV FDRGG+ YHGRI+A+ADAARE+GL+F
Sbjct  138  GITKVVFDRGGFLYHGRIKALADAAREHGLEF  169



>ref|XP_003563357.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Brachypodium 
distachyon]
Length=169

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  171  STRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTL  350
            ST  ++ +A+  T + DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  T+
Sbjct  39   STLVVVAKAKVSTPQADRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTV  98

Query  351  AAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAI  530
            A+ STM K++S++  YS+GPT EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+
Sbjct  99   ASASTMHKSLSKDLEYSAGPTTEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKAL  158

Query  531  ADAARENGLQF  563
            ADAARENGL+F
Sbjct  159  ADAARENGLEF  169



>ref|XP_002463594.1| hypothetical protein SORBIDRAFT_01g002610 [Sorghum bicolor]
 gb|EER90592.1| hypothetical protein SORBIDRAFT_01g002610 [Sorghum bicolor]
Length=165

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T ++DRIARH+R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ S
Sbjct  39   VVAKVKVSTPQDDRIARHARLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKQCTLASAS  98

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K +S+E  YS+GPTIE+A+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+AD+A
Sbjct  99   TMHKTLSKELEYSAGPTIEIAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADSA  158

Query  543  RENGLQF  563
            RE+GL+F
Sbjct  159  REHGLEF  165



>ref|XP_006650835.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Oryza 
brachyantha]
Length=172

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ +A+  T + DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TL + S
Sbjct  46   VVAKAKVSTPQADRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLVSAS  105

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S++  YS+GPT+EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAA
Sbjct  106  TMHKSLSKDMEYSAGPTVEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAA  165

Query  543  RENGLQF  563
            RENGL F
Sbjct  166  RENGLDF  172



>ref|NP_001051775.1| Os03g0828100 [Oryza sativa Japonica Group]
 sp|Q8SAY0.1|RK18_ORYSJ RecName: Full=50S ribosomal protein L18, chloroplastic; AltName: 
Full=CL18; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL79739.1|AC096687_3 putative ribosomal protein L18 [Oryza sativa Japonica Group]
 gb|ABF99672.1| 50S ribosomal protein L18, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99673.1| 50S ribosomal protein L18, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13689.1| Os03g0828100 [Oryza sativa Japonica Group]
 dbj|BAG93890.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60226.1| hypothetical protein OsJ_13209 [Oryza sativa Japonica Group]
Length=170

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T + DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TL + S
Sbjct  44   VVAKVKVSTPQADRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLVSAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S++  YS+GPT+EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAA
Sbjct  104  TMHKSLSKDLEYSAGPTVEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAA  163

Query  543  RENGLQF  563
            RENGL F
Sbjct  164  RENGLDF  170



>gb|EAY92422.1| hypothetical protein OsI_14156 [Oryza sativa Indica Group]
Length=170

 Score =   190 bits (482),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T + DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TL + S
Sbjct  44   VVAKVKVSTPQADRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLVSAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S++  YS+GPT+EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAA
Sbjct  104  TMHKSLSKDLEYSAGPTVEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAA  163

Query  543  RENGLQF  563
            RENGL F
Sbjct  164  RENGLDF  170



>gb|ABF99674.1| 50S ribosomal protein L18, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=169

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
            ++ + +  T + DRIARH R+RKKV GT ERPRLSVFRSNKHLY QVIDDTK  TL + S
Sbjct  44   VVAKVKVSTPQADRIARHVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLVSAS  103

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            TM K++S++  YS+GPT EVA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAA
Sbjct  104  TMHKSLSKDLEYSAGPT-EVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAA  162

Query  543  RENGLQF  563
            RENGL F
Sbjct  163  RENGLDF  169



>ref|XP_002982301.1| hypothetical protein SELMODRAFT_116145, partial [Selaginella 
moellendorffii]
 gb|EFJ16546.1| hypothetical protein SELMODRAFT_116145, partial [Selaginella 
moellendorffii]
Length=116

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  216  EDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFN  395
            E+R  +H RIRKK+ GT ERPRL+VFRSN+HLY QVIDDTKMHTLAA+ST+QK + +E N
Sbjct  1    ENRRMKHQRIRKKLSGTTERPRLAVFRSNQHLYCQVIDDTKMHTLAAMSTIQKPLRDELN  60

Query  396  YSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             SSGPTIE A++VGE IAK CL KGI+K+AFDRGG+ YHGRI+A+A+AARE+GL+F
Sbjct  61   LSSGPTIEAAKRVGEEIAKLCLSKGITKIAFDRGGFEYHGRIKALAEAARESGLEF  116



>ref|XP_002966231.1| hypothetical protein SELMODRAFT_143891 [Selaginella moellendorffii]
 gb|EFJ32258.1| hypothetical protein SELMODRAFT_143891 [Selaginella moellendorffii]
Length=112

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            +H RIRKK+ GT ERPRL+VFRSN+HLY QVIDDTKMHTLAA+ST+QK + +E N SSGP
Sbjct  2    KHQRIRKKLSGTTERPRLAVFRSNQHLYCQVIDDTKMHTLAAMSTIQKPLRDELNLSSGP  61

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            TIE A++VGE IAK CL KGI+K+AFDRGG+ YHGRI+A+A+AARE+GL+F
Sbjct  62   TIEAAKRVGEEIAKLCLSKGITKIAFDRGGFEYHGRIKALAEAARESGLEF  112



>ref|XP_001778114.1| predicted protein [Physcomitrella patens]
 gb|EDQ57120.1| predicted protein, partial [Physcomitrella patens]
Length=129

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  183  LIVQA-ESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAV  359
            L ++A + +TRRE   +RH R+RKK+ GT ERPRL+VFR+N+HLY QVIDDTK HTLAA 
Sbjct  2    LTIEALKDQTRRESLKSRHRRLRKKLSGTTERPRLAVFRTNQHLYAQVIDDTKQHTLAAA  61

Query  360  STMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADA  539
            ST+ K I E    ++GPTIE A+KVGE I K CLEKGISKVAFDRGG+ YHGRI+A+ADA
Sbjct  62   STLTKEIRESIEDTAGPTIESAKKVGEAIGKLCLEKGISKVAFDRGGFVYHGRIKALADA  121

Query  540  ARENGLQF  563
            ARE GL F
Sbjct  122  AREAGLDF  129



>gb|EMT20903.1| 50S ribosomal protein L18, chloroplastic [Aegilops tauschii]
Length=143

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  RIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIE  419
            R+ ++V GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ STM KA+S+E  YS+GPT E
Sbjct  36   RMVQRVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLASASTMHKALSKELEYSAGPTTE  95

Query  420  VARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            VA+K+GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAARENGL+F
Sbjct  96   VAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAARENGLEF  143



>gb|EMS49249.1| 50S ribosomal protein L18, chloroplastic [Triticum urartu]
Length=104

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +3

Query  255  VEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKV  434
            V GT ERPRLSVFRSNKHLY QVIDDTK  TLA+ STM KA+S+E  YS+GPT EVA+K+
Sbjct  2    VSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLASASTMHKALSKELEYSAGPTTEVAQKI  61

Query  435  GEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            GEVIAKSCLEKGI+KV FDRGG+ YHGRI+A+ADAARENGL+F
Sbjct  62   GEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAARENGLEF  104



>ref|XP_001767785.1| predicted protein [Physcomitrella patens]
 gb|EDQ67299.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +3

Query  132  LCNVFSFKLRVPTSTRPLIVQA-------ESRTRREDRIARHSRIRKKVEGTPERPRLSV  290
            L    SF+  +P  TR  +++        + +TRRE   +RH R+RKK+ GT ERPRL+V
Sbjct  17   LAAAPSFRPSIPAPTRSTLLRETLKVEALKDQTRRESLKSRHRRLRKKLSGTTERPRLAV  76

Query  291  FRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKG  470
            FR+N+HLY QVIDDTK HTLAA ST  K I +    ++GPTI+ A+KVGE I K CLEKG
Sbjct  77   FRTNQHLYAQVIDDTKQHTLAAASTRTKEIRDTIEDTAGPTIDSAKKVGEAIGKLCLEKG  136

Query  471  ISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            I+KVAFDRGG+ YHGRI+A+ADAARE GL F
Sbjct  137  ITKVAFDRGGFVYHGRIKALADAAREAGLDF  167



>ref|XP_001759681.1| predicted protein [Physcomitrella patens]
 gb|EDQ75593.1| predicted protein [Physcomitrella patens]
Length=132

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  180  PLIVQA-ESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAA  356
            PL ++A + +TRRE   +RH R+RKKV GT ERPRL+VFR+N+ LY QVIDDTK HTLA 
Sbjct  4    PLKIEALKDQTRRESVKSRHRRLRKKVIGTTERPRLAVFRTNQDLYAQVIDDTKQHTLAT  63

Query  357  VSTMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIAD  536
             ST+ K I E    ++GPTIE A+KVGE I + CLE+GI+KVAFDRGG+ YHGRI+A+AD
Sbjct  64   ASTLTKEIREAIEDTAGPTIESAKKVGEAIGRLCLERGITKVAFDRGGFVYHGRIKALAD  123

Query  537  AARENGLQF  563
            AARE GL F
Sbjct  124  AAREAGLNF  132



>ref|WP_042353695.1| 50S ribosomal protein L18 [Bacillus sp. MT2]
Length=120

 Score =   155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDDTK  TLA+ ST+ K    EFN  S  
Sbjct  14   RHARVRAKLSGTSTRPRLNVFRSNKHIYAQLIDDTKGVTLASASTLDK----EFNLESSS  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A+KVGE++AK  +EKGIS V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  70   NIEAAKKVGELVAKRAVEKGISSVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_013074240.1| 50S ribosomal protein L18 [Kyrpidia tusciae]
 gb|ADG04947.1| ribosomal protein L18 [Kyrpidia tusciae DSM 2912]
Length=122

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +3

Query  195  AESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQK  374
            A S +R+E R  RH R+RKKV GTP+RPRL+VFRS +H+Y QVIDDTK HT  A ST+  
Sbjct  2    AASVSRKEARHRRHLRVRKKVFGTPDRPRLNVFRSARHIYAQVIDDTKGHTYVAASTLDP  61

Query  375  AISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENG  554
             +  +  Y  G  +E ARKVGE++AK  LEKGISKV FDRGGY YHGR+ A+ADAARE G
Sbjct  62   ELRGQIGY--GGNVEAARKVGELVAKRALEKGISKVVFDRGGYLYHGRVRALADAAREAG  119

Query  555  LQF  563
            L+F
Sbjct  120  LEF  122



>ref|WP_038538497.1| 50S ribosomal protein L18 [Bacillus sp. X1(2014)]
 gb|AIM16685.1| 50S ribosomal protein L18 [Bacillus sp. X1(2014)]
Length=120

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDDTK  TLA+ ST+ K    E N  
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHIYAQLIDDTKGVTLASASTLDK----ELNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  +EKGI+ V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   SSSNIEAAKKVGELVAKRAVEKGITSVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_011229635.1| MULTISPECIES: 50S ribosomal protein L18 [Geobacillus]
 sp|Q5L3S3.1|RL18_GEOKA RecName: Full=50S ribosomal protein L18 [Geobacillus kaustophilus 
HTA426]
 dbj|BAD74407.1| 50S ribosomal protein L18 [Geobacillus kaustophilus HTA426]
 gb|ACX76823.1| ribosomal protein L18 [Geobacillus sp. Y412MC61]
 gb|ADI25196.1| ribosomal protein L18 [Geobacillus sp. C56-T3]
 gb|AEV17466.1| 50S ribosomal protein L18 [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|AGE20738.1| 50S ribosomal protein L18 [Geobacillus sp. GHH01]
 dbj|GAD13888.1| 50S ribosomal protein L18 [Geobacillus kaustophilus GBlys]
 gb|EPR29211.1| LSU ribosomal protein L18P [Geobacillus sp. WSUCF1]
 gb|EQB95843.1| 50S ribosomal protein L18 [Geobacillus sp. A8]
 gb|ESU73552.1| 50S ribosomal protein L18 [Geobacillus sp. MAS1]
 dbj|GAJ56889.1| 50S ribosomal protein L18 [Geobacillus thermoleovorans B23]
 gb|KDE50573.1| 50S ribosomal protein L18 [Geobacillus sp. CAMR5420]
 gb|KJE26109.1| ribosomal protein L18 [Geobacillus kaustophilus]
Length=120

 Score =   152 bits (385),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDDTK  T+ + ST+ K    EF   
Sbjct  11   RKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQIIDDTKSSTIVSASTLDK----EFGLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_033020984.1| MULTISPECIES: 50S ribosomal protein L18 [Geobacillus]
 gb|KFX32716.1| 50S ribosomal protein L18 [Geobacillus sp. G1w1]
Length=120

 Score =   152 bits (385),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y QVIDDTK  T+ + ST+ K    EF   
Sbjct  11   RKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQVIDDTKSATIVSASTLDK----EFTLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STNNIEAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGRVKALADAARETGLEF  120



>ref|WP_029421864.1| 50S ribosomal protein L18 [Alicyclobacillus macrosporangiidus]
Length=122

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH R+RK++EGTP RPRL+V+RSNKH+Y QVIDD   HTLA+ ST+ K +  E    +G 
Sbjct  14   RHLRVRKRIEGTPARPRLNVYRSNKHIYAQVIDDEHGHTLASASTLDKELRGEV--ENGA  71

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            T+E ARKVGE++AK  LEKG+  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  72   TVEAARKVGELVAKRALEKGVKSVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_013522755.1| 50S ribosomal protein L18 [Geobacillus sp. Y412MC52]
 gb|ADU92639.1| ribosomal protein L18 [Geobacillus sp. Y412MC52]
Length=120

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDDTK  T+ + ST+ K    EF   
Sbjct  11   RKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQIIDDTKSSTIVSASTLDK----EFGLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+AD ARE GL+F
Sbjct  67   STNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADTAREAGLEF  120



>ref|WP_033008681.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillaceae]
 sp|P09415.1|RL18_GEOSE RecName: Full=50S ribosomal protein L18; AltName: Full=BL22 [Geobacillus 
stearothermophilus]
 pdb|1OVY|A Chain A, Solution Structure Of Ribosomal Protein L18 From Bacillus 
Stearothermophilus
 gb|KFL17113.1| 50S ribosomal protein L18 [Geobacillus stearothermophilus]
 gb|KFX32502.1| 50S ribosomal protein L18 [Geobacillus stearothermophilus]
Length=120

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDDTK  T+ + ST+ K    EF   
Sbjct  11   RKKRHARIRKKIFGTTERPRLSVFRSNKHIYAQIIDDTKSATIVSASTLDK----EFGLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STNNIEAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_003247604.1| MULTISPECIES: 50S ribosomal protein L18 [Geobacillus]
 gb|ADP72982.1| ribosomal protein L18 [Geobacillus sp. Y4.1MC1]
 gb|AEH46206.1| ribosomal protein L18 [Geobacillus thermoglucosidasius C56-YS93]
 gb|EID42503.1| 50S ribosomal protein L18 [Geobacillus thermoglucosidans TNO-09.020]
 dbj|GAJ45018.1| 50S ribosomal protein L18 [Geobacillus thermoglucosidasius NBRC 
107763]
 gb|KJX67874.1| 50S ribosomal protein L18 [Geobacillus thermoglucosidasius]
Length=120

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+RKK+ GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+ +S  
Sbjct  14   RHARVRKKIFGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLASTG  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  70   NIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_032101418.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus]
Length=120

 Score =   150 bits (378),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  11   RKKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STSNVEAAQKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  120



>ref|WP_029763937.1| 50S ribosomal protein L18 [Gemmatimonadetes bacterium JGI 0000112-M07]
Length=122

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            +R E R  RH R+RKK+ GTPERPRLSVFRS KH+Y Q+IDDT+  TL + ST+ K ++ 
Sbjct  6    SRNEARKRRHLRVRKKISGTPERPRLSVFRSLKHIYAQLIDDTRGVTLVSASTLDKELAG  65

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   + G  +E ARKVGE+IAK  LEKG +KV FDRGGY YHGRI A+ADAARE GL+F
Sbjct  66   QI--TGGGNVEAARKVGELIAKRALEKGYAKVVFDRGGYLYHGRIRALADAAREAGLEF  122



>ref|WP_017434006.1| 50S ribosomal protein L18 [Geobacillus caldoxylosilyticus]
 dbj|GAJ40368.1| 50S ribosomal protein L18 [Geobacillus caldoxylosilyticus NBRC 
107762]
Length=120

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+RKK+ GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  S  
Sbjct  14   RHARVRKKIFGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLESTG  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  70   NIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_021095331.1| MULTISPECIES: 50S ribosomal protein L18 [Anoxybacillus]
 gb|EPZ37974.1| 50S ribosomal protein L18 [Anoxybacillus sp. SK3-4]
 gb|KHF28898.1| 50S ribosomal protein L18 [Anoxybacillus sp. BCO1]
 gb|KIQ95117.1| hypothetical protein LH47_00806 [Anoxybacillus thermarum]
Length=120

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  11   RKQRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STGNVEAAQKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  120



>ref|WP_041066903.1| 50S ribosomal protein L18 [Cohnella sp. VKM B-2846]
 gb|KIL34482.1| 50S ribosomal protein L18 [Cohnella sp. VKM B-2846]
Length=121

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRLSVFRS+KH+Y Q+IDD K  TLAA ST+ K ++E  N  
Sbjct  11   RLKRHLRVRKKISGTNERPRLSVFRSSKHIYAQLIDDVKGETLAAASTVDKELAELGN--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             G ++E ARKVGE+IAK   EKG   V FDRGGY YHGRI+A+ADAARE GLQF
Sbjct  69   -GGSVESARKVGELIAKRAKEKGYENVVFDRGGYLYHGRIQALADAAREAGLQF  121



>ref|WP_042888370.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus]
Length=120

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  11   RXKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STGNVEAAXKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  120



>ref|WP_004888689.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus]
 gb|ELK20899.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus TNO-09.006]
Length=120

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  11   RKKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDVKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STGNVEAAQKVGELIAKRALEKGITAVVFDRGGYLYHGRVKALADAAREAGLQF  120



>ref|WP_009361496.1| MULTISPECIES: 50S ribosomal protein L18 [Anoxybacillus]
 gb|EMI10921.1| 50S ribosomal protein L18 [Anoxybacillus sp. DT3-1]
 gb|KFZ43446.1| 50S ribosomal protein L18 [Anoxybacillus sp. KU2-6(11)]
 gb|KGP60329.1| 50S ribosomal protein L18 [Anoxybacillus gonensis]
Length=120

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  11   RKKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STGNVEAAQKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  120



>gb|ACJ32505.1| Ribosomal protein L18 [Anoxybacillus flavithermus WK1]
 dbj|GAC91823.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus NBRC 109594]
Length=126

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF+  
Sbjct  17   RKKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----EFDLE  72

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  73   STGNVEAAQKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  126



>ref|WP_020958372.1| 50S ribosomal protein L18 [Geobacillus sp. JF8]
 gb|AGT30408.1| 50S ribosomal protein L18 [Geobacillus sp. JF8]
Length=120

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDDTK  T+ + ST+ K    EF   S  
Sbjct  14   RHARIRKKIVGTTERPRLSVFRSNKHIYAQIIDDTKSTTIVSASTLDK----EFGLDSTN  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             I+ A+KVGE++A+  LEKGI +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  70   NIDAAKKVGELVAQRALEKGIKQVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_012748895.1| 50S ribosomal protein L18 [Geobacillus sp. WCH70]
 sp|C5D3T3.1|RL18_GEOSW RecName: Full=50S ribosomal protein L18 [Geobacillus sp. WCH70]
 gb|ACS23067.1| ribosomal protein L18 [Geobacillus sp. WCH70]
Length=120

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+RKK+ GT ERPRL+VFRSNKH+Y Q+IDD K  T+ + ST+ K    EF+  
Sbjct  11   RKKRHARVRKKIFGTAERPRLNVFRSNKHIYAQIIDDMKAVTIVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_008881929.1| MULTISPECIES: 50S ribosomal protein L18 [Geobacillus]
 sp|A4IJK4.1|RL18_GEOTN RecName: Full=50S ribosomal protein L18 [Geobacillus thermodenitrificans 
NG80-2]
 gb|ABO65508.1| Ribosomal protein L18 [Geobacillus thermodenitrificans NG80-2]
 gb|EDY04257.1| ribosomal protein L18 [Geobacillus sp. G11MC16]
Length=120

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDD K  T+ + ST+ K    EF+  
Sbjct  11   RKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQIIDDVKSATIVSASTLDK----EFSLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   I+ A+KVGE++AK  LEKGI +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STNNIDAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGRVKALADAAREAGLEF  120



>gb|AAA22702.1| ribosomal protein L18 [Geobacillus stearothermophilus]
Length=120

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIRKK+ GT ERPRLSVFRSNKH+Y Q+IDDTK  T+ + ST+ K    EF   
Sbjct  11   RKKRHARIRKKIFGTTERPRLSVFRSNKHIYAQIIDDTKSATIVSASTLDK----EFGLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  LEKGI +V FDRGGY YHGR++A+ADAARE G +F
Sbjct  67   STNNIEAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGRVKALADAAREAGXEF  120



>ref|WP_043903328.1| 50S ribosomal protein L18 [Geobacillus stearothermophilus]
 gb|EZP79125.1| 50S ribosomal protein L18 [Geobacillus stearothermophilus NUB3621]
Length=120

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+RKK+ GT ERPRL+VFRSNKH+Y Q+IDD K  T+ + ST+ K    EF+  S  
Sbjct  14   RHARVRKKIFGTAERPRLNVFRSNKHIYAQIIDDMKAVTIVSASTLDK----EFDLESTG  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A+KVGE++AK  LEKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  70   NIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_003397682.1| MULTISPECIES: 50S ribosomal protein L18 [Anoxybacillus]
 gb|EMT45660.1| 50S ribosomal protein L18 [Anoxybacillus flavithermus AK1]
 gb|KIP20566.1| hypothetical protein JV16_02280 [Anoxybacillus ayderensis]
Length=120

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    +F+  
Sbjct  11   RKKRHARVRRKVVGTAERPRLNVFRSNKHIYAQIIDDMKAVTLVSASTLDK----DFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKGI+ V FDRGGY YHGR++A+ADAARE GLQF
Sbjct  67   STGNVEAAQKVGELIAKRALEKGITSVVFDRGGYLYHGRVKALADAAREAGLQF  120



>ref|WP_027844106.1| 50S ribosomal protein L18 [Mastigocoleus testarum]
Length=120

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TR+E +  RH RIR KV G+PERPRL+VFRSN+H+Y QVIDDTK HTLAA ST++  +  
Sbjct  4    TRQESKQRRHRRIRGKVNGSPERPRLAVFRSNQHIYAQVIDDTKQHTLAAASTVEAEVKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   SSG T   + +VG+++AK   EKGISKV FDRGG  YHGRI+A+ADAARE GL F
Sbjct  64   K--SSSGDTCAASSEVGKLVAKRAQEKGISKVVFDRGGNIYHGRIKALADAAREAGLDF  120



>ref|WP_003354764.1| 50S ribosomal protein L18 [Bacillus smithii]
 gb|EHL76495.1| 50S ribosomal protein L18 [Bacillus smithii 7_3_47FAA]
Length=120

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+V+RSNKH+Y Q+IDDTK  TLA+ ST++K    +F+  
Sbjct  11   RKKRHARVRTKISGTSARPRLNVYRSNKHIYAQLIDDTKGVTLASASTLEK----DFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A KVGE+IAK  +EKGI+ V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STGNVEAAAKVGELIAKKAVEKGITSVVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|WP_026574102.1| 50S ribosomal protein L18 [Bacillus sp. UNC438CL73TsuS30]
Length=120

 Score =   147 bits (372),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K    E N  S  
Sbjct  14   RHARVRAKLSGTSARPRLNVFRSNKHIYAQIIDDMNGVTLASASTLDK----ELNLESSS  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             ++ A+KVGE++AK   EKGIS V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  70   NVDAAQKVGELVAKRAAEKGISNVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_045516522.1| 50S ribosomal protein L18 [Bacillus niacini]
Length=120

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKHLY Q+IDD    TLA+ STM+K    + N  
Sbjct  11   RKKRHARVRAKLSGTAARPRLNVFRSNKHLYAQLIDDMSGVTLASASTMEK----DLNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+ VGE++AK  +EKGI+ V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STSNVEAAKLVGELVAKRAVEKGITAVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_015253304.1| 50S ribosomal protein L18 [Thermobacillus composti]
 gb|AGA56540.1| ribosomal protein L18, bacterial type [Thermobacillus composti 
KWC4]
Length=122

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRLSVFRS+KH+Y Q+IDD K  TLA+ ST+ K + ++    
Sbjct  11   RLKRHLRVRKKINGTAERPRLSVFRSSKHIYAQLIDDEKGITLASASTLDKELRDKIG--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E AR+VGE+IA+   EKG++KV FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVEAARQVGELIARRAKEKGVAKVVFDRGGYLYHGRIQALADAAREGGLEF  122



>ref|WP_044895208.1| 50S ribosomal protein L18 [Bacillus alveayuensis]
Length=120

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y QVIDD K  TL + ST+ K    EF+  
Sbjct  11   RKKRHARVRRKVFGTAERPRLNVFRSNKHIYAQVIDDVKAVTLVSASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  LEKGI  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGNVEAAKKVGELVAKRALEKGIKSVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_019722051.1| 50S ribosomal protein L18 [Bacillus coagulans]
Length=120

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRLS++RSNK++Y Q+IDD K  TLA+ ST+ KA+S E    
Sbjct  11   RKKRHARVRAKLSGTAERPRLSIYRSNKNIYAQLIDDVKGVTLASASTLDKALSLE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  +EKGI +V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRAVEKGIKEVVFDRGGYLYHGRIKALADAARENGLQF  120



>ref|WP_015955692.1| 50S ribosomal protein L18 [Cyanothece sp. PCC 7424]
 sp|B7KI02.1|RL18_CYAP7 RecName: Full=50S ribosomal protein L18 [Cyanothece sp. PCC 7424]
 gb|ACK72099.1| ribosomal protein L18 [Cyanothece sp. PCC 7424]
Length=120

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            RTR E    RHSRIR+KVEGTP RPRL+VFRSN H+Y QVIDD   HTL A ST+ K + 
Sbjct  3    RTRTESVQRRHSRIRRKVEGTPSRPRLAVFRSNNHIYAQVIDDVAQHTLVAASTLDKDLK  62

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             EF  SSG T E +  VG+++A+  L KGI KV FDRGG  YHGRI A+A AARE GL F
Sbjct  63   GEF--SSGATCEASEAVGKLVAQRALAKGIEKVVFDRGGNLYHGRIRALAQAAREAGLDF  120



>ref|WP_020155528.1| 50S ribosomal protein L18 [Caldibacillus debilis]
Length=120

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+RIR K+ GTPERPRL+VFRSN+H+Y Q+IDDTK  TLA+ ST++K    + +  
Sbjct  11   RKKRHARIRAKISGTPERPRLNVFRSNQHIYAQLIDDTKGVTLASASTLEK----DLDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE+IAK  LEKG  KV FDRGGY YHGR++A+A+AARE GL+F
Sbjct  67   STKNIEAAKKVGELIAKRALEKGYKKVVFDRGGYLYHGRVKALAEAAREAGLEF  120



>ref|WP_045670717.1| 50S ribosomal protein L18 [Paenibacillus beijingensis]
 gb|AJY75286.1| 50S ribosomal protein L18 [Paenibacillus beijingensis]
Length=122

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRLS+FRS+KH+Y Q+IDD +  T+A+ ST+ K I+ E   S
Sbjct  11   RLKRHLRVRKKINGTTERPRLSIFRSSKHIYAQLIDDIQGVTIASASTLDKEIAAEI--S  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  IE ARKVGE++AK   EKG   V FDRGGY YHGRI+A+ADAARE GLQF
Sbjct  69   NGGNIESARKVGELVAKRAKEKGFENVVFDRGGYLYHGRIQALADAAREAGLQF  122



>ref|WP_043931552.1| 50S ribosomal protein L18 [Bacillus sp. EB01]
Length=120

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ S+M+K    +F   
Sbjct  11   RKKRHARVRSKLSGTAARPRLNVFRSNKHVYAQLIDDVNGVTLASASSMEK----DFGLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   IE A+KVGE++AK  +EKGI+ V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STNNIEAAQKVGELVAKRAVEKGITSVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_007085274.1| 50S ribosomal protein L18 [Bacillus bataviensis]
 gb|EKN69155.1| 50S ribosomal protein L18 [Bacillus bataviensis LMG 21833]
Length=120

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y QVIDD    TLA+ ST++K    +F   
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHIYAQVIDDMNGVTLASASTIEK----DFGLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  +EKGIS + FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STSNLEAAQKVGELVAKRAVEKGISAIVFDRGGYLYHGRVQALADAARENGLQF  120



>emb|CEG25270.1| 50S ribosomal protein L18 [Bacillus sp. B-jedd]
Length=120

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ STM+K    +F   
Sbjct  11   RKKRHARVRSKLSGTAARPRLNVFRSNKHIYAQLIDDVNGVTLASASTMEK----DFGLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S    E A+KVGE+IAK  +EKGIS V FDRGGY YHGRI+ +ADAARENGLQF
Sbjct  67   SSANKEAAQKVGELIAKRAVEKGISSVVFDRGGYLYHGRIQTLADAARENGLQF  120



>ref|WP_040203257.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
Length=120

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ ST++K    +F   
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHIYAQLIDDMNGVTLASASTIEK----DFGLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  +EKGIS V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STSNLEAAQKVGELVAKRAVEKGISSVVFDRGGYLYHGRVQALADAARENGLQF  120



>ref|WP_015141078.1| 50S ribosomal protein L18 [Nostoc sp. PCC 7524]
 gb|AFY50668.1| ribosomal protein L18, bacterial type [Nostoc sp. PCC 7524]
Length=120

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TR+E +  RH RIR KV+G+PERPRLSVFRSN+H+Y QVIDDT+ HTL A ST++  +  
Sbjct  4    TRKESKQRRHRRIRGKVQGSPERPRLSVFRSNEHIYAQVIDDTQHHTLVAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
              N +SG T E + ++G++IA   LEKGI+KV FDRGG  YHGRI+A+A+AARE GL F
Sbjct  64   --NLASGATCEASAQIGKLIAVRSLEKGITKVVFDRGGNLYHGRIKALAEAAREAGLDF  120



>ref|WP_015591974.1| 50S ribosomal protein L18 [Bacillus sp. 1NLA3E]
 gb|AGK51908.1| 50S ribosomal protein L18 [Bacillus sp. 1NLA3E]
Length=120

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRR+    RH+R+R K+ GTP RPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K    
Sbjct  10   TRRK----RHARVRAKLSGTPARPRLNVFRSNKHIYAQLIDDVNGVTLASASTLDK----  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +F   S   +E A+K+GE++AK  +EKGIS V FDRGGY YHGR++A+ADAARENGL+F
Sbjct  62   DFGLESTGNLEAAQKIGELVAKRAVEKGISSVVFDRGGYLYHGRVQALADAARENGLEF  120



>ref|WP_012676563.1| 50S ribosomal protein L18 [Persephonella marina]
 gb|ACO04325.1| ribosomal protein L18 [Persephonella marina EX-H1]
Length=123

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            +TRRE R+ RH RIRKKV GT ERPR++ F+S  +LYVQ+IDD   HTL + ST+ K   
Sbjct  4    KTRREKRLIRHKRIRKKVFGTAERPRMAFFKSLNNLYVQIIDDEAGHTLVSASTIDKDFV  63

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E++    G  IE+A+K+GE IA+  L KGI  V FDRGG+ YHG+++A ADAARE GL+F
Sbjct  64   EKYGVRGGKNIEMAKKLGEFIAEKALAKGIQNVVFDRGGFIYHGKVKAFADAAREKGLKF  123



>ref|WP_026565537.1| 50S ribosomal protein L18 [Bacillus sp. UNC41MFS5]
Length=120

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y QVIDD    TLA+ ST+ K    +F   
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHIYAQVIDDINGVTLASASTLDK----DFGLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  ++KGIS + FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STNNVEAAQKVGELVAKRAVDKGISSIVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_027091984.1| 50S ribosomal protein L18 [Cohnella thermotolerans]
Length=122

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRLSVFRS+KH+Y Q+IDD K  TLA+ ST+ K ++ +    
Sbjct  11   RLKRHLRVRKKINGTNERPRLSVFRSSKHIYAQLIDDVKGVTLASASTLDKELAPQI--G  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   +KG  KV FDRGGY YHGRI+A+ADAARE GLQF
Sbjct  69   NGGNVESARKVGELIAKRAKDKGYEKVVFDRGGYLYHGRIQALADAAREAGLQF  122



>ref|WP_042453984.1| 50S ribosomal protein L18 [Bacillus sp. FF4]
Length=120

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ ST++K +  E    S  
Sbjct  14   RHARVRAKLSGTSARPRLNVFRSNKHIYAQIIDDMNGVTLASASTIEKDLGLE----STS  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A+KVGE++AK  +EKGIS V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  70   NIEAAQKVGELVAKRAVEKGISAVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_027410249.1| 50S ribosomal protein L18 [Anoxybacillus tepidamans]
Length=120

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+KV GT ERPRL+VFRSNKH+Y Q+IDD K  TL + ST+ K    EF   
Sbjct  11   RKKRHARVRRKVFGTAERPRLNVFRSNKHIYAQIIDDVKAVTLVSASTLDK----EFGLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  LEKGI  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGNVEAAQKVGELVAKRALEKGIKSVVFDRGGYLYHGRVKALADAAREAGLEF  120



>dbj|BAK26451.1| 50S ribosomal protein L18 [Bacillus novalis]
Length=120

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 8/119 (7%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRR+    RH+R+R K+ GT  RPRL+VFRSNKH+Y QVIDD    TLA+ ST+ K    
Sbjct  10   TRRK----RHARVRAKLSGTSARPRLNVFRSNKHIYAQVIDDMSGVTLASASTLDK----  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            EF   S   +E A+ VGE++AK  +EKGIS V FDRGGY YHGR++ +ADAARENGLQF
Sbjct  62   EFTLDSSNNVEAAKAVGELVAKRAVEKGISSVVFDRGGYLYHGRVQVLADAARENGLQF  120



>ref|XP_005850443.1| hypothetical protein CHLNCDRAFT_142390 [Chlorella variabilis]
 gb|EFN58341.1| hypothetical protein CHLNCDRAFT_142390 [Chlorella variabilis]
Length=157

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +3

Query  183  LIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVS  362
              V+A   TRRE    RH RIR KVEGT ERPRL+VFRSN H+Y QVIDD+  +TLAA S
Sbjct  32   FCVEARVLTRRESVDKRHKRIRSKVEGTTERPRLAVFRSNNHIYAQVIDDSAGNTLAATS  91

Query  363  TMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAA  542
            T+   I ++ N  +G  +E A+ VG  IA+ C +K I KV FDRGG+ YHGR+EA+ADAA
Sbjct  92   TLNPEIRQQLN-GAGANVEAAKLVGAKIAELCKQKNIEKVCFDRGGFRYHGRVEALADAA  150

Query  543  RENGLQF  563
            RE GL F
Sbjct  151  REAGLSF  157



>ref|WP_018888237.1| MULTISPECIES: 50S ribosomal protein L18 [Paenibacillus]
Length=122

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK++GT +RPRL+VFRS KH+Y Q+IDD    TLAA STM K +S++   +
Sbjct  11   RVRRHLRVRKKIQGTAQRPRLNVFRSEKHIYAQLIDDVAGVTLAAASTMDKELSKDI--A  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E ARKVGE++AK   EKG++ V FDRGGY YHGRI+A+A+AARE GL+F
Sbjct  69   NGASVESARKVGELVAKRGKEKGVTAVVFDRGGYLYHGRIQALAEAARETGLEF  122



>ref|WP_034676115.1| 50S ribosomal protein L18 [Bacillus niacini]
 dbj|BAK26443.1| 50S ribosomal protein L18 [Bacillus niacini]
 gb|KGM45193.1| 50S ribosomal protein L18 [Bacillus niacini]
Length=120

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKHLY Q+IDD    TLA+ ST++K    + N  
Sbjct  11   RKKRHARVRAKLSGTAARPRLNVFRSNKHLYAQLIDDMSGVTLASASTIEK----DLNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+ VGE++AK  +EKGI+ V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STSNVEAAKLVGELVAKRAVEKGITAVVFDRGGYLYHGRIQALADAARENGLQF  120



>ref|WP_011994282.1| 50S ribosomal protein L18 [Fervidobacterium nodosum]
 sp|A7HM36.1|RL18_FERNB RecName: Full=50S ribosomal protein L18 [Fervidobacterium nodosum 
Rt17-B1]
 gb|ABS60969.1| ribosomal protein L18 [Fervidobacterium nodosum Rt17-B1]
Length=122

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            RR+ R+ RH R+RKK+ GTPERPRL+VFRS KH+Y Q+IDDTK  TL A ST++KA+ E+
Sbjct  7    RRQLRLVRHKRLRKKIFGTPERPRLAVFRSEKHMYAQIIDDTKGITLVAASTVEKAMKEK  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
               +    I  A++VG++IA+  L KGI +V FDRGG+ YHGR++A+ADAARE GL+F
Sbjct  67   LQKTW--NITAAKEVGKLIAERALAKGIKEVVFDRGGFKYHGRVKALADAAREAGLKF  122



>ref|WP_044482509.1| 50S ribosomal protein L18 [Paenibacillus sp. GD11]
Length=125

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK++GT ERPRL+V+RS+KH+Y Q+IDD    TL + ST+ K IS E N  
Sbjct  14   RLKRHLRVRKKIQGTAERPRLNVYRSSKHIYAQLIDDVAGVTLVSASTVDKEISSEIN--  71

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE++AK   EKG+  V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  72   NGGNVESARKVGELVAKRATEKGVKVVVFDRGGYLYHGRIQALADAAREAGLEF  125



>ref|WP_034767053.1| 50S ribosomal protein L18 [Bacillus thermoamylovorans]
 emb|CEE00006.1| ribosomal protein L18 [Bacillus thermoamylovorans]
 gb|KIO61350.1| hypothetical protein B4064_0063 [Bacillus thermoamylovorans]
 gb|KIO64572.1| hypothetical protein B4166_0126 [Bacillus thermoamylovorans]
 gb|KIO69805.1| hypothetical protein B4065_0048 [Bacillus thermoamylovorans]
 gb|KIO70652.1| hypothetical protein B4167_0096 [Bacillus thermoamylovorans]
Length=120

 Score =   144 bits (364),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+RIR K+ GTPERPRL+VFRSNKH+Y Q+IDDTK  T+A+ ST+ K    E N  S  
Sbjct  14   RHTRIRAKISGTPERPRLTVFRSNKHIYAQLIDDTKGVTVASASTLDK----EINLESTS  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE A KVGE++AK  LEKG   V FDR GY YHGRI+A+AD+ARE GL+F
Sbjct  70   NIEAAAKVGELVAKRALEKGYKSVVFDRSGYLYHGRIQALADSARETGLEF  120



>ref|WP_024027893.1| 50S ribosomal protein L18 [Bacillus vireti]
 gb|ETI69245.1| 50S ribosomal protein L18 [Bacillus vireti LMG 21834]
Length=120

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y QVIDD    TLA+ ST+ K    EF   
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHIYAQVIDDMSGVTLASASTLDK----EFTLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+ VGE++AK  +EKGI+ V FDRGGY YHGR++ +ADAARENGLQF
Sbjct  67   SSSNVEAAKAVGELVAKRAVEKGITSVVFDRGGYLYHGRVQVLADAARENGLQF  120



>ref|WP_002479557.1| 50S ribosomal protein L18 [Staphylococcus simulans]
 gb|EKS32226.1| 50S ribosomal protein L18 [Staphylococcus simulans ACS-120-V-Sch1]
 gb|ERS94168.1| 50S ribosomal protein L18 [Staphylococcus simulans UMC-CNS-990]
Length=120

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R  + GT E+PRL+V+RSNKH+Y Q+IDDTK  TLA  ST  K    +F   
Sbjct  11   RLKRHARVRTNLTGTSEKPRLNVYRSNKHIYAQIIDDTKGVTLAQASTQDK----DFENE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E++ KVGEVIAK  ++KGI+ + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   TGSKVELSAKVGEVIAKKAVDKGITAIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_019006404.1| 50S ribosomal protein L18 [Cohnella laeviribosi]
Length=122

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRLSVFRS+KH+Y Q+IDD K  TLA+ ST+ K ++ +    
Sbjct  11   RLKRHLRVRKKISGTAERPRLSVFRSSKHIYAQLIDDVKGVTLASASTLDKELASQIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E A KVGE+IAK   EKG  +V FDRGGY YHGRI+A+ADAARE GLQF
Sbjct  69   NGGNVESAAKVGELIAKRAKEKGYERVVFDRGGYLYHGRIQALADAAREAGLQF  122



>ref|WP_044880312.1| 50S ribosomal protein L18 [Paenibacillus sp. IHBB 10380]
 gb|AJS61645.1| 50S ribosomal protein L18 [Paenibacillus sp. IHBB 10380]
Length=122

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GT ERPRL+VFRS+KH+Y Q+IDD    T+ + ST+ K +SEE   S
Sbjct  11   RVRRHLRVRKKITGTVERPRLNVFRSSKHIYAQLIDDVTGVTIVSASTVDKGLSEEI--S  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   +KG++ V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGNVESARKVGELIAKRAKDKGVASVVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_027322642.1| 50S ribosomal protein L18 [Bacillus sp. URHB0009]
Length=120

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    T+A+ ST+ K    EF+  
Sbjct  11   RKKRHARVRAKLSGTSARPRLNVFRSNKHVYAQLIDDINGVTIASASTLDK----EFDLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  +EKG+S + FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STSNLEAAQKVGELVAKRAVEKGVSAIVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|WP_021252447.1| MULTISPECIES: 50S ribosomal protein L18 [Paenibacillus]
 gb|EPY14556.1| 50S ribosomal protein L18 [Paenibacillus alvei A6-6i-x]
Length=122

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT ERPRL+VFRS+KH+Y Q+IDD K  T+A+ STM K + E+    
Sbjct  11   RLKRHLRVRKKIEGTTERPRLNVFRSSKHIYAQLIDDVKGVTVASASTMDKELREDI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   E+G   + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGNVESARKVGELIAKRAKEQGYETIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_037589017.1| 50S ribosomal protein L18 [Staphylococcus aureus]
 gb|EZX22718.1| 50S ribosomal protein L18 [Staphylococcus aureus C0673]
Length=120

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+V+RSNKH+Y QVIDD    T+A  ST+ K    EFN  
Sbjct  11   RLKRHARVRAKLAGTSEKPRLNVYRSNKHIYAQVIDDLNGVTIAQASTVDK----EFNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +E A KVGE++AK   EKG+  V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   QSGNVEAAAKVGEIVAKRAAEKGVDAVVFDRGGYLYHGRIKALADAARENGLQF  120



>ref|WP_023153268.1| 50S ribosomal protein L18 [Eubacterium brachy]
 gb|ESE29753.1| ribosomal protein L18 [Eubacterium brachy ATCC 33089]
Length=119

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TR   R+ARH R+RK V GTPERPRL VFRSNK+++ QV+DD    TLAA ST++K    
Sbjct  5    TRANRRVARHERVRKDVHGTPERPRLCVFRSNKNIFAQVVDDVNGVTLAAASTLEK----  60

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E   ++G   E A+K+GEV+AK  LEKGI  VAFDRGG+ YHGR++ +AD ARE GL+F
Sbjct  61   ELEIANGGNKEAAKKIGEVVAKRALEKGIETVAFDRGGFLYHGRVKELADGAREAGLRF  119



>ref|WP_003178358.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 sp|Q65P91.1|RL18_BACLD RecName: Full=50S ribosomal protein L18 [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|AAU39123.1| 50S ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 
14580]
 gb|AAU21778.2| ribosomal protein L18 [Bacillus licheniformis DSM 13 = ATCC 14580]
 gb|EFV69619.1| 50S ribosomal protein L18 [Bacillus sp. BT1B_CT2]
 gb|EID49339.1| 50S ribosomal protein L18 [Bacillus licheniformis WX-02]
 gb|EQM27115.1| 50S ribosomal protein L18 [Bacillus licheniformis CG-B52]
 gb|KJE31794.1| ribosomal protein L18 [Bacillus licheniformis]
 gb|KJH63020.1| 50S ribosomal protein L18 [Bacillus licheniformis]
Length=120

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GTPERPRL+VFRSNKH+Y QVIDD    TL + ST+ K    +FN  
Sbjct  11   RLKRHARVRAKLSGTPERPRLNVFRSNKHIYAQVIDDVNGVTLVSASTLDK----DFNAE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G     A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   NGSDTAAAAKVGELVAKRASEKGITNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_028543524.1| 50S ribosomal protein L18 [Paenibacillus taiwanensis]
Length=122

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD K  T+AA STM K ++     S
Sbjct  11   RLKRHLRVRKKIEGTTARPRLNVFRSSKHIYAQLIDDVKGVTIAAASTMDKEVAASI--S  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE++AK   + G+++V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGNVESARKVGELVAKRAKDAGVTEVVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_026586058.1| 50S ribosomal protein L18 [Bacillus sp. NSP9.1]
Length=120

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GTPERPRL+VFRSNKH+Y QVIDD    TL + ST+ K    +FN  
Sbjct  11   RLKRHARVRSKLSGTPERPRLNVFRSNKHIYAQVIDDVNGVTLVSASTLDK----DFNAE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G     A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   NGGDTSAAAKVGELVAKRASEKGITNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_031503223.1| 50S ribosomal protein L18 [Thermotoga hypogea]
Length=122

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +3

Query  186  IVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVST  365
            +++ E R  +  RI RH RIRKKV+GTPE+PRL+VFRS KH+Y Q+IDDTK HTL + ST
Sbjct  1    MIKKEDRNLK--RIKRHLRIRKKVKGTPEKPRLAVFRSEKHIYAQIIDDTKGHTLVSAST  58

Query  366  MQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAAR  545
            + K + +    S     E AR+VG++IA+  L  GI  V FDRGG+ YHGRI+A+ADAAR
Sbjct  59   LDKELRQRL--SKTYNTEAAREVGKLIAQRALSLGIKTVVFDRGGFKYHGRIKALADAAR  116

Query  546  ENGLQF  563
            E GLQF
Sbjct  117  EAGLQF  122



>ref|WP_015921933.1| 50S ribosomal protein L18 [Thermomicrobium roseum]
 sp|B9KZX2.1|RL18_THERP RecName: Full=50S ribosomal protein L18 [Thermomicrobium roseum 
DSM 5159]
 gb|ACM06061.1| ribosomal protein L18 [Thermomicrobium roseum DSM 5159]
Length=124

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH R+R KV GTPERPRL+VFRSNKH+Y Q+IDDT+ HTL A ST++K + E F     P
Sbjct  15   RHLRVRAKVFGTPERPRLNVFRSNKHIYAQIIDDTRGHTLVAASTLEKEVRERFP-DPHP  73

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             IE AR VG+V+ +  L KGI++V FDRGGY YHGR++A+AD AR  GLQF
Sbjct  74   KIEEARIVGQVVGERALAKGITRVVFDRGGYKYHGRVKALADGARAAGLQF  124



>ref|WP_021974839.1| 50S ribosomal protein L18 [Firmicutes bacterium CAG:884]
 emb|CCY94558.1| 50S ribosomal protein L18 [Firmicutes bacterium CAG:884]
Length=120

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            +R E RIARH RIR+ V+GT E PRL+VFRSNK+++ Q+IDD    TL + S++ K    
Sbjct  6    SRNEKRIARHVRIRESVKGTSEVPRLNVFRSNKNIFAQIIDDEANKTLVSASSIDK----  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E N  +G  IE A KVGE+IAK   +  ISKV FDRGGY YHGR+EA+ADAARENGL+F
Sbjct  62   ELNLENGGNIEAATKVGELIAKRAKKAKISKVVFDRGGYQYHGRVEALADAARENGLEF  120



>ref|WP_020449866.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 gb|AGN34578.1| ribosomal protein L18 [Bacillus licheniformis 9945A]
 gb|ETB72006.1| 50S ribosomal protein L18 [Bacillus sp. CPSM8]
 gb|KFM94043.1| ribosomal protein L18 [Bacillus licheniformis]
 gb|AJO16268.1| 50S ribosomal protein L18 [Bacillus licheniformis]
 gb|KJD52629.1| 50S ribosomal protein L18 [Bacillus amyloliquefaciens]
Length=120

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+R K+ GTPERPRL+VFRSNKH+Y QVIDD    TL + ST+ K    +FN  
Sbjct  11   RLKRHGRVRAKLSGTPERPRLNVFRSNKHIYAQVIDDVNGVTLVSASTLDK----DFNAE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G     A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   NGSDTSAAAKVGELVAKRASEKGITNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_029141995.1| 50S ribosomal protein L18 [Bacillus coagulans]
 gb|AJH79008.1| ribosomal protein L18 [Bacillus coagulans DSM 1 = ATCC 7050]
Length=120

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+++RSNK++Y Q+IDD K  TLA+ ST+ K +S E    
Sbjct  11   RKKRHARVRAKLSGTAERPRLNIYRSNKNIYAQLIDDVKGVTLASASTLDKELSLE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  +EKGI +V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRAVEKGIKEVVFDRGGYLYHGRIKALADAARENGLQF  120



>ref|WP_010998338.1| 50S ribosomal protein L18 [Nostoc sp. PCC 7120]
 sp|Q8YPJ4.1|RL18_NOSS1 RecName: Full=50S ribosomal protein L18 [Nostoc sp. PCC 7120]
 dbj|BAB75899.1| 50S ribosomal protein L18 [Nostoc sp. PCC 7120]
Length=120

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH R+R KV+G+PERPRL+VFRSN+H+Y QVIDDT+ HTLAA ST++  +  
Sbjct  4    TRRESKERRHRRVRGKVQGSPERPRLAVFRSNEHIYAQVIDDTQHHTLAAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +SG   E + ++G++IA   LEKGI+KV FDRGG  YHGRI+A+A+AARE GL F
Sbjct  64   SL--ASGSNCEASAQIGKLIAARSLEKGITKVVFDRGGNLYHGRIKALAEAAREAGLDF  120



>ref|WP_004034754.1| 50S ribosomal protein L18 [Clostridium sp. ASF356]
 gb|EMZ14640.1| ribosomal protein L18 [Clostridium sp. ASF356]
Length=122

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            +R   R+ RH RIR KV GT ++PRL+VFRSNKH+Y Q+IDD   +TL A STM+  I+ 
Sbjct  6    SRVAARVKRHYRIRNKVNGTAQQPRLAVFRSNKHIYAQIIDDVAQNTLCAASTMEADIAS  65

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +  ++S  T+E A+ VGE IAK  ++KGI +V FDRGG+ YHG+I+A+ADAARE GLQF
Sbjct  66   KVEHTS--TVEAAKVVGEAIAKKAMDKGIKEVVFDRGGFVYHGKIQALADAAREAGLQF  122



>ref|WP_017554011.1| 50S ribosomal protein L18 [Bacillus coagulans]
Length=120

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+++RSNK++Y Q+IDD    TLA+ ST+ KA+S E    
Sbjct  11   RKKRHARVRAKLSGTAERPRLNIYRSNKNIYAQLIDDVNGVTLASASTLDKALSLE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  +EKGI +V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRAVEKGIKEVVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|WP_040953109.1| 50S ribosomal protein L18 [Paenibacillaceae bacterium G5]
Length=121

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRLS++RS+KH+Y Q+IDD++  TLAA ST  K ++E  N  
Sbjct  11   RLKRHLRVRKKIEGTAARPRLSIYRSSKHMYAQIIDDSQGVTLAAASTQDKELTEAGN--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             G  ++ A+ VGE+IAK   EKGI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   -GGNMDAAKLVGELIAKRAKEKGIEKVVFDRGGYLYHGRVQALADAAREAGLEF  121



>ref|WP_044744049.1| 50S ribosomal protein L18 [Anoxybacillus sp. ATCC BAA-2555]
Length=120

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R+K+ GT ERPRL+VFRSNKH+Y Q+IDD K  T+ + ST+ K    EFN  
Sbjct  11   RKKRHARVRRKLFGTAERPRLNVFRSNKHIYAQIIDDVKAVTIVSASTLDK----EFNLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   ++ A+KVGE++AK  LEKGI  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   ATGNVDAAQKVGELVAKRALEKGIKSVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_026964688.1| 50S ribosomal protein L18 [Alicyclobacillus pomorum]
Length=122

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            R E R  RH R+RK+V G+ ERPRL+V+RSNKH+Y QVIDD    TL + ST+ K + + 
Sbjct  7    RNEARKRRHLRVRKRVRGSAERPRLNVYRSNKHIYAQVIDDVNGTTLVSASTLDKELRDV  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +G  IE ARKVGE++AK  L KG+S V FDRGGY YHGR+ A+ADAARE GLQF
Sbjct  67   I--ENGSNIEAARKVGELVAKRALSKGLSSVVFDRGGYLYHGRVRALADAAREAGLQF  122



>ref|WP_041076694.1| 50S ribosomal protein L18 [Thermotoga caldifontis]
Length=122

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +3

Query  210  RREDR----IARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKA  377
            +REDR    I RH RIRKK++GTPERPRL+VFRS KH+Y Q+IDDTK HTL A ST+ K 
Sbjct  3    KREDRNLKRIRRHLRIRKKIKGTPERPRLAVFRSEKHIYAQIIDDTKGHTLVAASTLDKE  62

Query  378  ISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGL  557
            +  +   +    +E A++VG +IA+  L  GI KV FDRGG+ YHGRI+A+ADAARE GL
Sbjct  63   LRGKLVKTY--NVEAAKEVGRLIAQRALSLGIKKVVFDRGGFKYHGRIKALADAAREAGL  120

Query  558  QF  563
            +F
Sbjct  121  EF  122



>ref|WP_021259844.1| MULTISPECIES: 50S ribosomal protein L18 [Paenibacillus]
 gb|EPY06962.1| 50S ribosomal protein L18 [Paenibacillus alvei TS-15]
 gb|KJB87570.1| 50S ribosomal protein L18 [Paenibacillus sp. E194]
Length=122

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT ERPRL+VFRS+KH+Y Q+IDD K  T+A+ STM K + E+    
Sbjct  11   RLKRHLRVRKKIEGTTERPRLNVFRSSKHIYAQLIDDVKGVTVASASTMDKELREDI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   E+G   + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGNVESARKVGELIAKRAKEQGYEVIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_045870360.1| 50S ribosomal protein L18 [Tolypothrix sp. PCC 7601]
 gb|EKF02224.1| ribosomal protein L18 [Tolypothrix sp. PCC 7601]
Length=120

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH RIR KV+G+PERPRL++FRSN+H+Y QVIDDT+ HTL + ST++  +  
Sbjct  4    TRRESKTRRHRRIRGKVQGSPERPRLAIFRSNEHIYAQVIDDTQHHTLVSASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +SG   + + +VG++IA   LEKGI+KV FDRGG  YHGRI+A+ADAARE GL F
Sbjct  64   SL--ASGANRDASAQVGKLIAARSLEKGITKVVFDRGGNLYHGRIQALADAAREAGLDF  120



>ref|WP_042739076.1| 50S ribosomal protein L18 [Staphylococcus gallinarum]
 gb|KIR11406.1| 50S ribosomal protein L18 [Staphylococcus gallinarum]
Length=120

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+++RSNKH+Y QVIDD    TLA  ST +K    +F   
Sbjct  11   RLKRHARVRNKLSGTAEKPRLNIYRSNKHIYAQVIDDVNGQTLAQASTQEK----DFANE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  +E++ KVGE +AK  +EKG+  + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   SGSKVELSAKVGETVAKRAIEKGVKTIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_010348806.1| 50S ribosomal protein L18 [Paenibacillus peoriae]
Length=122

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD    TL + STM K +S E    
Sbjct  11   RVRRHLRVRKKIEGTAVRPRLNVFRSSKHIYAQLIDDVAGVTLVSASTMDKELSSEIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG ++E ARKVGE++AK   EKG + + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   SGGSVEAARKVGELVAKRAKEKGHANIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_041048877.1| 50S ribosomal protein L18 [Paenibacillus sp. VKM B-2647]
 gb|KIL39752.1| 50S ribosomal protein L18 [Paenibacillus sp. VKM B-2647]
Length=122

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+ GTPERPRL++FRS+KH+Y Q+IDDT   TLA+ ST  K +  +    
Sbjct  11   RLKRHLRVRKKIAGTPERPRLNIFRSSKHMYAQIIDDTTGVTLASASTQDKELKGQVE--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  +E A+KVGE+IA+    KG+ KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   SGGNVEAAKKVGELIAQRAKAKGLDKVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_015200867.1| 50S ribosomal protein L18 [Calothrix parietina]
 gb|AFZ04258.1| LSU ribosomal protein L18P [Calothrix sp. PCC 6303]
Length=120

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE ++ RH R+R KV+G+ ERPRL+VFRSN+H+Y QVIDDT+  TLAA ST++K +  
Sbjct  4    TRRESKVRRHKRVRGKVDGSAERPRLAVFRSNEHIYAQVIDDTQHCTLAAASTLEKDLKT  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   SSG   E + +VG++IA   L  GI+KV FDRGG  YHGRI+A+ADAARE GL+F
Sbjct  64   KL--SSGANCEASTEVGKLIAARSLAAGITKVVFDRGGNLYHGRIKALADAAREAGLEF  120



>ref|WP_026974621.1| 50S ribosomal protein L18 [Alicyclobacillus contaminans]
Length=122

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            R E R  RH R+RK+V G  +RPRL+V+RSNKH+Y QVIDD    TL + ST+ K + + 
Sbjct  7    RNEARKRRHLRVRKRVSGNADRPRLNVYRSNKHIYAQVIDDVSGTTLVSASTLDKELRDA  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
               S+G  +E ARKVGE++AK  LEKG+  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   V--SNGGNVEAARKVGELVAKRALEKGLKSVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_025906785.1| 50S ribosomal protein L18 [Staphylococcus sciuri]
Length=120

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+V+RSNKH+Y QVIDD    T+A  S++ K    EFN  
Sbjct  11   RLKRHARVRAKLAGTSEKPRLNVYRSNKHIYAQVIDDLNGVTIAQASSVDK----EFNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +E A KVGE++AK   EKG+  V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   QSGNVEAAAKVGEIVAKRAAEKGVDAVVFDRGGYLYHGRIKALADAARENGLQF  120



>ref|WP_006196729.1| 50S ribosomal protein L18 [Nodularia spumigena]
 gb|EAW45072.1| Ribosomal protein L18 [Nodularia spumigena CCY9414]
 gb|AHJ30665.1| LSU ribosomal protein L18p (L5e) [Nodularia spumigena CCY9414]
Length=120

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH R+R KV+GT ERPRL+VFRSN+H+Y QVIDDT+ HTL A ST++  +  
Sbjct  4    TRRESKQRRHRRVRGKVQGTRERPRLAVFRSNEHIYAQVIDDTQHHTLVAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
              N ++G T + + +VG++IA   LEKGI+KV FDRGG  YHGR++A+ADAARE GL F
Sbjct  64   --NLATGATCDASAQVGKLIAVRLLEKGITKVVFDRGGNLYHGRVKALADAAREAGLDF  120



>ref|WP_044907729.1| 50S ribosomal protein L18 [Lachnospiraceae bacterium MC2017]
Length=122

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            ++R E R  +H +IR +  GTPERPRL+VFRSNKH+Y QVIDD   +TL A ST++K ++
Sbjct  5    KSRSEVREKKHMKIRNRFSGTPERPRLAVFRSNKHMYAQVIDDVAGNTLVAASTLEKEVA  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             E  Y+    +E A+K+GEVIAK  LEKGI +V FDRGG+ Y G+++A+A+AARE GL F
Sbjct  65   SELKYTD--NVEAAQKLGEVIAKRALEKGIKEVVFDRGGFIYQGKVKALAEAAREAGLDF  122



>ref|WP_015113416.1| 50S ribosomal protein L18 [Nostoc sp. PCC 7107]
 gb|AFY43202.1| LSU ribosomal protein L18P [Nostoc sp. PCC 7107]
Length=120

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH R+R KV G+PERPRL+VFRSN+H+Y QVIDDT+  TL A ST+   I  
Sbjct  4    TRRESKQRRHRRVRGKVNGSPERPRLAVFRSNEHIYAQVIDDTQHQTLVAASTLDTEI--  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            + N +SG   E + KVG++IA   LEKGI+KV FDRGG  YHGRI+ +A+AARE GL F
Sbjct  62   KANLASGANCEASAKVGKLIAARALEKGINKVVFDRGGNLYHGRIKTLAEAAREAGLDF  120



>ref|WP_025729806.1| 50S ribosomal protein L18 [Bacillus ginsengihumi]
 gb|KHD85723.1| 50S ribosomal protein L18 [Bacillus ginsengihumi]
Length=120

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GTP RPRL+V+RSNK++Y Q+IDD    TL + ST+ K    E N  
Sbjct  11   RKKRHARVRAKLSGTPTRPRLNVYRSNKNIYAQLIDDVNGVTLVSASTVDK----ELNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK   EKG+S+V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRATEKGLSEVVFDRGGYLYHGRIKALADAARENGLQF  120



>ref|WP_040285496.1| 50S ribosomal protein L18 [Sporosarcina koreensis]
Length=120

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+V+RSNKH+Y Q+IDD    TLA+ STM K    EF+  
Sbjct  11   RKKRHARVRTKINGTAERPRLNVYRSNKHIYAQLIDDANGVTLASASTMDK----EFSAD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S    + A KVGE+IAK  LEK +  V FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   SSSNADAASKVGELIAKKGLEKNLKAVVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_044920980.1| 50S ribosomal protein L18 [Lachnospiraceae bacterium MA2020]
Length=122

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            ++R E R  +H +IR +  GTPERPRLSVFRSNKH+Y Q+IDD   +TL A ST++KA+S
Sbjct  5    KSRSEVREKKHLKIRNRFSGTPERPRLSVFRSNKHMYAQIIDDVAGNTLVAASTVEKAVS  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             E  Y+    +E A+ +G VI K  +EKGI++V FDRGG+ Y G+I+A+ADAARE GL+F
Sbjct  65   SELKYTD--NVEAAKYLGSVIGKRAVEKGITEVVFDRGGFIYQGKIQALADAAREAGLKF  122



>ref|WP_024095377.1| 50S ribosomal protein L18 [Paenibacillus larvae]
 gb|ETK28819.1| 50S ribosomal protein L18 [Paenibacillus larvae subsp. larvae 
DSM 25719]
 gb|AHD07524.1| 50S ribosomal protein L18 [Paenibacillus larvae subsp. larvae 
DSM 25430]
Length=122

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK++GT ERPRL+V+RS+KH+Y Q+IDD K  TL + ST+ K +  E    
Sbjct  11   RLKRHLRVRKKIQGTSERPRLNVYRSSKHMYAQIIDDVKGVTLVSASTLDKDLKGEV--E  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   E G++ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   NGGNVEAARKVGELIAKRAKENGLTNVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_043925511.1| 50S ribosomal protein L18 [Bacillus licheniformis]
 gb|EWH23390.1| 50S ribosomal protein L18 [Bacillus licheniformis S 16]
Length=120

 Score =   142 bits (357),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GTPERPRL+VFRSNK++Y QVIDD    TL + ST+ K    +FN  
Sbjct  11   RLKRHARVRAKLSGTPERPRLNVFRSNKNIYAQVIDDVNGVTLVSASTLDK----DFNAE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G     A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   NGSDTSAAAKVGELVAKRASEKGITNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_009382772.1| 50S ribosomal protein L18 [Staphylococcus massiliensis]
 gb|EKU48914.1| 50S ribosomal protein L18 [Staphylococcus massiliensis S46]
Length=120

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+V+RSNKH+Y Q+IDD K  TL   ST  K ++ E    
Sbjct  11   RLKRHARVRSKLNGTAEKPRLNVYRSNKHIYAQIIDDIKGVTLVQASTQDKDVASE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E+A KVGE++AK   EK I++V FDRGGY YHGR+EA+A+AARENGLQF
Sbjct  67   SATKVELASKVGEMVAKKATEKNITEVVFDRGGYLYHGRVEALANAARENGLQF  120



>ref|WP_013858094.1| 50S ribosomal protein L18 [Bacillus coagulans]
 gb|AEH52193.1| ribosomal protein L18 [Bacillus coagulans 2-6]
 gb|KGT38883.1| 50S ribosomal protein L18 [Bacillus coagulans P38]
Length=120

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+++RSNK++Y Q+IDD    TLA+ ST+ K +S E    
Sbjct  11   RKKRHARVRAKLSGTAERPRLNIYRSNKNIYAQLIDDVNGVTLASASTLDKELSLE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  +EKGI +V FDRGGY YHGRI+A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRAVEKGIKEVVFDRGGYLYHGRIKALADAARENGLQF  120



>gb|AEJ44910.1| ribosomal protein L18 [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius Tc-4-1]
Length=122

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R  RH R+R KV GTPERPRL+VFRSNKH+Y Q+IDDT  HT+AA S+++K    
Sbjct  9    NRNETRKRRHVRVRAKVFGTPERPRLNVFRSNKHIYAQLIDDTIGHTIAAASSLEKGFE-  67

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                 +G  +E ARKVG +IA+  L KG  KV FDRGGY YHGR+ A+ADAARE GL F
Sbjct  68   ----GNGGNVEGARKVGRMIAERALAKGYKKVVFDRGGYLYHGRVRALADAAREAGLDF  122



>ref|WP_015218383.1| 50S ribosomal protein L18 [Cyanobacterium aponinum]
 gb|AFZ52652.1| LSU ribosomal protein L18P [Cyanobacterium aponinum PCC 10605]
Length=122

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH RIRKKV+GTPERPRL+VFRSN H+Y Q+IDD   HTL A ST+ K + E+   +S  
Sbjct  12   RHLRIRKKVQGTPERPRLAVFRSNFHIYAQIIDDVAQHTLVAASTLDKELREKLKDASTS  71

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
              + + +VG++IA+  L KGI KV FDRGG  YHGR++A+ADAARE+GL F
Sbjct  72   NCDASAEVGKLIAQRALSKGIDKVVFDRGGNLYHGRVKALADAARESGLNF  122



>ref|WP_045165000.1| 50S ribosomal protein L18 [Thermoanaerobacter cellulolyticus]
Length=122

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R+ RH RIRKKV GT ERPRL V++S K++Y Q+IDD K HTL A S+++  I  
Sbjct  6    NRNEKRLIRHKRIRKKVFGTAERPRLCVYKSLKYIYAQIIDDEKGHTLVAASSLEPEIKS  65

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                SS  +IE A+ VG+VIA+   EKGI+KV FDRGGYPYHGR++A+ADAARE GL+F
Sbjct  66   RL--SSTKSIEAAQYVGKVIAERAKEKGITKVVFDRGGYPYHGRVKALADAAREAGLEF  122



>ref|WP_041695510.1| 50S ribosomal protein L18 [Alicyclobacillus acidocaldarius]
Length=119

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R  RH R+R KV GTPERPRL+VFRSNKH+Y Q+IDDT  HT+AA S+++K    
Sbjct  6    NRNETRKRRHVRVRAKVFGTPERPRLNVFRSNKHIYAQLIDDTIGHTIAAASSLEKGFE-  64

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                 +G  +E ARKVG +IA+  L KG  KV FDRGGY YHGR+ A+ADAARE GL F
Sbjct  65   ----GNGGNVEGARKVGRMIAERALAKGYKKVVFDRGGYLYHGRVRALADAAREAGLDF  119



>ref|WP_044359548.1| 50S ribosomal protein L18 [Staphylococcus microti]
 gb|KIX91078.1| 50S ribosomal protein L18 [Staphylococcus microti]
Length=119

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+V+RSNKH+Y Q+IDDTK  TLA  ST    +      +
Sbjct  11   RLKRHARVRTKLSGTSERPRLNVYRSNKHIYAQIIDDTKGVTLAQASTKDSGVD-----T  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E+A KVGE IAK   EKGI  V FDRGGY +HGR++A+ADAARENGLQF
Sbjct  66   SATKVEMATKVGEAIAKKANEKGIEAVVFDRGGYLFHGRVKALADAARENGLQF  119



>ref|WP_016839384.1| 50S ribosomal protein L18 [Ureibacillus thermosphaericus]
Length=119

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GTPERPRL+V+RSNK++Y Q+IDD   HTL + ST++K         
Sbjct  11   RKKRHARVRTKIHGTPERPRLNVYRSNKNIYAQIIDDVAGHTLVSASTLEKDFE-----G  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G   + A KVGE+IAK  LEK I+ V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  66   AGNNKDAAAKVGELIAKRALEKNITTVVFDRGGYLYHGRVKALADAARENGLQF  119



>ref|WP_002482628.1| 50S ribosomal protein L18 [Staphylococcus saprophyticus]
 gb|EHY93219.1| 50S ribosomal protein L18 [Staphylococcus saprophyticus subsp. 
saprophyticus KACC 16562]
 gb|KIJ87645.1| 50S ribosomal protein L18 [Staphylococcus saprophyticus]
Length=120

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+++RSNKH+Y QVIDD    TLA  ST +K ++ E    
Sbjct  11   RLKRHARVRNKLAGTAEKPRLNIYRSNKHIYAQVIDDVNGKTLAQASTQEKDLANE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  +E++ KVGE +AK   EKG+  + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   SGSKVELSAKVGETVAKRASEKGVKTIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_025685932.1| 50S ribosomal protein L18 [Paenibacillus sp. 1-49]
Length=122

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD    TL + STM K +S E    
Sbjct  11   RVRRHLRVRKKIEGTALRPRLNVFRSSKHIYAQLIDDVAGVTLVSASTMDKELSSEIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E ARKVGE++AK   EKG + + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVEAARKVGELVAKRAKEKGHANIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_015900963.1| 50S ribosomal protein L18 [Staphylococcus carnosus]
 sp|B9DM31.1|RL18_STACT RecName: Full=50S ribosomal protein L18 [Staphylococcus carnosus 
subsp. carnosus TM300]
 emb|CAL28625.1| 50S ribosomal protein L18 [Staphylococcus carnosus subsp. carnosus 
TM300]
 gb|KKB25252.1| 50S ribosomal protein L18 [Staphylococcus carnosus subsp. utilis]
Length=120

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R  + GT ++PRL+V+RSNKH+Y Q+IDDTK  TL   ST  K    +F   
Sbjct  11   RLKRHARVRSNLSGTAQKPRLNVYRSNKHIYAQIIDDTKGVTLVQASTQDK----DFENE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E++ KVGE IAK   +KGI+++ FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   TGSKVELSSKVGEAIAKKAADKGITEIVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|XP_006586621.1| PREDICTED: uncharacterized protein LOC100306308 isoform X1 [Glycine 
max]
Length=162

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  165  PTSTRPLIVQAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMH  344
            P+ + P +++A+ RTRREDR ARH+RIRKKVEGTPERPRLSVFRSNKHL VQVIDDTKMH
Sbjct  28   PSHSLPFVLEAKDRTRREDRSARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTKMH  87

Query  345  TLAAVSTMQKAISEEFNYSSGPTIEVA  425
            TLA++STMQK ++EEFNYS+GPT+ ++
Sbjct  88   TLASISTMQKTVAEEFNYSAGPTLVIS  114



>ref|WP_007432568.1| MULTISPECIES: 50S ribosomal protein L18 [Paenibacillus]
 gb|ADM72026.1| 50S ribosomal protein L18 [Paenibacillus polymyxa E681]
 gb|ADO58704.1| 50S ribosomal protein L18 [Paenibacillus polymyxa SC2]
 gb|EHS55403.1| 50S ribosomal protein L18 [Paenibacillus sp. Aloe-11]
 emb|CCI71245.1| 50S ribosomal protein L18 [Paenibacillus polymyxa M1]
 gb|AHM68108.1| 50S ribosomal protein L18 [Paenibacillus polymyxa SQR-21]
 gb|KEO76294.1| 50S ribosomal protein L18 [Paenibacillus polymyxa]
 gb|AIW41831.1| 50S ribosomal protein L18 [Paenibacillus polymyxa CR1]
 gb|AIY08849.1| 50S ribosomal protein L18 [Paenibacillus polymyxa]
 gb|AJE52258.1| 50S ribosomal protein L18 [Paenibacillus polymyxa]
 gb|KJD37627.1| 50S ribosomal protein L18 [Paenibacillus polymyxa]
 gb|KJK28390.1| 50S ribosomal protein L18 [Paenibacillus polymyxa]
Length=122

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD    TL + STM K +S E    
Sbjct  11   RVRRHLRVRKKIEGTAVRPRLNVFRSSKHIYAQLIDDVAGVTLVSASTMDKELSSEIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E ARKVGE++AK   EKG + + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVEAARKVGELVAKRAKEKGHANIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_045851866.1| 50S ribosomal protein L18 [Domibacillus enclensis]
Length=120

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 9/128 (7%)
 Frame = +3

Query  183  LIVQAE-SRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAV  359
            +I +A+ ++TR+     RH+R+R K+ GT  RPRL+VFRSNKHLY Q+IDD    TLA+ 
Sbjct  1    MITKADKNKTRKR----RHARVRAKIAGTAARPRLNVFRSNKHLYAQLIDDANGVTLASA  56

Query  360  STMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADA  539
            ST++K    +F   S   +E A KVGE +AK   EKG++ V FDRGGY YHGR++A+ADA
Sbjct  57   STIEK----DFGLESTSNLEAAAKVGETLAKRATEKGVASVVFDRGGYLYHGRVKALADA  112

Query  540  ARENGLQF  563
            ARENGL+F
Sbjct  113  ARENGLEF  120



>ref|WP_016859433.1| 50S ribosomal protein L18 [Fischerella muscicola]
Length=120

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH RIR KV G+PERPRL++FRS++H+Y QVIDDT+ HTL A ST++  +  
Sbjct  4    TRRESKQRRHRRIRGKVNGSPERPRLAIFRSHQHIYAQVIDDTQHHTLVAASTLEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   +SG   + + +VG++IA   LEKGI+KV FDRGG  YHGRI+A+ADAARE GL F
Sbjct  64   KL--TSGGNAKASTEVGKLIAARALEKGITKVVFDRGGNLYHGRIKALADAAREAGLDF  120



>ref|WP_011302601.1| 50S ribosomal protein L18 [Staphylococcus saprophyticus]
 sp|Q49ZF2.1|RL18_STAS1 RecName: Full=50S ribosomal protein L18 [Staphylococcus saprophyticus 
subsp. saprophyticus ATCC 15305]
 dbj|BAE17824.1| 50S ribosomal protein L18 [Staphylococcus saprophyticus subsp. 
saprophyticus ATCC 15305]
Length=120

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+++RSNKH+Y QVIDD    TLA  ST +K ++ E    
Sbjct  11   RLKRHARVRNKLAGTAEKPRLNIYRSNKHIYAQVIDDVSGKTLAQASTQEKDLANE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  +E++ KVGE +AK   EKG+  + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   SGSKVELSAKVGETVAKRASEKGVKTIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_002471319.1| 50S ribosomal protein L18 [Staphylococcus pettenkoferi]
 gb|EHM71702.1| ribosomal protein L18 [Staphylococcus pettenkoferi VCU012]
Length=120

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+V+RSNKH+Y QVIDD K  TLA  ST  K ++ E    
Sbjct  11   RLKRHARVRTKLSGTAEKPRLNVYRSNKHIYAQVIDDVKGETLAQASTKDKELANE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  +E+A KVG  +AK   +KGIS + FDRGGY YHGR++A+A+AARENGL+F
Sbjct  67   SGSKVEMASKVGAAVAKRAQDKGISTIVFDRGGYLYHGRVKALAEAARENGLEF  120



>ref|WP_016868078.1| 50S ribosomal protein L18 [Fischerella muscicola]
Length=120

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH RIR KV G+PERPRL++FRS++H+Y QVIDDT+ HT+ A ST++  +  
Sbjct  4    TRRESKQRRHRRIRGKVSGSPERPRLAIFRSHQHIYAQVIDDTQHHTIVAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +  +  G  I+ + +VG++IA   LEKGI+KV FDRGG  YHGRI+A+ADAARE GL F
Sbjct  64   KLTF--GGNIQASTEVGKLIATRALEKGITKVVFDRGGNLYHGRIKALADAAREAGLDF  120



>ref|WP_006640331.1| 50S ribosomal protein L18 [Bacillus sonorensis]
 gb|EME72441.1| 50S ribosomal protein L18 [Bacillus sonorensis L12]
Length=120

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GTPERPRL+VFRSNKH+Y QVIDD    TL + ST+ K    +FN  
Sbjct  11   RLKRHARVRAKLSGTPERPRLNVFRSNKHIYAQVIDDVNGVTLVSASTLDK----DFNAE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +      A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   NSGDTSAAAKVGELVAKRASEKGITNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_027114576.1| 50S ribosomal protein L18 [Lachnospiraceae bacterium NK4A144]
Length=122

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            ++R E R  +H +IR +  GTPERPRL+VFRSNKH+Y QVIDD   +TL A ST +K ++
Sbjct  5    KSRSEVREKKHMKIRNRFSGTPERPRLAVFRSNKHMYAQVIDDVAGNTLVAASTTEKEVA  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             E  Y+    +E A+K+GEVIAK  LEKGI +V FDRGG+ Y G+++A+A+AARE GL F
Sbjct  65   SELKYTD--NVEAAQKLGEVIAKRALEKGIKEVVFDRGGFIYQGKVKALAEAAREAGLDF  122



>ref|WP_039234442.1| 50S ribosomal protein L18 [Bacillus thermotolerans]
 gb|KKB34883.1| LSU ribosomal protein L18p (L5e) [Bacillaceae bacterium MTCC 
8252]
 gb|KKB35874.1| LSU ribosomal protein L18p (L5e) [Bacillus thermotolerans]
 gb|KKB40247.1| LSU ribosomal protein L18p (L5e) [Bacillaceae bacterium MTCC 
10057]
Length=120

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 9/128 (7%)
 Frame = +3

Query  183  LIVQAE-SRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAV  359
            +I +A+ ++TR++    RH R+R K+ GT ERPRL+V+RSN+HLY QVIDD    TLA+ 
Sbjct  1    MITKADKNKTRKK----RHGRVRSKLNGTAERPRLNVYRSNQHLYAQVIDDMNGVTLASA  56

Query  360  STMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADA  539
            ST++K    +F       ++ A KVGE++AK   EKGI+ V FDRGGY YHGR++A+ADA
Sbjct  57   STVEK----DFGLEQTNNVDAAAKVGELVAKRASEKGITSVVFDRGGYLYHGRVKALADA  112

Query  540  ARENGLQF  563
            ARENGLQF
Sbjct  113  ARENGLQF  120



>ref|WP_007132555.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillales]
 gb|EHB54201.1| ribosomal protein L18 [Paenibacillus lactis 154]
Length=122

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK++GT ERPRL+VFRS+KH+Y Q+IDD    TLA+ ST+ K +S +    
Sbjct  11   RLKRHLRVRKKIQGTAERPRLNVFRSSKHIYAQLIDDVAGVTLASASTLDKELSSDIQ--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE++AK   EKG   V FDRGGY YHGRI+A+A+AARE GL+F
Sbjct  69   NGGNVESARKVGELVAKRAAEKGYKSVVFDRGGYLYHGRIQALAEAAREAGLEF  122



>ref|WP_005583490.1| 50S ribosomal protein L18 [Clostridium ultunense]
 emb|CCQ93734.1| ribosomal protein L18 [Clostridium ultunense Esp]
Length=122

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            + ++R  RH RIR+K+ GT ERPRL+VFRSNKH+Y Q+IDD    TL + ST+   +  E
Sbjct  7    KNKERKVRHLRIRRKLHGTHERPRLNVFRSNKHIYAQLIDDQAGVTLVSASTLDPELKGE  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +G  IE A KVG +IAK  LEKGI++V FDRGGYPYHGR++A+AD+ARE GLQF
Sbjct  67   I--ENGGNIEAAEKVGALIAKRALEKGITQVVFDRGGYPYHGRVKALADSAREAGLQF  122



>ref|WP_033100600.1| 50S ribosomal protein L18 [Thermoactinomyces daqus]
Length=122

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            R + R  RH R+RKKV GT ERPRL+VFRS+K++Y Q+IDDT  HT+A+ ST+   + E+
Sbjct  7    RNKKRAKRHLRVRKKVFGTAERPRLNVFRSSKNIYAQLIDDTIGHTVASASTLDAELKEK  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            F  S+G T++ AR VGE+IAK  +EKG   V FDRGGY YHGR++A+A+ ARE GL F
Sbjct  67   F--SNGGTVDAARAVGELIAKRAVEKGFKSVVFDRGGYLYHGRVKALAEGAREGGLDF  122



>ref|WP_006676506.1| 50S ribosomal protein L18 [Paenibacillus dendritiformis]
 gb|EHQ62484.1| 50S ribosomal protein L18 [Paenibacillus dendritiformis C454]
Length=122

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y QVIDD K  T+AA STM K + EE    
Sbjct  11   RLKRHLRVRKKIEGTTARPRLNVFRSSKHIYAQVIDDVKGVTIAAASTMDKELREEI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E A KVGE+IAK    +G   V FDRGGY YHGRI+A+A+AARE GL+F
Sbjct  69   NGGSVEAASKVGELIAKRAKAQGYDNVVFDRGGYLYHGRIQALAEAAREAGLEF  122



>ref|WP_029523395.1| 50S ribosomal protein L18 [Persephonella sp. KM09-Lau-8]
Length=123

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            +TRR+ RI RH RIRKKV GT ERPR++ F+S  +LYVQ+IDD    TL + ST+ K   
Sbjct  4    KTRRQKRIIRHKRIRKKVFGTAERPRMAFFKSLNNLYVQIIDDEAGKTLVSASTIDKDFV  63

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E++    G  IE+A+K+GE IA+  L KGI +V FDRGG+ YHG+++A A+AARE GL+F
Sbjct  64   EKYGVRGGKNIEIAKKLGEFIAEKALAKGIERVVFDRGGFIYHGKVKAFAEAAREKGLKF  123



>ref|WP_023626415.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 gb|ESU31465.1| 50S ribosomal protein L18 [Bacillus sp. 17376]
 dbj|GAM14797.1| LSU ribosomal protein L18p (L5e) [Bacillus selenatarsenatis SF-1]
Length=119

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 10/128 (8%)
 Frame = +3

Query  183  LIVQAESR-TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAV  359
            +I +A+   TRR+    RH R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD K  TLA+ 
Sbjct  1    MITKADKNATRRK----RHGRVRAKLSGTEARPRLNVFRSNKHIYAQLIDDVKGVTLASA  56

Query  360  STMQKAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADA  539
            ST+ K ++ E     G  +E A+++GE+IAK  +EKG   V FDRGGY YHGRI+A+ADA
Sbjct  57   STLDKEVNVE-----GNNLEAAKQIGELIAKRAVEKGYKSVVFDRGGYLYHGRIQALADA  111

Query  540  ARENGLQF  563
            ARENGL+F
Sbjct  112  ARENGLEF  119



>ref|WP_010469301.1| 50S ribosomal protein L18 [Acaryochloris sp. CCMEE 5410]
Length=118

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRR+   +RH R+R+KV GT ERPRL+VFRSN+H+Y QVIDD++ HTLAA ST++     
Sbjct  4    TRRDATRSRHQRVRRKVVGTAERPRLAVFRSNQHIYAQVIDDSQQHTLAAASTVE----S  59

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   SSG T + +  VG+++A+  +EKGI  V FDRGG  YHGR++A+ADAARE GL+F
Sbjct  60   DLKSSSGATCDASTAVGKLVAERAIEKGIKAVVFDRGGNLYHGRVKALADAAREAGLEF  118



>ref|WP_014096492.1| 50S ribosomal protein L18 [Bacillus coagulans]
 gb|AEP00362.1| ribosomal protein L18 [Bacillus coagulans 36D1]
 gb|KGB30083.1| 50S ribosomal protein L18 [Bacillus coagulans]
 gb|AJO24874.1| 50S ribosomal protein L18 [Bacillus coagulans]
Length=120

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+++RSNK++Y Q+IDD    TLA+ ST+ K +S E    
Sbjct  11   RKKRHARVRAKLSGTAERPRLNIYRSNKNIYAQLIDDANGVTLASASTLDKELSLE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S    E A+KVGE+IAK  +EKGI +V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STGNAEAAQKVGELIAKRAMEKGIKEVVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|WP_011317571.1| 50S ribosomal protein L18 [Anabaena variabilis]
 sp|Q3MFA6.1|RL18_ANAVT RecName: Full=50S ribosomal protein L18 [Anabaena variabilis 
ATCC 29413]
 gb|ABA20330.1| LSU ribosomal protein L18P [Anabaena variabilis ATCC 29413]
Length=120

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH R+R KV+G+PERPRL+VFRSN+H+Y QVIDDT+ HTL + ST++  +  
Sbjct  4    TRRESKQRRHRRVRGKVQGSPERPRLAVFRSNEHIYAQVIDDTQHHTLVSASTVEPEVKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +SG   E + ++G++IA   LEKGI+KV FDRGG  YHGRI+A+A+AARE GL F
Sbjct  64   SL--ASGANCEASSQIGKLIAVRSLEKGITKVVFDRGGNLYHGRIKALAEAAREAGLDF  120



>ref|WP_009455540.1| MULTISPECIES: 50S ribosomal protein L18 [Fischerella]
 gb|EHC18127.1| ribosomal protein L18 [Fischerella sp. JSC-11]
Length=120

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH RIR KV G+PERPRL++FRS++H+Y QVIDDT+ HT+ A ST++  +  
Sbjct  4    TRRESKQRRHRRIRGKVSGSPERPRLAIFRSHQHIYAQVIDDTQHHTIVAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +  +  G  I+ + +VG++IA   LEKGI+KV FDRGG  YHGR++A+ADAARE GL F
Sbjct  64   KLTF--GGNIQASTEVGKLIATRALEKGITKVVFDRGGNLYHGRVKALADAAREAGLDF  120



>ref|WP_014278306.1| 50S ribosomal protein L18 [Paenibacillus terrae]
 gb|AET57537.1| 50S ribosomal protein L18 [Paenibacillus terrae HPL-003]
Length=122

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS KH+Y Q+IDD    TL + STM K +S E    
Sbjct  11   RVRRHLRVRKKIEGTAVRPRLNVFRSAKHIYAQLIDDVAGVTLVSASTMDKELSSEIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E ARKVGE++AK   EKG + + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVEAARKVGELVAKRAKEKGHANIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_034931942.1| 50S ribosomal protein L18 [Erysipelotrichaceae bacterium NK3D112]
Length=118

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            + E+RI RH R+RK V GTP+ PRL+VFRSN ++Y QVIDDT   TL A S++      E
Sbjct  7    KNEERIRRHKRVRKIVNGTPDCPRLNVFRSNANIYAQVIDDTTGTTLCAASSL------E  60

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +G  IE A++VGE +AK CLEK I+ V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  61   LKLENGGNIEAAKQVGEAVAKKCLEKNITSVRFDRGGYVYHGRVQALADAAREAGLKF  118



>ref|WP_019420711.1| 50S ribosomal protein L18 [Paenibacillus sp. OSY-SE]
Length=122

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT ERPRL+VFRS+KH+Y Q+IDD K  T+A+ STM K ++ +    
Sbjct  11   RLKRHLRVRKKIEGTTERPRLNVFRSSKHIYAQLIDDVKGVTIASASTMDKELNADI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK    +G   V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGDVESARKVGELIAKRAKAQGYETVVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_011522046.1| 50S ribosomal protein L18 [Candidatus Koribacter versatilis]
 sp|Q1ISA6.1|RL18_KORVE RecName: Full=50S ribosomal protein L18 [Candidatus Koribacter 
versatilis Ellin345]
 gb|ABF40244.1| LSU ribosomal protein L18P [Candidatus Koribacter versatilis 
Ellin345]
Length=124

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  234  HSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGPT  413
            HSRIRKK+EGTPERPRL+V+RS  HLYVQVIDD+K  TL A +T++   ++E    +G  
Sbjct  15   HSRIRKKMEGTPERPRLNVYRSTNHLYVQVIDDSKGATLVAANTLEFGEAKEGKRPTGGN  74

Query  414  IEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +  A+++G+ IA+   +KGI+KV FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  75   LSAAKQLGKAIAERAKQKGINKVVFDRGGYLYHGRIKALADAAREGGLEF  124



>ref|WP_003225816.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus]
 ref|NP_388013.2| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. 168]
 sp|P46899.1|RL18_BACSU RecName: Full=50S ribosomal protein L18; AltName: Full=BL16 [Bacillus 
subtilis subsp. subtilis str. 168]
 pdb|3J3V|O Chain O, Atomic Model Of The Immature 50s Subunit From Bacillus 
Subtilis (state I-a)
 gb|AAB06815.1| ribosomal protein L18 [Bacillus subtilis]
 emb|CAB11908.2| ribosomal protein L18 [Bacillus subtilis subsp. subtilis str. 
168]
 gb|EFG90640.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. spizizenii 
ATCC 6633]
 gb|ADM36192.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. spizizenii 
str. W23]
 gb|ADV95063.1| 50S ribosomal protein L18 [Bacillus subtilis BSn5]
 dbj|BAK26475.1| 50S ribosomal protein L18 [Bacillus subtilis]
 dbj|BAK26482.1| 50S ribosomal protein L18 [Bacillus subtilis]
 dbj|BAK26490.1| 50S ribosomal protein L18 [Bacillus subtilis]
 dbj|BAK26506.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|AEP89201.1| ribosomal protein L18 [Bacillus subtilis subsp. subtilis str. 
RO-NN-1]
 gb|AFI26672.1| 50S ribosomal protein L18 [Bacillus sp. JS]
 gb|AFQ56069.1| Ribosomal protein L18 [Bacillus subtilis QB928]
 dbj|BAM49062.1| 50S ribosomal protein L18 [Bacillus subtilis BEST7613]
 dbj|BAM56332.1| 50S ribosomal protein L18 [Bacillus subtilis BEST7003]
 gb|AGA20692.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. BSP1]
 gb|EME04869.1| ribosomal protein L18 [Bacillus subtilis MB73/2]
 gb|AGG59475.1| ribosomal protein L18 [Bacillus subtilis subsp. subtilis 6051-HGW]
 gb|AGI27404.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. BAB-1]
 gb|ERI41584.1| 50S ribosomal protein L18 [Bacillus sp. EGD-AK10]
 gb|AHA76089.1| 50S ribosomal protein L18 [Bacillus subtilis PY79]
 gb|EXF51538.1| 50S ribosomal protein L18 [Bacillus subtilis QH-1]
 gb|KDE22449.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|AIC38507.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC42739.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|AIC96779.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. OH 131.1]
 emb|CCU59786.1| LSU ribosomal protein L18p (L5e) [Bacillus subtilis E1]
 gb|KFC28542.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|KFF56645.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|KFH29588.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis]
 gb|KFH29689.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis]
 gb|KFK77842.1| ribosomal protein L18 [Bacillus subtilis]
 dbj|GAK78725.1| 50S ribosomal protein L18 [Bacillus subtilis Miyagi-4]
 gb|AIX05857.1| 50S ribosomal protein L18 [Bacillus subtilis]
 emb|CEI55253.1| 50S ribosomal protein L18 [Bacillus subtilis]
 emb|CEJ75678.1| 50S ribosomal protein L18 [Bacillus sp.]
 gb|AIY91416.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis 
str. 168]
 gb|AIY95723.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|AJD34865.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. spizizenii]
 gb|KIH40486.1| 50S ribosomal protein L18 [Bacillus sp. A053]
 gb|AJE92818.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. subtilis]
 gb|KIL31672.1| hypothetical protein B4067_0105 [Bacillus subtilis subsp. subtilis]
 gb|KIN30420.1| hypothetical protein B4069_0129 [Bacillus subtilis]
 gb|KIN35637.1| hypothetical protein B4068_0105 [Bacillus subtilis]
 gb|KIN35960.1| hypothetical protein B4070_0127 [Bacillus subtilis]
 gb|KIN45441.1| hypothetical protein B4071_0106 [Bacillus subtilis]
 gb|KIN48015.1| hypothetical protein B4072_0130 [Bacillus subtilis]
 gb|KIN55936.1| hypothetical protein B4073_0104 [Bacillus subtilis]
 gb|KIN56942.1| hypothetical protein B4146_0104 [Bacillus subtilis]
 gb|KIN58482.1| hypothetical protein B4145_0104 [Bacillus subtilis]
 gb|KIO58625.1| hypothetical protein B4143_0109 [Bacillus subtilis]
 gb|AJO60588.1| 50S ribosomal protein L18 [Bacillus sp. YP1]
 gb|KIU10297.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|KIX80371.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|AJW85667.1| 50S ribosomal protein L18 [Bacillus subtilis]
Length=120

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K ++ E   S
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDLNVE---S  67

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G T   A KVGE++AK   EKGIS V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  68   TGDT-SAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF  120



>ref|WP_024860940.1| 50S ribosomal protein L18 [Ruminococcus flavefaciens]
Length=119

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+R K+ GTPERPRL+VFRS KH+Y Q+IDD    TLA+ S+M K         
Sbjct  11   RLKRHRRVRAKISGTPERPRLNVFRSTKHIYAQLIDDVNGVTLASASSMDKGFE-----G  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK+  +KGIS+V FDRGGY YHGR++ +A+ ARENGL+F
Sbjct  66   NGGNVEGARKVGEMIAKNAADKGISEVVFDRGGYLYHGRVKELAEGARENGLKF  119



>ref|WP_002506977.1| MULTISPECIES: 50S ribosomal protein L18 [Staphylococcus]
 emb|CCI58742.1| 50S ribosomal protein L18 [Staphylococcus equorum subsp. equorum 
Mu2]
 gb|EJX18828.1| 50S ribosomal protein L18 [Staphylococcus sp. OJ82]
 gb|ERH36161.1| 50S ribosomal protein L18 [Staphylococcus equorum UMC-CNS-924]
Length=120

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+++RSNKH+Y QVIDD    TLA  ST +K ++ E    
Sbjct  11   RLKRHARVRNKLSGTAEKPRLNIYRSNKHIYAQVIDDVNGKTLAQASTQEKDLANE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E++ KVGE +AK   +KGI  + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   TGSKVELSAKVGETVAKRASDKGIKTIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_003328274.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus subtilis group]
 gb|ADP34771.1| 50S ribosomal protein L18 [Bacillus atrophaeus 1942]
 dbj|BAK26411.1| 50S ribosomal protein L18 [Bacillus atrophaeus]
 gb|EIM09450.1| 50S ribosomal protein L18 [Bacillus atrophaeus C89]
 gb|EOB38787.1| LSU ribosomal protein L18p L5e [Bacillus atrophaeus UCMB-5137]
 gb|AIK48938.1| ribosomal protein L18 [Bacillus atrophaeus subsp. globigii]
 gb|KFK80870.1| ribosomal protein L18 [Bacillus subtilis subsp. niger]
 gb|AJF87260.1| 50S ribosomal protein L18 [Bacillus atrophaeus]
Length=120

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            ++   R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y QVIDD    TL + ST+ K    
Sbjct  6    SKNASRLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQVIDDVNGVTLVSASTLDK----  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            + N  S   I  A KVGE++AK   EKG+S V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  62   DLNIESTGDISAATKVGELVAKRAAEKGVSNVVFDRGGYLYHGRVKALADAAREAGLKF  120



>ref|WP_010332778.1| 50S ribosomal protein L18 [Bacillus mojavensis]
Length=120

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K ++ E   S
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDLNVE---S  67

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G T   A KVGE++AK   EKGIS V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  68   TGDT-SAAAKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF  120



>ref|WP_010279626.1| 50S ribosomal protein L18 [Paenibacillus senegalensis]
Length=122

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            + + R+ RH R+RKK++GT ERPRLS+FRS+KH+Y QVIDD K  T+A+ ST+   + E 
Sbjct  7    KNQARLKRHLRVRKKIQGTTERPRLSIFRSSKHMYAQVIDDIKGVTIASASTLDSELKE-  65

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +G   E ARKVGE++AK     GI KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  66   -GIGNGGNAEAARKVGELVAKRAKANGIEKVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_008339761.1| 50S ribosomal protein L18 [Alicyclobacillus acidocaldarius]
 gb|EED07162.1| ribosomal protein L18 [Alicyclobacillus acidocaldarius LAA1]
 gb|ACV59699.1| ribosomal protein L18 [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius DSM 446]
Length=119

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R  RH R+R KV GTPERPRL+VFRSNKH+Y Q+IDDT  HT+AA S+++K    
Sbjct  6    NRNEARKRRHVRVRAKVFGTPERPRLNVFRSNKHIYAQLIDDTIGHTIAAASSLEKGFE-  64

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                 +G  +E AR+VG +IA+  L KG  KV FDRGGY YHGR+ A+ADAARE GL F
Sbjct  65   ----GNGGNVEGARQVGRMIAERALAKGYKKVVFDRGGYLYHGRVRALADAAREAGLDF  119



>ref|WP_012164970.1| 50S ribosomal protein L18 [Acaryochloris marina]
 sp|B0C1E8.1|RL18_ACAM1 RecName: Full=50S ribosomal protein L18 [Acaryochloris marina 
MBIC11017]
 gb|ABW29683.1| 50S ribosomal protein L18 [Acaryochloris marina MBIC11017]
Length=118

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRR+   +RH R+R+KV GT ERPRL+VFRSN+H+Y QVIDD + HTLAA ST++     
Sbjct  4    TRRDATRSRHQRVRRKVVGTAERPRLAVFRSNQHIYAQVIDDAQQHTLAAASTVE----S  59

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   SSG T + +  VG+++A+  +EKGI  V FDRGG  YHGR++A+ADAARE GL+F
Sbjct  60   DLKSSSGATCDASTAVGKLVAERAIEKGIKAVVFDRGGNLYHGRVKALADAAREAGLEF  118



>ref|WP_044747035.1| 50S ribosomal protein L18 [Bacillus alveayuensis]
Length=120

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+V+RSNKH+Y QVIDDT   TL + ST+ K    E N  
Sbjct  11   RKKRHARVRSKLFGTATRPRLNVYRSNKHIYAQVIDDTNHATLVSASTLDK----ELNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   I+ A+KVGE++AK  LEKGI  V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGNIDAAQKVGELVAKRALEKGIKNVVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_029520171.1| 50S ribosomal protein L18 [Persephonella sp. IF05-L8]
Length=123

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            +TRR+ RI RH RIRKKV GT ERPR++ F+S  +LYVQ+IDD    TL + ST+ K   
Sbjct  4    KTRRQKRIIRHKRIRKKVFGTAERPRMAFFKSLNNLYVQIIDDEAGKTLVSASTIDKDFV  63

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E++    G  IE+A+K+GE IA+  L KGI +V FDRGG+ YHG+++A A+AARE GL+F
Sbjct  64   EKYGVRGGKNIEMAKKLGEFIAEKALAKGIERVVFDRGGFIYHGKVKAFAEAAREKGLKF  123



>ref|WP_012548289.1| 50S ribosomal protein L18 [Dictyoglomus thermophilum]
 sp|B5YDV9.1|RL18_DICT6 RecName: Full=50S ribosomal protein L18 [Dictyoglomus thermophilum 
H-6-12]
 gb|ACI19657.1| ribosomal protein L18 [Dictyoglomus thermophilum H-6-12]
Length=122

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            R+R+E R  RH RIRKK+ GT ERPRL+V++S +++Y Q+IDDTK HTL + S+++K I 
Sbjct  5    RSRKELRKIRHLRIRKKIIGTSERPRLAVYKSLRYIYAQIIDDTKGHTLVSASSLEKEIR  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             +    S   IE A+ VGEVIAK  LEKGI KV FDRGG+ YHG+++A+AD+AR  GL+F
Sbjct  65   SQLK--STKNIEAAKLVGEVIAKRALEKGIKKVVFDRGGFLYHGKVKALADSARAAGLEF  122



>ref|WP_006284360.1| 50S ribosomal protein L18 [Paenibacillus popilliae]
 dbj|GAC41089.1| ribosomal protein L18 [Paenibacillus popilliae ATCC 14706]
Length=122

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD +  TLAA STM K + EE    
Sbjct  11   RLKRHLRVRKKIEGTSARPRLNVFRSSKHIYAQLIDDVQGVTLAAASTMDKELREEI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK    +G   V FDRGGY YHGRI+A+A+AARE GL+F
Sbjct  69   NGGGVEAARKVGELIAKRAKAQGHDNVVFDRGGYLYHGRIQALAEAAREAGLEF  122



>ref|WP_033827273.1| 50S ribosomal protein L18 [Bacillus sp. KW-12]
Length=120

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+R K+ GTPERPRLSV+RSNKH+Y Q+IDD    TLA+ ST+ K    E N  S  
Sbjct  14   RHARVRAKISGTPERPRLSVYRSNKHIYAQLIDDMNGVTLASASTLDK----EINVESAS  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             I+ A KVGE++AK  +EKG   V FDR GY YHGRI+A+ADAARE GL+F
Sbjct  70   NIDAAAKVGELVAKRAVEKGYKSVVFDRSGYLYHGRIQALADAAREAGLEF  120



>ref|WP_017722934.1| 50S ribosomal protein L18 [Staphylococcus xylosus]
 gb|AID02069.1| 50S ribosomal protein L18 [Staphylococcus xylosus]
 gb|AID42143.1| LSU ribosomal protein L18p (L5e) [Staphylococcus xylosus]
 emb|CEF18148.1| 50S ribosomal protein L18 [Staphylococcus xylosus]
Length=120

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RHSR+R K+ GT E+PRL+++RSNKH+Y QVIDD    T+A  ST +K ++ E    
Sbjct  11   RLKRHSRVRSKLAGTAEKPRLNIYRSNKHIYAQVIDDVNGKTIAQASTQEKDLANE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            SG  ++++ KVGE +AK   EKG+  + FDRGGY YHGR++A+ADAARENGL+F
Sbjct  67   SGSKVDLSAKVGETVAKRASEKGVKTIVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_036835550.1| 50S ribosomal protein L18 [Pontibacillus litoralis]
 gb|KGX85367.1| 50S ribosomal protein L18 [Pontibacillus litoralis JSM 072002]
Length=120

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RHSR+RKK+ GTPERPRL+V+RSNKH+Y Q+IDD    T+A+ ST    +  EFN  
Sbjct  11   RKKRHSRVRKKIAGTPERPRLNVYRSNKHIYAQLIDDVNGVTVASAST----VDNEFNLD  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   +E A KVGE++AK   +KG  ++ FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   TTGNVEAATKVGELVAKRAQDKGFKEIVFDRGGYLYHGRVKALADAAREAGLEF  120



>ref|WP_018759697.1| 50S ribosomal protein L18 [Paenibacillus terrigena]
Length=122

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRLSVFRS+KH+Y Q+IDD    T+AA STM K +  +    
Sbjct  11   RLKRHLRVRKKIEGTTTRPRLSVFRSSKHVYAQLIDDVTGKTVAAASTMDKELQGQI--G  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE++AK   E G  +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   NGGNVEAARKVGELVAKRAKEAGYVQVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_019167903.1| 50S ribosomal protein L18 [Staphylococcus intermedius]
Length=119

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT E+PRL+V+RSNKH+Y Q+IDDTK  TL   ST    +      +
Sbjct  11   RLKRHARVRTKLSGTSEKPRLNVYRSNKHIYAQIIDDTKGVTLVQASTKDSDVD-----T  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E+A KVGEVIAK   EKGI  V FDRGGY +HGR++A+ADAARENGLQF
Sbjct  66   SATKVEMASKVGEVIAKKANEKGIEAVVFDRGGYLFHGRVKALADAARENGLQF  119



>ref|WP_011612507.1| 50S ribosomal protein L18 [Trichodesmium erythraeum]
 sp|Q110C2.1|RL18_TRIEI RecName: Full=50S ribosomal protein L18 [Trichodesmium erythraeum 
IMS101]
 gb|ABG52152.1| LSU ribosomal protein L18P [Trichodesmium erythraeum IMS101]
Length=120

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TR++  I RH R+RKKV GT ERPRLSVFRSN H+Y QVIDDTK HTL A ST++  +  
Sbjct  4    TRKDSIIKRHRRVRKKVFGTSERPRLSVFRSNMHIYAQVIDDTKQHTLVAASTLEAEVKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                 SG   + + ++G++IA+  LEKGI KV FDRGG  YHGR++A+A+AARE GL F
Sbjct  64   TIK--SGANCDASIQIGKLIAQRSLEKGIEKVVFDRGGNLYHGRVKALAEAAREAGLDF  120



>ref|WP_018663945.1| 50S ribosomal protein L18 [Bacillus acidiproducens]
Length=120

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R ++ GT ERPRL+++RSNK++Y Q+IDD    TL + ST+ K    + N  
Sbjct  11   RKKRHARVRARLSGTAERPRLNIYRSNKNIYAQLIDDVNHVTLVSASTLDK----DLNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE+IAK  LEKG+ +V FDRGGY YHGR++A+ADAARENGLQF
Sbjct  67   STGNVEAAQKVGELIAKRALEKGLEEVVFDRGGYLYHGRVKALADAARENGLQF  120



>ref|WP_003241994.1| MULTISPECIES: 50S ribosomal protein L18 [Bacillus subtilis group]
 gb|ELS59231.1| 50S ribosomal protein L18 [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=120

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K ++ E   S
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDLNVE---S  67

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G T   A KVGE++AK   EKG+S V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  68   TGDT-SAATKVGELVAKRAAEKGVSDVVFDRGGYLYHGRVKALADAAREAGLKF  120



>ref|WP_028595144.1| 50S ribosomal protein L18 [Paenibacillus assamensis]
Length=122

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL+VFRS+KH+Y Q+IDD K  T+A+ STM K + ++    
Sbjct  11   RLKRHLRVRKKIEGTTARPRLNVFRSSKHIYAQLIDDVKGVTVASASTMDKELRDQI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E A KVGE+IAK   E+G + V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVEAAAKVGELIAKRAKEQGQTNVVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_032120412.1| 50S ribosomal protein L18 [Clostridium sp. LF2]
Length=120

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R+E R  RH R+RKK+ GT ERPRLSV+RS KH+YVQ+IDD    TL A ST+ K +  
Sbjct  6    NRQESRERRHLRVRKKISGTAERPRLSVYRSEKHIYVQIIDDVAQRTLVAASTLDKDLGL  65

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E     G   + A+KVGE++AK  L+KGI +V FDRGGY YHGR++ +AD ARE GL+F
Sbjct  66   EL----GSNKDAAKKVGELVAKKALDKGIKQVVFDRGGYIYHGRVKELADGAREAGLEF  120



>gb|EES53072.1| ribosomal protein L18 [Leptospirillum ferrodiazotrophum]
Length=118

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TR E R+++H+R+RKK++G+PERPRLSV+RS K++Y Q+IDDT   TL + S++   +SE
Sbjct  5    TRNEKRLSKHARVRKKIKGSPERPRLSVYRSLKYIYAQIIDDTTGSTLVSASSL--TMSE  62

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                 SG T++VA+KVGEV+A    +K I+ V FDRGGY YHGRI+A+AD AR  GLQF
Sbjct  63   A---KSGDTVDVAKKVGEVLATEAKKKNITSVVFDRGGYLYHGRIKALADGARSGGLQF  118



>ref|WP_036652519.1| 50S ribosomal protein L18 [Paenibacillus pini]
 dbj|GAF10263.1| LSU ribosomal protein L18p [Paenibacillus pini JCM 16418]
Length=122

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT ERPRL+VFRS+KH+Y Q+IDD    T+ + ST+ K ISE     
Sbjct  11   RVRRHLRVRKKIEGTAERPRLNVFRSSKHMYAQLIDDVAGVTIVSASTVDKEISESIK--  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G ++E AR+VGE++AK   +KG + V FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGSVESARQVGELVAKRAKDKGHTSVVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_003348593.1| 50S ribosomal protein L18 [Bacillus methanolicus]
 gb|EIJ81237.1| 50S ribosomal protein L18 [Bacillus methanolicus MGA3]
 gb|AIE58658.1| 50S ribosomal protein L18 [Bacillus methanolicus MGA3]
Length=120

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K    + N  
Sbjct  11   RKKRHARVRSKLSGTAARPRLNVFRSNKHIYAQLIDDVNGVTLASASTLDK----DLNLE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A+KVGE++AK  +EKGI  V FDRGGY YHGR++A+A+AARENGL+F
Sbjct  67   STGNVEAAQKVGELVAKRAIEKGIKSVVFDRGGYLYHGRVKALAEAARENGLEF  120



>ref|WP_022337785.1| 50S ribosomal protein L18 [Clostridium sp. CAG:433]
 emb|CDD30051.1| 50S ribosomal protein L18 [Clostridium sp. CAG:433]
Length=120

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            +R E R ARH RIRK + GT E PRL+VFRS KH+  Q+IDD   +TL + S+M K    
Sbjct  6    SRNEARQARHERIRKNISGTNEVPRLNVFRSAKHITAQIIDDEAGNTLVSASSMDK----  61

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +    +G  +E A+KVGE IAK  ++ GI+KV FDRGGY YHGR++A+ADAARENGL+F
Sbjct  62   DLKIENGGNVEAAKKVGEAIAKKAVKAGITKVVFDRGGYLYHGRVQALADAARENGLEF  120



>ref|WP_034304989.1| 50S ribosomal protein L18 [Bacillus simplex]
 emb|CEG24662.1| 50S ribosomal protein L18 [Bacillus simplex]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD K  TLA+ ST+ K I  E    
Sbjct  11   RQKRHARVRAKLSGTEARPRLNVFRSNKHIYAQLIDDAKGVTLASASTLDKEIGIE----  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G   E A+KVGE+IAK  +EKG   V FDRGGY +HGR++A+ADAARENGL+F
Sbjct  67   AGSNAEAAQKVGELIAKRAVEKGFKAVVFDRGGYLFHGRVKALADAARENGLEF  120



>dbj|BAK26514.1| 50S ribosomal protein L18 [Bacillus subtilis]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K    + N  
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDK----DLNVE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S      A KVGE++AK   EKGIS V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGDASAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF  120



>emb|CEG24406.1| 50S ribosomal protein L18 [Planomicrobium sp. ES2]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R  RH+R+R K+ GT ERPRL+VFRSNK++Y Q+IDDTK  TL + S+M+K    +F   
Sbjct  11   RKKRHARVRSKITGTAERPRLNVFRSNKYIYAQLIDDTKGVTLVSASSMEK----DFTGE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S   +E A K+GE IAK   E+G++ + FDRGGY YHGRI+A+A+AARENGLQF
Sbjct  67   STGNVEAAAKIGETIAKRATEQGLNSIVFDRGGYLYHGRIKALAEAARENGLQF  120



>ref|WP_017310479.1| MULTISPECIES: 50S ribosomal protein L18 [Stigonematales]
 gb|KIY13454.1| 50S ribosomal protein L18 [Mastigocladus laminosus UU774]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
            TRRE +  RH RIR KV G+PERPRL++FRS++H+Y QVIDDT+ HTL A ST++  +  
Sbjct  4    TRRESKQRRHRRIRGKVSGSPERPRLAIFRSHQHIYAQVIDDTQHHTLVAASTVEPELKS  63

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +   +SG   + + +VG+++A   LEKGI+KV FDRGG  YHGRI+A+ADAARE GL F
Sbjct  64   KL--TSGGNAKASTEVGKLLAARALEKGITKVVFDRGGNLYHGRIKALADAAREAGLDF  120



>ref|WP_031537909.1| 50S ribosomal protein L18 [Bacillus sp. MB2021]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +3

Query  231  RHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYSSGP  410
            RH+R+R K+ GT  RPRL+VFRSNKH+Y Q+IDD K  T+A+ S++ K    E N  S  
Sbjct  14   RHARVRSKLSGTEARPRLNVFRSNKHIYAQLIDDVKGVTIASASSLDK----ELNLESTG  69

Query  411  TIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             +E A K+GE++AK  +EKGI  V FDRGGY YHGR++A+ADAARENGL+F
Sbjct  70   NLEAAVKIGELVAKRAVEKGIKSVVFDRGGYLYHGRVKALADAARENGLEF  120



>ref|WP_040735558.1| 50S ribosomal protein L18 [Paenibacillus alvei]
Length=122

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK EGT ERPRL+VFRS+KH+Y Q+IDD K  T+A+ STM K +  +    
Sbjct  11   RLKRHLRVRKKXEGTTERPRLNVFRSSKHIYAQLIDDVKGVTVASASTMDKELRGDI--K  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK   E+G   + FDRGGY YHGRI+A+ADAARE GL+F
Sbjct  69   NGGNVESARKVGELIAKRAKEQGYETIVFDRGGYLYHGRIQALADAAREAGLEF  122



>ref|WP_044153410.1| 50S ribosomal protein L18 [Salinibacillus aidingensis]
 dbj|BAK26498.1| 50S ribosomal protein L18 [Bacillus subtilis]
Length=120

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K ++ E   S
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDLNVE---S  67

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G T   A KVGE++AK   EKG+S V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  68   TGDT-SAAAKVGELVAKRAAEKGVSDVVFDRGGYLYHGRVKALADAAREAGLKF  120



>ref|WP_009984976.1| 50S ribosomal protein L18 [Ruminococcus flavefaciens]
Length=119

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+R K+ GT ERPRL+VFRS+KH+Y Q+IDD    TLA+ S+M K         
Sbjct  11   RLKRHRRVRAKISGTAERPRLNVFRSSKHIYAQLIDDVNGVTLASASSMDKGFE-----G  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVGE+IAK+  +KGIS+V FDRGGY YHGR++++A+ ARENGL+F
Sbjct  66   NGGNVEGARKVGEMIAKNAADKGISEVVFDRGGYLYHGRVQSLAEGARENGLKF  119



>ref|WP_029196452.1| 50S ribosomal protein L18 [Paenibacillus alginolyticus]
Length=122

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT  RPRL++FRS+KH+Y Q+IDDT   T+ A ST  K +  E    
Sbjct  11   RLKRHLRVRKKIEGTTVRPRLNIFRSSKHMYAQLIDDTTGVTIVAASTQDKELKSEI--G  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVG +IA+   EKG+ KV FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   NGGNVEAARKVGALIAQRAKEKGLDKVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_028881012.1| 50S ribosomal protein L18 [Synergistetes bacterium JGI 0000079-D21]
Length=122

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            R+R E R+ RH R+R+K+ GT E PRLSVFRS KH+Y QVIDD K  TL AVST +KA++
Sbjct  5    RSRNEMRLIRHQRLRQKLSGTAETPRLSVFRSLKHIYAQVIDDEKGTTLVAVSTREKAVA  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            E+   +    +E A+ VG+++A+  LEKGI  V FDRGG+ YHGR++A+AD+ARE GL+F
Sbjct  65   EQLKGTG--NVEAAKFVGKLVAERALEKGIQAVVFDRGGHMYHGRVKALADSAREAGLKF  122



>ref|WP_028552001.1| 50S ribosomal protein L18 [Paenibacillus sp. UNC451MF]
Length=122

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+RKK+EGT ERPRL++FRS+KH+Y Q+IDD K  T+AA ST  K + E     
Sbjct  11   RLKRHLRVRKKIEGTTERPRLNIFRSSKHMYAQLIDDVKGVTIAAASTQDKELKESI--G  68

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  +E ARKVG +IA+   + G+ +V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  69   NGGNVEAARKVGALIAERAKKNGVQQVVFDRGGYLYHGRVQALADAAREAGLEF  122



>ref|WP_039043306.1| 50S ribosomal protein L18 [Sporosarcina sp. ZBG7A]
Length=120

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 88/124 (71%), Gaps = 8/124 (6%)
 Frame = +3

Query  192  QAESRTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQ  371
            Q ++ TRR+    RH+R+R K+ GT ERPRL+V+RSNKH+Y Q+IDD    TLA+ STM 
Sbjct  5    QDKNATRRK----RHARVRTKINGTAERPRLNVYRSNKHIYAQLIDDANGVTLASASTMD  60

Query  372  KAISEEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAAREN  551
            K    EF+  S    + A KVGE+IAK   EK +  V FDRGGY YHGR++A+ADAAREN
Sbjct  61   K----EFSTDSSSNADAAVKVGEMIAKKGAEKNVKVVVFDRGGYLYHGRVKALADAAREN  116

Query  552  GLQF  563
            GL+F
Sbjct  117  GLEF  120



>ref|WP_039764309.1| MULTISPECIES: 50S ribosomal protein L18 [Caldicellulosiruptor]
Length=122

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R+ RH RIRKKV GT ERPRL V++S K++Y Q+IDD K HTL A S+++  I  
Sbjct  6    NRNEKRLIRHKRIRKKVFGTAERPRLCVYKSLKYIYAQIIDDEKGHTLVAASSLEPEIKS  65

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +S  +IE A+ +G VIA+   EKGI+KV FDRGGYPYHGR++A+ADAARE GL+F
Sbjct  66   RL--TSTKSIEAAQYIGRVIAERAKEKGITKVVFDRGGYPYHGRVKALADAAREAGLEF  122



>sp|A4XLR4.2|RL18_CALS8 RecName: Full=50S ribosomal protein L18 [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 gb|ABP67849.2| ribosomal protein L18 [Caldicellulosiruptor saccharolyticus DSM 
8903]
Length=124

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +3

Query  207  TRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISE  386
             R E R+ RH RIRKKV GT ERPRL V++S K++Y Q+IDD K HTL A S+++  I  
Sbjct  8    NRNEKRLIRHKRIRKKVFGTAERPRLCVYKSLKYIYAQIIDDEKGHTLVAASSLEPEIKS  67

Query  387  EFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +S  +IE A+ +G VIA+   EKGI+KV FDRGGYPYHGR++A+ADAARE GL+F
Sbjct  68   RL--TSTKSIEAAQYIGRVIAERAKEKGITKVVFDRGGYPYHGRVKALADAAREAGLEF  124



>ref|WP_031471907.1| 50S ribosomal protein L18 [[Clostridium] aminophilum]
Length=122

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  RTRREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAIS  383
            ++R E RI +H+R+R +  GT +RPRL+VFRSN H+Y Q+IDD K  TLAA ST++K + 
Sbjct  5    KSRSEVRIKKHARLRNRFSGTAQRPRLAVFRSNDHMYAQIIDDEKQVTLAAASTVEKDVK  64

Query  384  EEFNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
             E   ++   +E A  VG +IAK  LEKGI +V FDRGGY YHG+++A+ADAARE GL+F
Sbjct  65   AELTKTN--NVEAASYVGTLIAKRALEKGIEEVVFDRGGYIYHGKVQALADAAREAGLKF  122



>ref|WP_025640188.1| 50S ribosomal protein L18 [Clostridium ultunense]
Length=122

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            R E R  RH R+R+KV GTPERPRL+V+RSN H+Y QVIDD + HTL + ST+ K + E+
Sbjct  7    RNEMRKKRHIRVRQKVYGTPERPRLNVYRSNSHIYAQVIDDVEGHTLVSASTLDKELKEK  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
               SS    E A+ VGE++ K  LEKGI KV FDRGGY YHGRI+ +A+ ARE GL+F
Sbjct  67   L--SSTHNKEAAKLVGELVGKRALEKGIDKVVFDRGGYIYHGRIKELAEGAREAGLKF  122



>ref|WP_028988526.1| 50S ribosomal protein L18 [Thermicanus aegyptius]
Length=122

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +3

Query  210  RREDRIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEE  389
            + ++R  RH RIR+K+ GT ERPRL+VFRSNKH+Y Q+IDD    TL + ST+   +  E
Sbjct  7    KNKERKVRHLRIRRKLHGTHERPRLNVFRSNKHIYAQLIDDQAGVTLVSASTLDPELKGE  66

Query  390  FNYSSGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
                +G  IE A KVG +IAK  LEKG ++V FDRGGYPYHGR++A+AD+ARE GLQF
Sbjct  67   I--ENGGNIEAAEKVGALIAKRALEKGFTQVVFDRGGYPYHGRVKALADSAREAGLQF  122



>ref|WP_031563410.1| 50S ribosomal protein L18 [Ruminococcus flavefaciens]
Length=119

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH R+R K+ GT ERPRL+VFRS KH+Y Q+IDD    TLA+ S+M K         
Sbjct  11   RLKRHRRVRAKISGTAERPRLNVFRSTKHIYAQLIDDVNGVTLASASSMDKGFE-----G  65

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            +G  ++ ARKVGE+IAK+  +KGIS+V FDRGGY YHGR++A+A+ ARENGL+F
Sbjct  66   NGGNVDGARKVGELIAKNAADKGISEVVFDRGGYLYHGRVQALAEGARENGLKF  119



>ref|WP_014112347.1| 50S ribosomal protein L18 [Bacillus subtilis]
 gb|AEP84905.1| ribosomal protein L18 [Bacillus subtilis subsp. spizizenii TU-B-10]
Length=120

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = +3

Query  222  RIARHSRIRKKVEGTPERPRLSVFRSNKHLYVQVIDDTKMHTLAAVSTMQKAISEEFNYS  401
            R+ RH+R+R K+ GT ERPRL+VFRSNKH+Y Q+IDD    TLA+ ST+ K    + N  
Sbjct  11   RLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDK----DLNVE  66

Query  402  SGPTIEVARKVGEVIAKSCLEKGISKVAFDRGGYPYHGRIEAIADAARENGLQF  563
            S      A KVGE++AK   EKGIS V FDRGGY YHGR++A+ADAARE GL+F
Sbjct  67   STGDSSAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140