BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4303

Length=953
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF17669.1|  putative pyruvate dehydrogenase E1 alpha subunit        198   2e-71   Capsicum annuum
ref|XP_011101308.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    199   2e-71   Sesamum indicum [beniseed]
gb|KJB51242.1|  hypothetical protein B456_008G208500                    196   4e-71   Gossypium raimondii
ref|XP_004494869.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    197   5e-71   Cicer arietinum [garbanzo]
emb|CDP08620.1|  unnamed protein product                                196   6e-71   Coffea canephora [robusta coffee]
ref|XP_006353739.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    196   8e-71   Solanum tuberosum [potatoes]
ref|XP_009793937.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    195   9e-71   Nicotiana sylvestris
gb|KJB49639.1|  hypothetical protein B456_008G130900                    193   1e-70   Gossypium raimondii
ref|XP_002515074.1|  pyruvate dehydrogenase, putative                   194   2e-70   Ricinus communis
ref|XP_009590458.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    194   2e-70   Nicotiana tomentosiformis
ref|XP_002301442.2|  hypothetical protein POPTR_0002s18020g             193   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004251713.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    196   3e-70   Solanum lycopersicum
ref|XP_006345233.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    196   3e-70   Solanum tuberosum [potatoes]
ref|XP_007051428.1|  Pyruvate dehydrogenase E1 alpha, ALPHA             192   4e-70   
ref|XP_004251714.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    196   5e-70   Solanum lycopersicum
gb|EYU17698.1|  hypothetical protein MIMGU_mgv1a006615mg                193   7e-70   Erythranthe guttata [common monkey flower]
ref|XP_008233047.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    191   8e-70   Prunus mume [ume]
ref|XP_007218034.1|  hypothetical protein PRUPE_ppa006008mg             191   8e-70   Prunus persica
gb|KJB41627.1|  hypothetical protein B456_007G112900                    192   9e-70   Gossypium raimondii
ref|XP_006858882.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    192   9e-70   Amborella trichopoda
ref|XP_011025370.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    191   1e-69   Populus euphratica
gb|KHG16317.1|  Pyruvate dehydrogenase E1 component subunit alpha       191   2e-69   Gossypium arboreum [tree cotton]
ref|XP_004306615.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    192   2e-69   Fragaria vesca subsp. vesca
gb|KEH18570.1|  pyruvate dehydrogenase E1 component, alpha subunit      194   2e-69   Medicago truncatula
ref|XP_009622532.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    193   2e-69   Nicotiana tomentosiformis
ref|XP_002267676.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    194   3e-69   Vitis vinifera
gb|KJB41628.1|  hypothetical protein B456_007G112900                    192   3e-69   Gossypium raimondii
ref|XP_010107149.1|  Pyruvate dehydrogenase E1 component subunit ...    191   4e-69   Morus notabilis
ref|XP_009366597.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_009793746.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    192   6e-69   Nicotiana sylvestris
ref|XP_007139015.1|  hypothetical protein PHAVU_009G257800g             190   1e-68   Phaseolus vulgaris [French bean]
ref|NP_171617.1|  pyruvate dehydrogenase E1 alpha subunit               190   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15879.1|  Pyruvate dehydrogenase E1 component subunit alpha       187   2e-68   Glycine soja [wild soybean]
ref|XP_008376219.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    189   2e-68   
ref|XP_008459830.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    187   2e-68   Cucumis melo [Oriental melon]
ref|XP_010056030.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   2e-68   Eucalyptus grandis [rose gum]
ref|XP_007135321.1|  hypothetical protein PHAVU_010G119600g             186   2e-68   Phaseolus vulgaris [French bean]
ref|XP_010666479.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    186   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002889385.1|  PDH-E1 alpha                                       189   3e-68   
ref|XP_003520883.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    189   4e-68   Glycine max [soybeans]
gb|AFK44557.1|  unknown                                                 190   4e-68   Medicago truncatula
ref|XP_004140530.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    186   5e-68   Cucumis sativus [cucumbers]
ref|XP_008347189.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   5e-68   
ref|XP_004514921.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    189   5e-68   
ref|XP_010480668.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006307579.1|  hypothetical protein CARUB_v10009201mg             188   6e-68   Capsella rubella
ref|XP_010457174.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010474696.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003554784.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    187   9e-68   Glycine max [soybeans]
gb|KFK42500.1|  hypothetical protein AALP_AA1G001500                    187   1e-67   Arabis alpina [alpine rockcress]
emb|CDY37473.1|  BnaC08g46110D                                          186   1e-67   Brassica napus [oilseed rape]
ref|XP_009119669.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    187   1e-67   Brassica rapa
emb|CDX90009.1|  BnaA10g00730D                                          187   2e-67   
ref|XP_009118790.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    187   2e-67   Brassica rapa
ref|XP_012083102.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    188   2e-67   Jatropha curcas
ref|XP_006418380.1|  hypothetical protein EUTSA_v10007695mg             187   2e-67   Eutrema salsugineum [saltwater cress]
emb|CDY15202.1|  BnaC05g00810D                                          187   2e-67   Brassica napus [oilseed rape]
dbj|BAQ95526.1|  pyruvate dehydrogenase                                 191   2e-67   Gentiana triflora
gb|KHN06367.1|  Pyruvate dehydrogenase E1 component subunit alpha       188   3e-67   Glycine soja [wild soybean]
ref|XP_010522887.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    185   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_009401925.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    185   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN11375.1|  Pyruvate dehydrogenase E1 component subunit alpha       184   9e-67   Glycine soja [wild soybean]
ref|XP_010056032.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    182   1e-66   Eucalyptus grandis [rose gum]
ref|XP_003580308.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    183   2e-66   Brachypodium distachyon [annual false brome]
gb|ABR18203.1|  unknown                                                 185   2e-66   Picea sitchensis
ref|XP_006491368.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    184   3e-66   Citrus sinensis [apfelsine]
dbj|BAJ95313.1|  predicted protein                                      183   3e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010251507.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    182   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_006491369.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    184   4e-66   Citrus sinensis [apfelsine]
ref|XP_006653118.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    182   5e-66   
gb|EMT15607.1|  Pyruvate dehydrogenase E1 component subunit alpha       182   6e-66   
ref|XP_006444730.1|  hypothetical protein CICLE_v10020210mg             183   6e-66   Citrus clementina [clementine]
gb|EAY92846.1|  hypothetical protein OsI_14647                          182   6e-66   Oryza sativa Indica Group [Indian rice]
emb|CAH65949.1|  H0716A07.7                                             182   8e-66   Oryza sativa [red rice]
ref|XP_006444729.1|  hypothetical protein CICLE_v10020210mg             183   8e-66   
ref|XP_002446057.1|  hypothetical protein SORBIDRAFT_06g001120          183   8e-66   Sorghum bicolor [broomcorn]
ref|NP_001052065.1|  Os04g0119400                                       182   8e-66   
ref|XP_001775995.1|  predicted protein                                  190   1e-65   
gb|KDO86617.1|  hypothetical protein CISIN_1g013928mg                   183   1e-65   Citrus sinensis [apfelsine]
ref|XP_004981196.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    181   1e-65   Setaria italica
ref|XP_008667490.1|  PREDICTED: uncharacterized protein LOC100272...    181   2e-65   Zea mays [maize]
ref|XP_009384635.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    181   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001140759.1|  uncharacterized protein LOC100272834               180   3e-65   Zea mays [maize]
ref|XP_010556630.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    180   4e-65   Tarenaya hassleriana [spider flower]
ref|XP_001782068.1|  predicted protein                                  187   8e-65   
emb|CCW28725.1|  putative transketolase                                 182   1e-64   Arachis duranensis
ref|XP_010940832.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate deh...    179   5e-64   Elaeis guineensis
ref|XP_008777457.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    179   6e-64   Phoenix dactylifera
ref|XP_002968875.1|  hypothetical protein SELMODRAFT_227859             178   2e-63   
ref|XP_002974096.1|  hypothetical protein SELMODRAFT_149464             177   4e-63   Selaginella moellendorffii
emb|CDY37428.1|  BnaC08g45660D                                          182   1e-61   Brassica napus [oilseed rape]
gb|AAF26472.1|AC007323_13  T25K16.8                                     163   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KIY99248.1|  pyruvate dehydrogenase E1 component subunit alpha       145   4e-54   Monoraphidium neglectum
ref|XP_005845662.1|  hypothetical protein CHLNCDRAFT_32109              150   6e-54   Chlorella variabilis
ref|XP_002950542.1|  hypothetical protein VOLCADRAFT_104783             143   7e-52   Volvox carteri f. nagariensis
gb|EMS48424.1|  Pyruvate dehydrogenase E1 component subunit alpha       157   6e-50   Triticum urartu
ref|XP_011399872.1|  Pyruvate dehydrogenase E1 component subunit ...    133   1e-48   Auxenochlorella protothecoides
gb|KJB49643.1|  hypothetical protein B456_008G131200                    167   3e-47   Gossypium raimondii
ref|XP_005643628.1|  hypothetical protein COCSUDRAFT_31344              145   7e-46   Coccomyxa subellipsoidea C-169
gb|KDD73866.1|  dehydrogenase E1                                        124   1e-44   Helicosporidium sp. ATCC 50920
ref|XP_008245109.1|  PREDICTED: pyruvate dehydrogenase E1 compone...    141   3e-40   Prunus mume [ume]
gb|AFB33324.1|  hypothetical protein 2_3307_01                          144   6e-39   Pinus mugo [mountain pine]
gb|AEW08220.1|  hypothetical protein 2_3307_01                          142   3e-38   Pinus radiata
gb|KHG08766.1|  Pyruvate dehydrogenase E1 component subunit alpha       100   1e-37   Gossypium arboreum [tree cotton]
ref|WP_015219261.1|  pyruvate dehydrogenase (acetyl-transferring)...    102   2e-33   Cyanobacterium aponinum
ref|WP_014276531.1|  pyruvate dehydrogenase E1 subunit alpha          85.1    3e-32   Arthrospira platensis
ref|WP_006623993.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  84.0    5e-32   Arthrospira
ref|WP_009555730.1|  pyruvate dehydrogenase E1 component, alpha s...  89.0    5e-32   Oscillatoriales cyanobacterium JSC-12
ref|WP_013191125.1|  pyruvate dehydrogenase E1 subunit alpha          93.2    8e-32   Trichormus azollae
ref|WP_011244460.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  84.0    8e-32   Synechococcus
ref|WP_016951883.1|  pyruvate dehydrogenase E1 subunit alpha          92.0    2e-31   Anabaena sp. PCC 7108
ref|WP_012305987.1|  pyruvate dehydrogenase E1 subunit alpha          90.9    3e-31   Synechococcus
ref|WP_036001760.1|  pyruvate dehydrogenase                           83.6    4e-31   [Leptolyngbya] sp. JSC-1
ref|WP_015144713.1|  pyruvate dehydrogenase E1 component subunit ...  88.2    6e-31   Pleurocapsa minor
ref|WP_045056773.1|  pyruvate dehydrogenase                           92.0    7e-31   Aliterella atlantica
ref|WP_015785134.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  89.4    8e-31   Cyanothece
ref|WP_008180311.1|  pyruvate dehydrogenase E1 subunit alpha          89.0    8e-31   Moorea producens
ref|WP_012161918.1|  pyruvate dehydrogenase E1 subunit alpha          88.2    1e-30   Acaryochloris marina
ref|WP_015132096.1|  pyruvate dehydrogenase (acetyl-transferring)...  90.1    1e-30   Calothrix sp. PCC 7507
ref|WP_024544584.1|  pyruvate dehydrogenase                           88.2    2e-30   Synechococcus sp. NKBG15041c
ref|WP_015213298.1|  pyruvate dehydrogenase (acetyl-transferring)...  89.0    2e-30   Anabaena cylindrica
ref|WP_015172813.1|  pyruvate dehydrogenase (acetyl-transferring)...  84.3    2e-30   Geitlerinema sp. PCC 7407
ref|WP_006102809.1|  pyruvate dehydrogenase E1 subunit alpha          86.7    2e-30   Coleofasciculus chthonoplastes
ref|WP_015201162.1|  pyruvate dehydrogenase (acetyl-transferring)...  89.7    3e-30   Crinalium epipsammum
ref|WP_028090740.1|  pyruvate dehydrogenase                           88.6    3e-30   Dolichospermum circinale
ref|WP_017285746.1|  pyruvate dehydrogenase E1 subunit alpha          84.7    3e-30   Leptolyngbya boryana
ref|WP_008309458.1|  pyruvate dehydrogenase E1 component, alpha s...  82.4    4e-30   Leptolyngbya sp. PCC 6406
ref|WP_015116622.1|  pyruvate dehydrogenase E1 component subunit ...  83.6    4e-30   Rivularia sp. PCC 7116
ref|WP_012597993.1|  pyruvate dehydrogenase E1 subunit alpha          87.8    5e-30   Cyanothece sp. PCC 7424
ref|WP_028083643.1|  pyruvate dehydrogenase                           87.4    5e-30   Dolichospermum circinale
ref|WP_015083169.1|  pyruvate dehydrogenase E1 component subunit ...  87.4    5e-30   Anabaena sp. 90
dbj|BAQ64837.1|  pyruvate dehydrogenase E1 component alpha subunit    93.2    5e-30   Geminocystis sp. NIES-3709
ref|WP_017293986.1|  pyruvate dehydrogenase E1 subunit alpha          90.9    6e-30   Geminocystis herdmanii
ref|WP_039199282.1|  pyruvate dehydrogenase                           87.0    6e-30   Aphanizomenon flos-aquae
ref|WP_017306355.1|  pyruvate dehydrogenase E1 subunit alpha          86.3    7e-30   Spirulina subsalsa
ref|WP_030006129.1|  pyruvate dehydrogenase                           86.3    7e-30   Synechococcus
ref|WP_012411829.1|  pyruvate dehydrogenase E1 subunit alpha          86.7    7e-30   Nostoc punctiforme
ref|WP_015195309.1|  pyruvate dehydrogenase (acetyl-transferring)...  89.0    8e-30   Stanieria cyanosphaera
ref|WP_006276818.1|  pyruvate dehydrogenase E1 subunit alpha          86.7    9e-30   Cylindrospermopsis raciborskii
ref|WP_013321798.1|  pyruvate dehydrogenase E1 subunit alpha          85.5    9e-30   Cyanothece sp. PCC 7822
ref|WP_015221634.1|  pyruvate dehydrogenase (acetyl-transferring)...  88.6    9e-30   
ref|WP_025924769.1|  pyruvate dehydrogenase                           89.0    1e-29   
ref|WP_009343327.1|  pyruvate dehydrogenase E1 subunit alpha          86.3    1e-29   Aphanizomenonaceae
ref|WP_026103513.1|  pyruvate dehydrogenase                           80.9    1e-29   Pseudanabaena sp. PCC 6802
ref|WP_015147267.1|  pyruvate dehydrogenase E1 component subunit ...  89.0    1e-29   Oscillatoria acuminata
ref|WP_009787238.1|  pyruvate dehydrogenase E1 subunit alpha          82.0    2e-29   Lyngbya sp. PCC 8106
ref|WP_027404647.1|  pyruvate dehydrogenase                           87.0    2e-29   Aphanizomenon flos-aquae
ref|WP_006197352.1|  pyruvate dehydrogenase E1 subunit alpha          85.9    3e-29   Nodularia spumigena
ref|WP_023064139.1|  pyruvate dehydrogenase (acetyl-transferring)...  82.0    3e-29   Lyngbya aestuarii
ref|WP_015169202.1|  pyruvate dehydrogenase E1 component subunit ...  80.5    3e-29   Synechococcus sp. PCC 7502
ref|WP_017653143.1|  pyruvate dehydrogenase E1 subunit alpha          86.3    3e-29   Fortiea contorta
ref|WP_015111181.1|  pyruvate dehydrogenase (acetyl-transferring)...  87.4    3e-29   Nostoc sp. PCC 7107
ref|WP_006454326.1|  pyruvate dehydrogenase E1 subunit alpha          85.9    3e-29   Synechococcus sp. PCC 7335
ref|WP_041035191.1|  pyruvate dehydrogenase                           85.9    3e-29   Tolypothrix campylonemoides
ref|WP_015188060.1|  pyruvate dehydrogenase (acetyl-transferring)...  82.4    3e-29   Gloeocapsa sp. PCC 7428
ref|WP_015124179.1|  pyruvate dehydrogenase E1 component subunit ...  85.1    4e-29   Synechococcus sp. PCC 6312
ref|WP_010996861.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  85.5    4e-29   Nostocaceae
ref|WP_015205680.1|  pyruvate dehydrogenase E1 component, alpha s...  84.0    6e-29   Cylindrospermum stagnale
ref|WP_045874564.1|  pyruvate dehydrogenase                           84.0    7e-29   Nostocales
ref|NP_053877.1|  pyruvate dehydrogenase E1 component alpha subunit   82.4    7e-29   Porphyra purpurea
ref|WP_039728256.1|  MULTISPECIES: pyruvate dehydrogenase             80.5    8e-29   Lyngbya confervoides
ref|YP_009027551.1|  pyruvate dehydrogenase E1 component, alpha s...  82.8    9e-29   Pyropia perforata
gb|KIJ81314.1|  pyruvate dehydrogenase                                85.1    1e-28   Scytonema tolypothrichoides VB-61278
ref|WP_017316476.1|  pyruvate dehydrogenase E1 subunit alpha          85.5    1e-28   Mastigocladopsis repens
gb|AFC39936.1|  pyruvate dehydrogenase E1 component alpha subunit     80.9    1e-28   Porphyra umbilicalis
ref|WP_011614263.1|  pyruvate dehydrogenase E1 subunit alpha          83.6    2e-28   Trichodesmium erythraeum
ref|WP_040055045.1|  pyruvate dehydrogenase                           82.8    2e-28   
ref|WP_012626468.1|  pyruvate dehydrogenase E1 subunit alpha          84.3    2e-28   Cyanothece sp. PCC 7425
ref|WP_008231351.1|  Pyruvate dehydrogenase E1 component alpha su...  85.5    2e-28   Richelia intracellularis
dbj|BAQ62043.1|  pyruvate dehydrogenase E1 component alpha subunit    85.1    2e-28   Geminocystis sp. NIES-3708
ref|WP_009631809.1|  pyruvate dehydrogenase E1 component, alpha s...  84.7    2e-28   Synechocystis sp. PCC 7509
gb|AIA21296.1|  pyruvate dehydrogenase E1 component alpha subunit     82.0    2e-28   Pyropia kanakaensis
ref|WP_015182305.1|  pyruvate dehydrogenase E1 component subunit ...  78.2    3e-28   Microcoleus sp. PCC 7113
ref|WP_016868968.1|  pyruvate dehydrogenase E1 subunit alpha          84.0    3e-28   Fischerella muscicola
ref|WP_007355519.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  78.6    3e-28   Kamptonema
ref|WP_015135286.1|  pyruvate dehydrogenase (acetyl-transferring)...  82.0    4e-28   Leptolyngbya sp. PCC 7376
ref|WP_009756662.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  84.0    4e-28   Fischerella thermalis
ref|WP_016873792.1|  pyruvate dehydrogenase E1 subunit alpha          83.6    4e-28   Chlorogloeopsis fritschii
ref|YP_007947796.1|  pyruvate dehydrogenase E1 component alpha su...  82.0    4e-28   Pyropia haitanensis
ref|WP_029985298.1|  pyruvate dehydrogenase                           85.1    4e-28   
ref|WP_015199024.1|  pyruvate dehydrogenase (acetyl-transferring)...  85.1    4e-28   Calothrix parietina
ref|WP_035153086.1|  pyruvate dehydrogenase                           84.7    5e-28   Calothrix sp. 336/3
ref|XP_006837866.2|  PREDICTED: pyruvate dehydrogenase E1 compone...  93.6    5e-28   
ref|YP_536948.1|  pyruvate dehydrogenase E1 component alpha subunit   80.5    5e-28   Pyropia yezoensis
ref|WP_029981554.1|  pyruvate dehydrogenase                           83.6    5e-28   
ref|WP_025973497.1|  pyruvate dehydrogenase                           84.7    6e-28   
emb|CDJ27426.1|  pyruvate dehydrogenase, putative                     82.0    6e-28   Eimeria mitis
ref|WP_040898162.1|  pyruvate dehydrogenase                           83.2    6e-28   Xenococcus sp. PCC 7305
ref|WP_025957935.1|  pyruvate dehydrogenase                           84.3    6e-28   
gb|ELS02452.1|  pyruvate dehydrogenase E1 component, alpha subunit    83.2    6e-28   Xenococcus sp. PCC 7305
ref|WP_009546784.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  80.9    6e-28   Cyanothece
ref|WP_025939676.1|  pyruvate dehydrogenase                           84.3    7e-28   
ref|WP_017662830.1|  pyruvate dehydrogenase E1 subunit alpha          84.0    8e-28   Geitlerinema sp. PCC 7105
ref|WP_037216252.1|  pyruvate dehydrogenase                           81.3    8e-28   
ref|WP_032518250.1|  pyruvate dehydrogenase                           84.0    8e-28   Prochlorococcus marinus
ref|WP_016860018.1|  pyruvate dehydrogenase E1 subunit alpha          83.2    8e-28   Fischerella muscicola
ref|XP_003626604.1|  Pyruvate dehydrogenase E1 component subunit ...  98.2    8e-28   
gb|AIA21502.1|  pyruvate dehydrogenase E1 component alpha subunit     79.3    9e-28   Pyropia fucicola
ref|WP_011142838.1|  pyruvate dehydrogenase E1 subunit alpha          77.4    9e-28   Gloeobacter violaceus
ref|WP_026732160.1|  pyruvate dehydrogenase                           82.4    9e-28   Fischerella sp. PCC 9605
ref|WP_027847037.1|  pyruvate dehydrogenase                           82.4    1e-27   Mastigocoleus testarum
ref|WP_025972417.1|  pyruvate dehydrogenase                           83.2    1e-27   
gb|KGG00227.1|  Pyruvate dehydrogenase E1 component alpha subunit     84.0    1e-27   Prochlorococcus marinus str. MIT 9314
ref|WP_009626838.1|  pyruvate dehydrogenase (acetyl-transferring)...  78.2    1e-27   Pseudanabaena
ref|WP_025937490.1|  pyruvate dehydrogenase                           83.2    1e-27   
ref|WP_032516396.1|  pyruvate dehydrogenase                           83.6    1e-27   Prochlorococcus marinus
ref|WP_011863403.1|  pyruvate dehydrogenase E1 subunit alpha          83.6    1e-27   Prochlorococcus marinus
ref|WP_026720629.1|  pyruvate dehydrogenase                           82.0    1e-27   Fischerella sp. PCC 9431
ref|WP_035985435.1|  pyruvate dehydrogenase                           79.7    1e-27   Leptolyngbya sp. KIOST-1
ref|WP_029975736.1|  pyruvate dehydrogenase                           84.0    1e-27   
ref|WP_015163657.1|  pyruvate dehydrogenase (acetyl-transferring)...  77.4    1e-27   Pseudanabaena sp. PCC 7367
ref|WP_025933867.1|  pyruvate dehydrogenase                           82.8    1e-27   
ref|WP_029972030.1|  pyruvate dehydrogenase                           83.6    1e-27   
ref|WP_025965833.1|  pyruvate dehydrogenase                           82.0    1e-27   
ref|WP_017301098.1|  pyruvate dehydrogenase E1 subunit alpha          78.6    1e-27   Nodosilinea nodulosa
gb|KGG09007.1|  Pyruvate dehydrogenase E1 component alpha subunit     83.6    1e-27   Prochlorococcus marinus str. SB
ref|WP_025975942.1|  pyruvate dehydrogenase                           83.6    1e-27   
ref|WP_032520254.1|  pyruvate dehydrogenase                           83.6    1e-27   Prochlorococcus marinus
ref|WP_023173177.1|  pyruvate dehydrogenase E1 component, alpha s...  78.2    1e-27   Gloeobacter kilaueensis
emb|CDJ40271.1|  pyruvate dehydrogenase, putative                     81.3    2e-27   Eimeria tenella
ref|WP_025963883.1|  pyruvate dehydrogenase                           83.2    2e-27   
ref|WP_025894873.1|  pyruvate dehydrogenase                           83.2    2e-27   
ref|WP_029984869.1|  pyruvate dehydrogenase                           83.6    2e-27   
gb|AIQ95599.1|  Pyruvate dehydrogenase E1 component alpha subunit     84.0    2e-27   Prochlorococcus sp. MIT 0604
ref|WP_042850841.1|  pyruvate dehydrogenase                           84.0    2e-27   Prochlorococcus sp. MIT 0604
ref|WP_025900779.1|  MULTISPECIES: pyruvate dehydrogenase             83.2    2e-27   
ref|WP_025882077.1|  MULTISPECIES: pyruvate dehydrogenase             83.2    2e-27   
ref|WP_015178608.1|  pyruvate dehydrogenase (acetyl-transferring)...  75.9    2e-27   Oscillatoria nigro-viridis
ref|YP_008144878.1|  pyruvate dehydrogenase E1 component subunit ...  77.4    2e-27   Grateloupia taiwanensis
ref|WP_017312723.1|  pyruvate dehydrogenase E1 subunit alpha          81.3    2e-27   Fischerella sp. PCC 9339
ref|WP_025961427.1|  pyruvate dehydrogenase                           82.4    2e-27   
emb|CDJ70250.1|  pyruvate dehydrogenase, putative                     80.5    2e-27   Eimeria necatrix
ref|WP_025928734.1|  pyruvate dehydrogenase                           82.4    2e-27   
ref|WP_025969423.1|  pyruvate dehydrogenase                           82.4    2e-27   
ref|WP_025913752.1|  MULTISPECIES: pyruvate dehydrogenase             81.6    3e-27   Prochlorococcus
ref|WP_015160492.1|  pyruvate dehydrogenase E1 component, alpha s...  79.3    3e-27   Chamaesiphon minutus
ref|WP_011141528.1|  pyruvate dehydrogenase E1 subunit alpha          75.1    3e-27   Gloeobacter violaceus
ref|WP_029977208.1|  pyruvate dehydrogenase                           82.0    3e-27   
ref|WP_028948828.1|  pyruvate dehydrogenase                           83.6    3e-27   Synechocystis sp. PCC 6714
ref|WP_025922531.1|  pyruvate dehydrogenase                           82.0    4e-27   
ref|WP_029960454.1|  MULTISPECIES: pyruvate dehydrogenase             82.0    4e-27   
ref|WP_025889000.1|  pyruvate dehydrogenase                           80.1    4e-27   
ref|WP_026786093.1|  MULTISPECIES: pyruvate dehydrogenase             85.1    4e-27   Planktothrix
ref|WP_011818906.1|  pyruvate dehydrogenase E1 subunit alpha          81.6    4e-27   Prochlorococcus marinus
ref|WP_019489774.1|  pyruvate dehydrogenase E1 subunit alpha          83.2    4e-27   Calothrix sp. PCC 7103
ref|WP_029976517.1|  pyruvate dehydrogenase                           82.0    4e-27   
ref|WP_026794738.1|  MULTISPECIES: pyruvate dehydrogenase             84.7    5e-27   Planktothrix
ref|WP_042155681.1|  pyruvate dehydrogenase                           84.7    5e-27   Planktothrix agardhii
ref|WP_007307445.1|  pyruvate dehydrogenase E1 subunit alpha          79.3    5e-27   Crocosphaera watsonii
emb|CCQ68831.1|  Pyruvate dehydrogenase E1 component alpha subunit    79.3    5e-27   Crocosphaera watsonii WH 0402
ref|WP_010315614.1|  pyruvate dehydrogenase E1 subunit alpha          80.1    5e-27   Synechococcus sp. CB0205
ref|WP_025935351.1|  pyruvate dehydrogenase                           81.3    5e-27   
ref|WP_010873216.1|  pyruvate dehydrogenase E1 subunit alpha          84.3    6e-27   Synechocystis
ref|WP_032527218.1|  pyruvate dehydrogenase                           82.8    6e-27   Prochlorococcus marinus
ref|YP_009019636.1|  pyruvate dehydrogenase E1 component alpha su...  76.6    6e-27   Gracilaria salicornia
ref|WP_015228871.1|  pyruvate dehydrogenase E1 component subunit ...  80.9    6e-27   Dactylococcopsis salina
ref|WP_025975544.1|  pyruvate dehydrogenase                           80.9    7e-27   
ref|WP_006515269.1|  pyruvate dehydrogenase E1 component, alpha s...  86.3    7e-27   Leptolyngbya sp. PCC 7375
ref|WP_006634162.1|  pyruvate dehydrogenase E1 subunit alpha          75.5    7e-27   Microcoleus vaginatus
ref|WP_025957368.1|  MULTISPECIES: pyruvate dehydrogenase             80.5    8e-27   
ref|WP_038653884.1|  pyruvate dehydrogenase                           78.2    9e-27   Prochlorococcus sp. MIT 0801
ref|WP_025946958.1|  MULTISPECIES: pyruvate dehydrogenase             80.5    9e-27   
ref|WP_025925522.1|  MULTISPECIES: pyruvate dehydrogenase             80.5    9e-27   
ref|WP_025956922.1|  pyruvate dehydrogenase                           80.5    9e-27   
gb|KGF96626.1|  Pyruvate dehydrogenase E1 component alpha subunit     79.3    1e-26   Prochlorococcus marinus str. MIT 9201
ref|WP_025979027.1|  hypothetical protein                             80.5    1e-26   
ref|WP_032521686.1|  pyruvate dehydrogenase                           79.3    1e-26   Prochlorococcus marinus
gb|KGG01314.1|  Pyruvate dehydrogenase E1 component alpha subunit     80.5    1e-26   Prochlorococcus marinus str. MIT 9311
ref|WP_011376930.1|  pyruvate dehydrogenase E1 subunit alpha          80.1    1e-26   Prochlorococcus marinus
ref|WP_002805940.1|  pyruvate dehydrogenase E1 subunit alpha          80.1    1e-26   Prochlorococcus marinus
gb|AJO68462.1|  pyruvate dehydrogenase E1 component alpha ubunit      74.3    1e-26   Gracilariopsis lemaneiformis
ref|YP_009122071.1|  pyruvate dehydrogenase E1 component subunit ...  75.9    1e-26   Choreocolax polysiphoniae
ref|WP_025974065.1|  pyruvate dehydrogenase                           80.1    1e-26   
ref|WP_025974715.1|  hypothetical protein                             80.5    1e-26   
ref|WP_025920841.1|  pyruvate dehydrogenase                           80.1    1e-26   
ref|WP_025964429.1|  pyruvate dehydrogenase                           80.1    1e-26   
ref|WP_012008176.1|  pyruvate dehydrogenase E1 subunit alpha          80.5    1e-26   Prochlorococcus marinus
ref|WP_025944154.1|  MULTISPECIES: pyruvate dehydrogenase             80.1    1e-26   
ref|WP_025961979.1|  pyruvate dehydrogenase                           79.7    1e-26   
ref|WP_025975106.1|  pyruvate dehydrogenase                           79.7    2e-26   
emb|CDI76381.1|  pyruvate dehydrogenase, putative                     77.8    2e-26   
gb|KGF85353.1|  Pyruvate dehydrogenase E1 component alpha subunit     81.3    2e-26   
ref|WP_012954145.1|  pyruvate dehydrogenase E1 subunit alpha          77.0    2e-26   
ref|WP_032524876.1|  pyruvate dehydrogenase                           80.9    2e-26   
ref|WP_008272481.1|  pyruvate dehydrogenase E1 subunit alpha          77.0    2e-26   
ref|WP_010310573.1|  pyruvate dehydrogenase E1 subunit alpha          78.2    2e-26   
ref|WP_025934505.1|  MULTISPECIES: pyruvate dehydrogenase             79.3    2e-26   
ref|WP_010472859.1|  pyruvate dehydrogenase E1 subunit alpha          89.4    2e-26   
ref|WP_015138839.1|  pyruvate dehydrogenase E1 component subunit ...  78.2    2e-26   
ref|WP_029976840.1|  pyruvate dehydrogenase                           79.3    2e-26   
emb|CDI80905.1|  pyruvate dehydrogenase, putative                     75.9    2e-26   
ref|WP_032523520.1|  pyruvate dehydrogenase                           82.0    2e-26   
ref|WP_011429423.1|  pyruvate dehydrogenase E1 subunit alpha          81.3    3e-26   
ref|WP_019509314.1|  pyruvate dehydrogenase E1 subunit alpha          84.0    3e-26   
emb|CDJ47615.1|  pyruvate dehydrogenase, putative                     77.0    3e-26   
ref|WP_032513088.1|  pyruvate dehydrogenase                           81.6    3e-26   
ref|WP_036533717.1|  pyruvate dehydrogenase                           87.8    3e-26   
ref|WP_043696173.1|  pyruvate dehydrogenase                           77.0    4e-26   
ref|YP_063628.1|  pyruvate dehydrogenase E1 component alpha subunit   75.1    4e-26   
emb|CDJ61237.1|  pyruvate dehydrogenase, putative                     75.5    6e-26   
ref|WP_011820753.1|  pyruvate dehydrogenase E1 subunit alpha          77.4    6e-26   
gb|AAZ58346.1|  pyruvate dehydrogenase (lipoamide)                    75.1    7e-26   
ref|WP_011431966.1|  pyruvate dehydrogenase E1 subunit alpha          79.0    8e-26   
ref|WP_036485963.1|  pyruvate dehydrogenase                           78.2    8e-26   
ref|WP_041711031.1|  pyruvate dehydrogenase                           74.7    8e-26   
ref|WP_034416483.1|  pyruvate dehydrogenase                           76.6    9e-26   
ref|WP_019479963.1|  pyruvate dehydrogenase E1 subunit alpha          78.2    9e-26   
ref|WP_025891921.1|  pyruvate dehydrogenase                           77.0    1e-25   
ref|WP_022607853.1|  pyruvate dehydrogenase E1 component, alpha s...  75.5    1e-25   
ref|WP_025967260.1|  pyruvate dehydrogenase                           80.1    1e-25   
ref|WP_026101161.1|  pyruvate dehydrogenase                           75.5    1e-25   
ref|WP_011132922.1|  pyruvate dehydrogenase E1 subunit alpha          76.3    1e-25   
gb|KGG14287.1|  Pyruvate dehydrogenase E1 component alpha subunit     74.7    2e-25   
ref|WP_011125513.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  74.7    2e-25   
ref|WP_006909495.1|  pyruvate dehydrogenase E1 subunit alpha          75.5    2e-25   
ref|WP_035829726.1|  pyruvate dehydrogenase                           74.7    2e-25   
gb|KGG22140.1|  Pyruvate dehydrogenase E1 component alpha subunit     74.7    2e-25   
gb|ABM76264.1|  Pyruvate dehydrogenase E1 alpha subunit               76.3    3e-25   
ref|WP_036905297.1|  pyruvate dehydrogenase                           76.3    3e-25   
ref|WP_041700622.1|  pyruvate dehydrogenase                           76.3    3e-25   
ref|WP_019476652.1|  hypothetical protein                             76.6    3e-25   
ref|WP_007098531.1|  pyruvate dehydrogenase E1 subunit alpha          77.8    3e-25   
ref|WP_041425471.1|  pyruvate dehydrogenase                           76.3    4e-25   
gb|ABB26477.1|  Pyruvate dehydrogenase (lipoamide)                    76.3    4e-25   
ref|WP_019477322.1|  pyruvate dehydrogenase E1 subunit alpha          74.3    6e-25   
ref|WP_007100389.1|  pyruvate dehydrogenase E1 subunit alpha          74.3    7e-25   
ref|WP_037988804.1|  pyruvate dehydrogenase                           75.5    7e-25   
dbj|BAP17336.1|  pyruvate dehydrogenase E1 component alpha subunit    75.5    7e-25   
gb|EAU70620.1|  Pyruvate dehydrogenase (lipoamide)                    75.1    7e-25   
ref|WP_044107560.1|  pyruvate dehydrogenase                           75.5    8e-25   
ref|YP_008965799.1|  pyruvate dehydrogenase E1 component alpha su...  71.6    9e-25   
ref|YP_009122195.1|  pyruvate dehydrogenase E1 component subunit ...  71.2    1e-24   
ref|WP_011826582.1|  pyruvate dehydrogenase E1 subunit alpha          72.0    1e-24   
ref|WP_011129726.1|  pyruvate dehydrogenase E1 subunit alpha          72.0    1e-24   
ref|WP_036912824.1|  MULTISPECIES: pyruvate dehydrogenase             72.0    2e-24   
ref|WP_017712216.1|  pyruvate dehydrogenase E1 subunit alpha          82.4    2e-24   
ref|WP_015153409.1|  pyruvate dehydrogenase (acetyl-transferring)...  88.2    2e-24   
ref|WP_011057011.1|  pyruvate dehydrogenase E1 component subunit ...  87.4    2e-24   
ref|WP_009610620.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  72.8    2e-24   
ref|WP_036920401.1|  pyruvate dehydrogenase                           72.4    2e-24   
ref|WP_017744791.1|  pyruvate dehydrogenase E1 subunit alpha          71.6    2e-24   
ref|WP_003870169.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  72.4    3e-24   
ref|WP_003867262.1|  MULTISPECIES: acetoin:2,6-dichlorophenolindo...  72.4    3e-24   
ref|WP_009052565.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  72.4    3e-24   
ref|WP_012195887.1|  pyruvate dehydrogenase E1 subunit alpha          74.3    3e-24   
ref|YP_002048789.1|  Pyruvate dehydrogenase E1 alpha subunit          74.7    3e-24   
ref|WP_039715561.1|  pyruvate dehydrogenase                           86.7    5e-24   
gb|AEW09053.1|  hypothetical protein CL3466Contig1_01                 75.9    9e-24   
ref|WP_017717188.1|  pyruvate dehydrogenase E1 subunit alpha          82.0    1e-23   
ref|WP_036902357.1|  pyruvate dehydrogenase                           74.3    1e-23   
ref|WP_006530738.1|  pyruvate dehydrogenase E1 component, alpha s...  85.9    1e-23   
ref|WP_019478230.1|  pyruvate dehydrogenase E1 subunit alpha          69.7    1e-23   
ref|WP_013276766.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  73.2    2e-23   
ref|NP_849059.1|  pyruvate dehydrogenase E1 component alpha subunit   70.9    2e-23   
gb|AIA61192.1|  pyruvate dehydrogenase E1 component alpha subunit...  73.9    2e-23   
ref|WP_011128484.1|  pyruvate dehydrogenase E1 subunit alpha          80.5    3e-23   
ref|WP_006041926.1|  pyruvate dehydrogenase E1 subunit alpha          81.3    4e-23   
ref|WP_018398079.1|  pyruvate dehydrogenase E1 subunit alpha          86.3    4e-23   
ref|WP_031294493.1|  pyruvate dehydrogenase                           74.7    4e-23   
gb|ESA32648.1|  pyruvate dehydrogenase e1 subunit alpha               74.7    4e-23   
ref|WP_036918589.1|  MULTISPECIES: pyruvate dehydrogenase             69.3    4e-23   
gb|KGG16280.1|  Pyruvate dehydrogenase E1 component alpha subunit     69.3    5e-23   
ref|YP_007878253.1|  pyruvate dehydrogenase E1 component alpha su...  70.1    5e-23   
ref|WP_038961409.1|  dehydrogenase                                    71.2    6e-23   
ref|WP_006171785.1|  pyruvate dehydrogenase E1 subunit alpha          77.8    1e-22   
ref|YP_007627411.1|  pyruvate dehydrogenase E1 component alpha su...  75.5    1e-22   
gb|ABD32705.1|  Pyruvate dehydrogenase E1 component alpha subunit...  97.1    1e-22   
gb|AES82822.2|  2-oxoisovalerate dehydrogenase E1 component, alph...  97.1    1e-22   
ref|WP_029635771.1|  pyruvate dehydrogenase [                         85.1    3e-22   
ref|WP_039752681.1|  pyruvate dehydrogenase                           85.1    3e-22   
ref|XP_002987864.1|  hypothetical protein SELMODRAFT_426604           87.0    3e-22   
ref|WP_025362400.1|  pyruvate dehydrogenase                           77.0    3e-22   
gb|KDO86616.1|  hypothetical protein CISIN_1g013928mg                 96.7    3e-22   
ref|WP_028952470.1|  pyruvate dehydrogenase                           80.1    5e-22   
ref|WP_040934285.1|  pyruvate dehydrogenase                           78.6    5e-22   
ref|WP_024124449.1|  pyruvate dehydrogenase E1 component alpha su...  80.1    6e-22   
gb|AIL65174.1|  Acetoin:2,6-dichlorophenolindophenol oxidoreducta...  71.6    6e-22   
gb|ABB34648.1|  Pyruvate dehydrogenase (lipoamide)                    75.9    6e-22   
ref|WP_011933632.1|  pyruvate dehydrogenase E1 subunit alpha          77.0    7e-22   
ref|WP_041434499.1|  pyruvate dehydrogenase                           75.9    7e-22   
ref|WP_003362664.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  69.3    7e-22   
ref|WP_024931501.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  69.3    7e-22   
ref|WP_038604484.1|  pyruvate dehydrogenase                           71.6    7e-22   
ref|WP_033065497.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.9    9e-22   
ref|WP_038557300.1|  pyruvate dehydrogenase                           75.5    1e-21   
gb|AII49956.1|  pyruvate dehydrogenase E1 subunit alpha               75.1    1e-21   
ref|WP_012704820.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.6    1e-21   
ref|WP_040934253.1|  pyruvate dehydrogenase                           77.0    1e-21   
ref|WP_045890741.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    1e-21   
gb|EDU37136.1|  TPP-dependent acetoin dehydrogenase complex, E1 c...  68.2    1e-21   
ref|WP_011949161.1|  MULTISPECIES: acetoin:2,6-dichlorophenolindo...  68.2    2e-21   
ref|WP_017319820.1|  pyruvate dehydrogenase E1 subunit alpha          82.4    2e-21   
ref|WP_045894928.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    2e-21   
ref|WP_003358952.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    2e-21   
ref|WP_041349256.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    2e-21   
ref|WP_043002339.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    2e-21   
gb|EPS47238.1|  acetoin dehydrogenase E1 component alpha-subunit      68.2    2e-21   
ref|WP_038545717.1|  pyruvate dehydrogenase                           78.2    2e-21   
ref|WP_045461859.1|  pyruvate dehydrogenase                           85.5    2e-21   
ref|NP_045197.1|  pyruvate dehydrogenase E1 component alpha subunit   68.6    2e-21   
ref|WP_014012842.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  71.6    2e-21   
gb|AII44015.1|  pyruvate dehydrogenase E1 subunit alpha               78.2    2e-21   
gb|EPS65417.1|  hypothetical protein M569_09358                       94.0    2e-21   
ref|WP_003491397.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  67.4    2e-21   
ref|WP_040108143.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  67.4    2e-21   
ref|WP_015108816.1|  pyruvate dehydrogenase E1 component subunit ...  81.6    3e-21   
ref|WP_030034935.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  67.0    3e-21   
ref|WP_039129459.1|  pyruvate dehydrogenase                           80.9    3e-21   
ref|WP_043737107.1|  pyruvate dehydrogenase                           79.0    3e-21   
gb|ETX04796.1|  hypothetical protein ETSY2_26730                      77.0    3e-21   
emb|CAK28609.1|  Pyruvate dehydrogenase E1 component alpha subunit    78.6    4e-21   
ref|WP_040583768.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  65.9    4e-21   
ref|WP_015226684.1|  pyruvate dehydrogenase (acetyl-transferring)...  79.7    4e-21   
ref|WP_017894579.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.9    5e-21   
ref|WP_003399710.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  66.2    6e-21   
dbj|GAM99362.1|  pyruvate dehydrogenase E1 component alpha subunit    65.9    8e-21   
dbj|GAO45640.1|  pyruvate dehydrogenase E1 component alpha subunit    80.9    8e-21   
ref|WP_028526261.1|  pyruvate dehydrogenase                           78.6    9e-21   
ref|WP_017751085.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.2    9e-21   
ref|WP_013559836.1|  pyruvate dehydrogenase E1 subunit alpha          75.5    1e-20   
ref|WP_008583181.1|  pyruvate dehydrogenase E1 subunit alpha          82.4    1e-20   
ref|WP_039170081.1|  pyruvate dehydrogenase                           72.0    1e-20   
ref|WP_012267065.1|  pyruvate dehydrogenase E1 subunit alpha          84.0    1e-20   
ref|WP_004163914.1|  pyruvate dehydrogenase E1 subunit alpha          84.0    1e-20   
ref|WP_045358808.1|  pyruvate dehydrogenase                           84.0    1e-20   
ref|WP_019296871.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  72.0    1e-20   
gb|KJF28615.1|  acetoin:2,6-dichlorophenolindophenol oxidoreducta...  65.5    2e-20   
ref|WP_044823288.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  65.5    2e-20   
ref|WP_006854596.1|  pyruvate dehydrogenase E1 subunit alpha          75.1    2e-20   
ref|WP_028666745.1|  pyruvate dehydrogenase                           74.7    2e-20   
ref|WP_027259085.1|  pyruvate dehydrogenase                           70.5    3e-20   
ref|YP_009051098.1|  pyruvate dehydrogenase E1 component alpha su...  68.2    3e-20   
ref|WP_025048325.1|  pyruvate dehydrogenase                           67.4    3e-20   
ref|WP_042679158.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  70.5    3e-20   
ref|WP_015849906.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  65.5    4e-20   
ref|WP_011618705.1|  pyruvate dehydrogenase E1 subunit alpha          74.3    4e-20   
ref|WP_026393538.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  63.5    4e-20   
ref|WP_027237759.1|  pyruvate dehydrogenase                           69.7    4e-20   
ref|WP_032556862.1|  pyruvate dehydrogenase                           80.5    5e-20   
ref|WP_004069554.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  68.6    5e-20   
ref|WP_039146169.1|  MULTISPECIES: pyruvate dehydrogenase             69.7    6e-20   
ref|WP_028978872.1|  pyruvate dehydrogenase                           80.1    6e-20   
ref|WP_021727411.1|  TPP-dependent acetoin dehydrogenase complex,...  65.1    7e-20   
ref|WP_037929356.1|  pyruvate dehydrogenase                           68.9    7e-20   
gb|AIF81883.1|  pyruvate dehydrogenase subunit alpha                  72.8    8e-20   
ref|WP_018615520.1|  pyruvate dehydrogenase E1 subunit alpha          78.2    8e-20   
ref|WP_038541684.1|  pyruvate dehydrogenase                           72.4    9e-20   
ref|WP_013931009.1|  pyruvate dehydrogenase E1 subunit alpha          73.9    9e-20   
gb|KIE06129.1|  Pyruvate dehydrogenase E1 component subunit alpha     69.3    1e-19   
ref|WP_039454819.1|  pyruvate dehydrogenase                           69.3    1e-19   
ref|WP_018996930.1|  pyruvate dehydrogenase E1 subunit alpha          65.5    1e-19   
ref|WP_015028735.1|  pyruvate dehydrogenase E1 subunit alpha          73.2    1e-19   
ref|WP_004160336.1|  Pyruvate dehydrogenase E1 component subunit ...  80.9    1e-19   
gb|ESS34028.1|  pyruvate dehydrogenase complex subunit PDH-E1Alpha    63.9    1e-19   
ref|WP_008554412.1|  pyruvate dehydrogenase E1 subunit alpha          68.6    1e-19   
ref|WP_038960559.1|  hypothetical protein                             64.3    1e-19   
ref|WP_039687501.1|  pyruvate dehydrogenase                           69.7    1e-19   
ref|WP_036513498.1|  pyruvate dehydrogenase                           70.9    2e-19   
ref|XP_002994313.1|  hypothetical protein SELMODRAFT_432239           67.0    2e-19   
ref|WP_028787578.1|  pyruvate dehydrogenase                           79.0    2e-19   
ref|WP_039141408.1|  pyruvate dehydrogenase                           74.3    2e-19   
ref|WP_021698092.1|  pyruvate dehydrogenase E1 component alpha su...  62.8    2e-19   
ref|WP_024090103.1|  pyruvate dehydrogenase E1 subunit alpha          67.4    2e-19   
ref|WP_038960958.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  63.5    2e-19   
ref|WP_018626639.1|  pyruvate dehydrogenase E1 subunit alpha          77.4    2e-19   
ref|WP_029717149.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  63.9    2e-19   
ref|WP_045320332.1|  pyruvate dehydrogenase                           70.5    2e-19   
ref|WP_027240494.1|  pyruvate dehydrogenase                           67.4    2e-19   
ref|WP_028957681.1|  pyruvate dehydrogenase                           68.9    2e-19   
ref|WP_017873043.1|  hypothetical protein                             70.5    3e-19   
dbj|GAD57153.1|  pyruvate dehydrogenase E1 component alpha subunit    70.5    3e-19   
ref|WP_039166328.1|  pyruvate dehydrogenase                           68.2    3e-19   
ref|WP_019533267.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  64.7    3e-19   
ref|WP_025054005.1|  pyruvate dehydrogenase                           66.6    3e-19   
ref|WP_026770172.1|  MULTISPECIES: pyruvate dehydrogenase             74.3    3e-19   
ref|WP_002942391.1|  pyruvate dehydrogenase E1 subunit alpha          72.0    4e-19   
ref|WP_029187403.1|  pyruvate dehydrogenase                           72.0    4e-19   
ref|WP_026983801.1|  MULTISPECIES: pyruvate dehydrogenase             70.5    4e-19   
ref|WP_044762551.1|  pyruvate dehydrogenase                           72.0    4e-19   
ref|WP_024385177.1|  pyruvate dehydrogenase                           72.0    4e-19   
ref|WP_024376420.1|  pyruvate dehydrogenase                           72.0    4e-19   
ref|WP_025730833.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  62.0    4e-19   
ref|WP_035452648.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  66.2    4e-19   
ref|WP_010137986.1|  pyruvate dehydrogenase E1 subunit alpha          64.7    4e-19   
ref|WP_029998049.1|  pyruvate dehydrogenase                           71.6    5e-19   
ref|WP_008228053.1|  pyruvate dehydrogenase E1 subunit alpha          65.1    5e-19   
ref|WP_003545136.1|  MULTISPECIES: acetoin:2,6-dichlorophenolindo...  67.0    5e-19   
ref|XP_002991363.1|  hypothetical protein SELMODRAFT_429697           72.4    5e-19   
ref|WP_009826759.1|  pyruvate dehydrogenase E1 subunit alpha          67.0    5e-19   
ref|WP_005852939.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  67.0    5e-19   
ref|XP_008780050.1|  PREDICTED: pyruvate dehydrogenase E1 compone...  90.5    6e-19   
ref|WP_017890478.1|  hypothetical protein                             69.3    6e-19   
ref|WP_039123987.1|  pyruvate dehydrogenase                           67.4    7e-19   
ref|WP_040098371.1|  hypothetical protein                             63.5    7e-19   
ref|WP_011836968.1|  pyruvate dehydrogenase E1 subunit alpha          77.4    7e-19   
ref|WP_044775780.1|  pyruvate dehydrogenase                           72.8    8e-19   
ref|WP_044768468.1|  pyruvate dehydrogenase                           72.8    8e-19   
ref|WP_009200688.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  65.1    8e-19   
ref|WP_010233662.1|  acetoin:2,6-dichlorophenolindophenol oxidore...  62.4    8e-19   
ref|WP_005654260.1|  MULTISPECIES: pyruvate dehydrogenase E1 subu...  68.9    9e-19   



>gb|ACF17669.1| putative pyruvate dehydrogenase E1 alpha subunit [Capsicum annuum]
Length=431

 Score =   198 bits (503),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI ALKKY+F+N L  E ELKAI+KKIDE+VEESVE
Sbjct  326  RGHSLADPDELRDPAEKNHYATRDPITALKKYMFENNLVNEAELKAIDKKIDELVEESVE  385

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SPVPAR QLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  386  FADASPVPARNQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  431


 Score =   100 bits (248),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA EA+GRARRGEGPTLVECETYRF+
Sbjct  278  KKGPAFGMPGVHVDGMDVLKVREVANEAVGRARRGEGPTLVECETYRFR  326



>ref|XP_011101308.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Sesamum indicum]
Length=437

 Score =   199 bits (505),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI ALKKY+ +N LA+E ELKAIEKKIDE+VE++VE
Sbjct  332  RGHSLADPDELRDPAEKAHYATRDPITALKKYILENNLASEAELKAIEKKIDEVVEDAVE  391

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVPAR+QLLENVFADPRGFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  392  FADESPVPARSQLLENVFADPRGFGIGPDGKYRCEDPKFTEGTAQV  437


 Score = 99.4 bits (246),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA EAI RARRGEGPTLVECETYRF+
Sbjct  284  KKGPAFGMPGVHVDGMDVLKVREVANEAIARARRGEGPTLVECETYRFR  332



>gb|KJB51242.1| hypothetical protein B456_008G208500 [Gossypium raimondii]
Length=424

 Score =   196 bits (498),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPD+LRDP+EK+HYAARDPI ALKKYL DN LA+E +LKAI+KKIDE+VEE+VE
Sbjct  319  RGHSLADPDKLRDPAEKAHYAARDPITALKKYLIDNSLASEADLKAIDKKIDEVVEEAVE  378

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP+++QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  379  FADESPVPSKSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  424


 Score =   100 bits (250),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  271  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  319



>ref|XP_004494869.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Cicer arietinum]
Length=428

 Score =   197 bits (501),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI+ LKKY+ +NKLA+E+ELK IEKKIDEI+EE+VE
Sbjct  323  RGHSLADPDELRDPAEKAHYAGRDPISTLKKYMLENKLASEQELKTIEKKIDEIIEEAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  383  FADESPVPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  428


 Score = 99.4 bits (246),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGP+L+ECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPSLIECETYRFR  323



>emb|CDP08620.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   196 bits (497),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YA+RDPI+ALKKY+F+N LA+E ELKAI+KKIDE+VE++VE
Sbjct  339  RGHSLADPDELRDPAEKARYASRDPISALKKYMFENNLASEAELKAIDKKIDELVEDAVE  398

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+PAR+QLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  399  FADESPLPARSQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  444


 Score =   100 bits (250),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  291  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  339



>ref|XP_006353739.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Solanum tuberosum]
Length=437

 Score =   196 bits (498),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI ALKKY+F+N L  E ELKAI+KKIDE+VEESVE
Sbjct  332  RGHSLADPDELRDPAEKNHYATRDPITALKKYMFENNLVNEAELKAIDKKIDELVEESVE  391

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FA+ SPVPAR QLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  392  FAEASPVPARNQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  437


 Score = 99.8 bits (247),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA EA+GRARRGEGPTLVECETYRF+
Sbjct  284  KKGPAFGMPGVHVDGMDVLKVREVAMEAVGRARRGEGPTLVECETYRFR  332



>ref|XP_009793937.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Nicotiana sylvestris]
Length=434

 Score =   195 bits (496),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI ALKKY+F+N L +E ELKAI+KKIDE+VEESVE
Sbjct  329  RGHSLADPDELRDPAEKNHYATRDPITALKKYMFENNLVSEAELKAIDKKIDEVVEESVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SPVPAR+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  389  FADASPVPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  434


 Score =   100 bits (249),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  329



>gb|KJB49639.1| hypothetical protein B456_008G130900 [Gossypium raimondii]
Length=495

 Score =   193 bits (491),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKYL +N LA+E +LKAI+KKIDE+VEE+VE
Sbjct  390  RGHSLADPDELRDPAEKAHYAARDPITALKKYLIENSLASEADLKAIDKKIDEVVEEAVE  449

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP ++QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  450  FADESPVPPQSQLLENVFADPKGFGIGPDGQYRCEDPKFTEGTAQV  495


 Score =   101 bits (252),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  342  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  390



>ref|XP_002515074.1| pyruvate dehydrogenase, putative [Ricinus communis]
 gb|EEF47058.1| pyruvate dehydrogenase, putative [Ricinus communis]
Length=433

 Score =   194 bits (492),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI +LKKY+ +N LA+E ELKAIEKKIDE+VE+SVE
Sbjct  328  RGHSLADPDELRDPAEKAHYAARDPITSLKKYIIENSLASEAELKAIEKKIDEVVEDSVE  387

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP R+QLLENVFADP+GFGIGPDGRYRCEDPKFT+GTA V
Sbjct  388  FADESPVPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTQGTAHV  433


 Score =   100 bits (250),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  280  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  328



>ref|XP_009590458.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=434

 Score =   194 bits (493),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI ALKKY+F+N L +E ELKAI+KKIDE+VEESVE
Sbjct  329  RGHSLADPDELRDPAEKNHYATRDPITALKKYMFENNLVSEAELKAIDKKIDELVEESVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SPVPAR+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  389  FADASPVPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  434


 Score =   100 bits (248),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  329



>ref|XP_002301442.2| hypothetical protein POPTR_0002s18020g [Populus trichocarpa]
 gb|ABK95003.1| unknown [Populus trichocarpa]
 gb|EEE80715.2| hypothetical protein POPTR_0002s18020g [Populus trichocarpa]
Length=442

 Score =   193 bits (490),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPIAALKKY+ +N LA+E ELKAIEKKIDE+VEE+VE
Sbjct  337  RGHSLADPDELRDPAEKARYAARDPIAALKKYMIENSLASEAELKAIEKKIDEVVEEAVE  396

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P+R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA+V
Sbjct  397  FADESPHPSRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTARV  442


 Score =   101 bits (251),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  289  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  337



>ref|XP_004251713.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Solanum lycopersicum]
Length=440

 Score =   196 bits (498),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI+ALKKY+F+N LA+E ELKAI+KKIDE+VEE+VE
Sbjct  335  RGHSLADPDELRDPAEKNHYAARDPISALKKYMFENNLASEAELKAIDKKIDELVEEAVE  394

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  395  FADESPHPVRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  440


 Score = 97.8 bits (242),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  287  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  335



>ref|XP_006345233.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Solanum tuberosum]
Length=440

 Score =   196 bits (498),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI+ALKKY+F+N LA+E ELKAI+KKIDE+VEE+VE
Sbjct  335  RGHSLADPDELRDPAEKNHYAARDPISALKKYMFENNLASEAELKAIDKKIDELVEEAVE  394

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  395  FADESPHPVRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  440


 Score = 97.8 bits (242),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  287  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  335



>ref|XP_007051428.1| Pyruvate dehydrogenase E1 alpha, ALPHA [Theobroma cacao]
 gb|EOX95585.1| Pyruvate dehydrogenase E1 alpha, ALPHA [Theobroma cacao]
Length=526

 Score =   192 bits (489),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKYL +N LA+E ELKAI+KKIDE+VE+SVE
Sbjct  421  RGHSLADPDELRDPAEKAHYAARDPITALKKYLIENSLASEAELKAIDKKIDEVVEDSVE  480

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P+R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  481  FADESPLPSRSQLLENVFADPKGFGIGPDGQYRCEDPKFTEGTAHV  526


 Score =   100 bits (250),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG+HVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  373  KKGPAFGMPGIHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  421



>ref|XP_004251714.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Solanum lycopersicum]
Length=440

 Score =   196 bits (497),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI+ALKKY+F+N LA+E ELKAI+KKIDE+VEE+VE
Sbjct  335  RGHSLADPDELRDPAEKNHYAARDPISALKKYMFENNLASEAELKAIDKKIDELVEEAVE  394

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  395  FADESPHPVRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  440


 Score = 97.8 bits (242),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  287  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  335



>gb|EYU17698.1| hypothetical protein MIMGU_mgv1a006615mg [Erythranthe guttata]
Length=437

 Score =   193 bits (490),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPIAALKKY+ +N LA+E +LKAIEKKIDE +EE+VE
Sbjct  332  RGHSLADPDELRDPAEKAHYATRDPIAALKKYILENNLASEADLKAIEKKIDEELEEAVE  391

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FA+ESPVPAR+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  392  FAEESPVPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  437


 Score = 99.8 bits (247),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+GRARRGEGPTLVECETYRF+
Sbjct  284  KKGPAFGMPGVHVDGMDVLKVREVAKEAVGRARRGEGPTLVECETYRFR  332



>ref|XP_008233047.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic isoform X1 [Prunus mume]
 ref|XP_008233048.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic isoform X2 [Prunus mume]
Length=431

 Score =   191 bits (485),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKY+ +N LATE+ELKAI KKIDE+VE++VE
Sbjct  326  RGHSLADPDELRDPAEKAHYAARDPITALKKYILENNLATEQELKAIHKKIDELVEDAVE  385

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  386  FADESPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  431


 Score =   101 bits (251),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  278  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  326



>ref|XP_007218034.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica]
 gb|EMJ19233.1| hypothetical protein PRUPE_ppa006008mg [Prunus persica]
Length=432

 Score =   191 bits (485),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKY+ +N LATE+ELKAI KKIDE+VE++VE
Sbjct  327  RGHSLADPDELRDPAEKAHYAARDPITALKKYILENNLATEQELKAIHKKIDELVEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  387  FADESPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  432


 Score =   101 bits (251),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  327



>gb|KJB41627.1| hypothetical protein B456_007G112900 [Gossypium raimondii]
Length=432

 Score =   192 bits (489),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKYL +N LA+E +LKAI+KKIDE+VE++VE
Sbjct  327  RGHSLADPDELRDPAEKAHYAARDPITALKKYLIENSLASEADLKAIDKKIDEVVEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP+++QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  387  FADESPVPSQSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  432


 Score = 99.8 bits (247),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG+HVDGMDVLKVREVA++AIGRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGIHVDGMDVLKVREVAKDAIGRARRGEGPTLVECETYRFR  327



>ref|XP_006858882.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Amborella trichopoda]
 gb|ERN20349.1| hypothetical protein AMTR_s00066p00199280 [Amborella trichopoda]
Length=435

 Score =   192 bits (487),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKY+ +N LA E ELK IEKKIDEIVEE+VE
Sbjct  330  RGHSLADPDELRDPAEKAHYAARDPIMALKKYIIENNLANESELKVIEKKIDEIVEEAVE  389

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD+SP+P R+QLLENVFADP+GFGIGPDGRYRCEDP FTEGTAQV
Sbjct  390  FADKSPLPPRSQLLENVFADPKGFGIGPDGRYRCEDPGFTEGTAQV  435


 Score =   100 bits (249),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG+HVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  282  KKGPAFGMPGIHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  330



>ref|XP_011025370.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Populus euphratica]
Length=442

 Score =   191 bits (484),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKY+ +N LA+E ELKAIEKKIDE+VEE+VE
Sbjct  337  RGHSLADPDELRDPAEKARYAARDPITALKKYMIENSLASEAELKAIEKKIDEVVEEAVE  396

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P+R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  397  FADESPHPSRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTACV  442


 Score =   101 bits (251),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  289  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  337



>gb|KHG16317.1| Pyruvate dehydrogenase E1 component subunit alpha [Gossypium 
arboreum]
Length=432

 Score =   191 bits (484),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK++YAARDPI ALKKYL +N LA+E +LKAI+KKIDE+VE++V+
Sbjct  327  RGHSLADPDELRDPAEKAYYAARDPITALKKYLIENSLASEADLKAIDKKIDEVVEDAVD  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP+R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  387  FADESPVPSRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  432


 Score =   100 bits (250),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG+HVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGIHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  327



>ref|XP_004306615.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=437

 Score =   192 bits (487),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKY+F++ LA+EEELKAI+KKIDE+++++VE
Sbjct  332  RGHSLADPDELRDPAEKAHYAARDPITALKKYIFEHNLASEEELKAIDKKIDEVLDDAVE  391

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDGRYRCEDPKFT+GTA+V
Sbjct  392  FADESPLPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTQGTAKV  437


 Score = 99.8 bits (247),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  284  KKGPAFGMPGVHVDGMDVLKVREVAKEAIARARRGEGPTLVECETYRFR  332



>gb|KEH18570.1| pyruvate dehydrogenase E1 component, alpha subunit [Medicago 
truncatula]
Length=427

 Score =   194 bits (492),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK HYA RDPI ALKKYLF+NKLATE+ELKAI+KKIDE++EE+V+
Sbjct  322  RGHSLADPDELRNPAEKQHYAGRDPITALKKYLFENKLATEQELKAIDKKIDEVLEEAVD  381

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FA++SP PAR+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  382  FAEKSPAPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  427


 Score = 97.4 bits (241),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGP+LVECETYRF+
Sbjct  274  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPSLVECETYRFR  322



>ref|XP_009622532.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=438

 Score =   193 bits (491),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI+ALKKY+F+N L  E ELKAI+KKIDE+VE++VE
Sbjct  333  RGHSLADPDELRDPTEKNHYAARDPISALKKYMFENNLVNEAELKAIDKKIDELVEDAVE  392

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADPRGFGIGPDGRYRCEDPKFTEGTA V
Sbjct  393  FADESPHPVRSQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAHV  438


 Score = 97.4 bits (241),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  285  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  333



>ref|XP_002267676.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Vitis vinifera]
 emb|CBI38712.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   194 bits (493),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDP+ ALKKY+FDNKLA+E ELKAIEKKIDE+VEESVE
Sbjct  328  RGHSLADPDELRDPAEKAHYAARDPLTALKKYIFDNKLASEAELKAIEKKIDEVVEESVE  387

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG YRCEDPKFTEGTA V
Sbjct  388  FADASPPPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTEGTAHV  433


 Score = 96.7 bits (239),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  280  KKGPAFGMPGFHVDGMDVLKVREVAKEAIQRARRGEGPTLVECETYRFR  328



>gb|KJB41628.1| hypothetical protein B456_007G112900 [Gossypium raimondii]
Length=339

 Score =   192 bits (487),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKYL +N LA+E +LKAI+KKIDE+VE++VE
Sbjct  234  RGHSLADPDELRDPAEKAHYAARDPITALKKYLIENSLASEADLKAIDKKIDEVVEDAVE  293

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESPVP+++QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  294  FADESPVPSQSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  339


 Score = 98.6 bits (244),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG+HVDGMDVLKVREVA++AIGRARRGEGPTLVECETYRF+
Sbjct  186  KKGPAFGMPGIHVDGMDVLKVREVAKDAIGRARRGEGPTLVECETYRFR  234



>ref|XP_010107149.1| Pyruvate dehydrogenase E1 component subunit alpha [Morus notabilis]
 gb|EXC13670.1| Pyruvate dehydrogenase E1 component subunit alpha [Morus notabilis]
Length=431

 Score =   191 bits (485),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL +NKLA E+ELKA+EKKIDE+VEE+VE
Sbjct  326  RGHSLADPDELRDPAEKARYAARDPITALKKYLVENKLANEQELKAVEKKIDELVEEAVE  385

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  386  FADASPHPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  431


 Score = 99.0 bits (245),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  278  KKGPAFGMPGVHVDGMDVLKVREVAKEAIARARRGEGPTLVECETYRFR  326



>ref|XP_009366597.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Pyrus x bretschneideri]
Length=432

 Score =   188 bits (478),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALK+Y+ +N LATE++LKAI KKIDE+VE++VE
Sbjct  327  RGHSLADPDELRDPAEKAHYAARDPITALKQYILENNLATEQDLKAIHKKIDELVEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  387  FADESPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  432


 Score =   101 bits (251),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  327



>ref|XP_009793746.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Nicotiana sylvestris]
Length=438

 Score =   192 bits (488),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI+ALKKY+F+N L  E ELKAI+K+IDE+VE++VE
Sbjct  333  RGHSLADPDELRDPAEKNHYAARDPISALKKYMFENNLVNEAELKAIDKRIDELVEDAVE  392

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADPRGFGIGPDGRYRCEDPKFTEGTA V
Sbjct  393  FADESPHPVRSQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAHV  438


 Score = 97.4 bits (241),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  285  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  333



>ref|XP_007139015.1| hypothetical protein PHAVU_009G257800g [Phaseolus vulgaris]
 gb|ESW11009.1| hypothetical protein PHAVU_009G257800g [Phaseolus vulgaris]
Length=426

 Score =   190 bits (483),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI+ALKKYL  NKLA+E+ELKAIE KIDE++EE+VE
Sbjct  321  RGHSLADPDELRDPAEKAHYADRDPISALKKYLIGNKLASEQELKAIENKIDEVLEEAVE  380

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTA V
Sbjct  381  FADESPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAHV  426


 Score = 98.2 bits (243),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  273  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  321



>ref|NP_171617.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana]
 sp|O24457.1|ODPA3_ARATH RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86803.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana]
 gb|AAK96625.1| At1g01090/T25K16_8 [Arabidopsis thaliana]
 gb|AAL36074.1| At1g01090/T25K16_8 [Arabidopsis thaliana]
 dbj|BAE98984.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana]
 gb|AEE27233.1| pyruvate dehydrogenase E1 component subunit alpha [Arabidopsis 
thaliana]
Length=428

 Score =   190 bits (483),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPIAALKKYL +NKLA E ELK+IEKKIDE+VEE+VE
Sbjct  323  RGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENKLAKEAELKSIEKKIDELVEEAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  383  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  428


 Score = 97.8 bits (242),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  323



>gb|KHN15879.1| Pyruvate dehydrogenase E1 component subunit alpha [Glycine soja]
Length=432

 Score =   187 bits (476),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK HYA RDPI ALKKYLF+N LA E+ELK IEKKIDEI+E++VE
Sbjct  327  RGHSLADPDELRDPAEKEHYAGRDPITALKKYLFENNLANEQELKTIEKKIDEILEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD+SP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  387  FADKSPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  432


 Score =   100 bits (248),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+GRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGVHVDGMDVLKVREVAKEAVGRARRGEGPTLVECETYRFR  327



>ref|XP_008376219.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Malus domestica]
Length=432

 Score =   189 bits (479),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALK+YL +N LATE++LKAI KKIDE+VE++VE
Sbjct  327  RGHSLADPDELRDPAEKAHYAARDPITALKEYLLENNLATEQDLKAIHKKIDELVEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  387  FADESPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  432


 Score = 99.0 bits (245),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAF MPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFXMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  327



>ref|XP_008459830.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Cucumis melo]
Length=428

 Score =   187 bits (474),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP EK+ YAARDPIAALKKYL +NKLA E+ELKAI+ KI E+VE++V+
Sbjct  323  RGHSLADPDELRDPDEKARYAARDPIAALKKYLLENKLANEQELKAIKDKIVEVVEDAVQ  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+PAR+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  383  FADESPLPARSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  428


 Score =   100 bits (250),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  323



>ref|XP_010056030.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW72607.1| hypothetical protein EUGRSUZ_E01069 [Eucalyptus grandis]
 gb|KCW72608.1| hypothetical protein EUGRSUZ_E01069 [Eucalyptus grandis]
Length=434

 Score =   188 bits (477),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALKKY+ ++ LA+E ELKAI+KKIDEI+E++VE
Sbjct  329  RGHSLADPDELRDPAEKAHYAARDPIVALKKYILESNLASEAELKAIDKKIDEIIEDAVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  389  FADASPIPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  434


 Score = 99.8 bits (247),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  329



>ref|XP_007135321.1| hypothetical protein PHAVU_010G119600g [Phaseolus vulgaris]
 gb|ESW07315.1| hypothetical protein PHAVU_010G119600g [Phaseolus vulgaris]
Length=428

 Score =   186 bits (473),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK +YAARDPI ALK+YL +N LA+E+ELKAIEKKIDEI++++VE
Sbjct  323  RGHSLADPDELRDPAEKEYYAARDPITALKQYLAENNLASEQELKAIEKKIDEILDDAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  383  FADNSPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  428


 Score =   101 bits (251),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  323



>ref|XP_010666479.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   186 bits (472),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ Y++RDPIAALKKYL +NKLA+E +LK IEKKIDE+VE++V+
Sbjct  330  RGHSLADPDELRDPAEKASYSSRDPIAALKKYLIENKLASESDLKTIEKKIDEVVEDAVD  389

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            F D+SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  390  FGDQSPAPLRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  435


 Score =   101 bits (251),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  282  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  330



>ref|XP_002889385.1| PDH-E1 alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65644.1| PDH-E1 alpha [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   189 bits (479),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK+IEKKIDE+VEE+VE
Sbjct  327  RGHSLADPDELRDAAEKAKYAARDPIVALKKYLIENKLAKEAELKSIEKKIDELVEEAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  387  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  432


 Score = 98.2 bits (243),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  279  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  327



>ref|XP_003520883.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Glycine max]
 gb|KHN16403.1| Pyruvate dehydrogenase E1 component subunit alpha [Glycine soja]
Length=418

 Score =   189 bits (480),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI+ALKKY+ +NKLA+E+ELK IEKKI+EIVE++VE
Sbjct  313  RGHSLADPDELRDPAEKAHYAGRDPISALKKYMIENKLASEQELKTIEKKIEEIVEDAVE  372

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTA V
Sbjct  373  FADESPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAHV  418


 Score = 97.8 bits (242),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  265  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  313



>gb|AFK44557.1| unknown [Medicago truncatula]
Length=167

 Score =   190 bits (483),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK HYA RDPI ALKKYLF+NKLATE+ELKAI+KKIDE++EE+V+
Sbjct  62   RGHSLADPDELRNPAEKQHYAGRDPITALKKYLFENKLATEQELKAIDKKIDEVLEEAVD  121

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FA++SP PAR+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  122  FAEKSPAPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  167


 Score = 96.7 bits (239),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGP+LVECETYRF+
Sbjct  14   KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPSLVECETYRFR  62



>ref|XP_004140530.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Cucumis sativus]
 gb|KGN46471.1| hypothetical protein Csa_6G095870 [Cucumis sativus]
Length=428

 Score =   186 bits (471),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP EK+ YAARDPIAALKKY+ +NKLA E+ELKAI+ KI E+VEE+V+
Sbjct  323  RGHSLADPDELRDPDEKARYAARDPIAALKKYMLENKLANEQELKAIKDKIVEVVEEAVQ  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP PAR+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  383  FADESPHPARSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  428


 Score =   100 bits (250),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  323



>ref|XP_008347189.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like, partial [Malus domestica]
Length=399

 Score =   188 bits (478),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI ALK+YL +N LATE++LKAI KKIDE+VE++VE
Sbjct  294  RGHSLADPDELRDPAEKAHYAARDPITALKEYLLENNLATEQDLKAIHKKIDELVEDAVE  353

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP+P R+QLLENVFADP+GFGIGPDG YRCEDPKFT+GTA V
Sbjct  354  FADESPLPPRSQLLENVFADPKGFGIGPDGSYRCEDPKFTQGTAHV  399


 Score = 98.2 bits (243),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAF MPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  246  KKGPAFXMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  294



>ref|XP_004514921.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Cicer arietinum]
Length=339

 Score =   189 bits (479),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK HYA RDPI ALKKYLF+NKLAT++ELK I+KKIDEI+EE+VE
Sbjct  234  RGHSLADPDELRNPAEKEHYATRDPITALKKYLFENKLATDQELKTIDKKIDEILEEAVE  293

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  294  FADNSPPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  339


 Score = 97.4 bits (241),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  186  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPTLVECETYRFR  234



>ref|XP_010480668.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Camelina sativa]
Length=430

 Score =   188 bits (477),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPIAALKKYL +N LA E ELK+IEKKIDE+VEE+VE
Sbjct  325  RGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENNLAKEAELKSIEKKIDELVEEAVE  384

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  385  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  430


 Score = 98.6 bits (244),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  277  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGEGPTLVECETYRFR  325



>ref|XP_006307579.1| hypothetical protein CARUB_v10009201mg [Capsella rubella]
 gb|EOA40477.1| hypothetical protein CARUB_v10009201mg [Capsella rubella]
Length=430

 Score =   188 bits (478),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK+IEKKIDE+VEE+VE
Sbjct  325  RGHSLADPDELRDAAEKAKYAARDPIVALKKYLIENKLAKEAELKSIEKKIDELVEEAVE  384

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  385  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  430


 Score = 97.8 bits (242),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  277  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  325



>ref|XP_010457174.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Camelina sativa]
Length=430

 Score =   188 bits (478),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPIAALKKYL +NKL  E ELK+IEKKIDE+VEE+VE
Sbjct  325  RGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENKLVKEAELKSIEKKIDELVEEAVE  384

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  385  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  430


 Score = 97.8 bits (242),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  277  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  325



>ref|XP_010474696.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Camelina sativa]
Length=430

 Score =   188 bits (477),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPIAALKKYL +N LA E ELK+IEKKIDE+VEE+VE
Sbjct  325  RGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENNLAKEAELKSIEKKIDELVEEAVE  384

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  385  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  430


 Score = 97.8 bits (242),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  277  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  325



>ref|XP_003554784.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Glycine max]
Length=427

 Score =   187 bits (476),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI+ALKKY+ +NKLA+E+ELK I+KKI+E+VE++VE
Sbjct  322  RGHSLADPDELRDPAEKAHYAGRDPISALKKYMIENKLASEQELKTIDKKIEEVVEDAVE  381

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  382  FADESPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  427


 Score = 97.8 bits (242),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  274  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  322



>gb|KFK42500.1| hypothetical protein AALP_AA1G001500 [Arabis alpina]
Length=426

 Score =   187 bits (474),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK+IEKKIDE+VEE+VE
Sbjct  321  RGHSLADPDELRDAAEKAKYAARDPITALKKYLTENKLANEAELKSIEKKIDELVEEAVE  380

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  381  FADASPQPGRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  426


 Score = 98.2 bits (243),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  273  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  321



>emb|CDY37473.1| BnaC08g46110D [Brassica napus]
Length=423

 Score =   186 bits (473),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK IEKKID++VEE+VE
Sbjct  318  RGHSLADPDELRDAAEKAKYAARDPITALKKYLIENKLANEGELKTIEKKIDDLVEEAVE  377

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  378  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  423


 Score = 98.6 bits (244),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  270  KKGPAFGMPGVHVDGMDVLKVREVAKEAVSRARRGEGPTLVECETYRFR  318



>ref|XP_009119669.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Brassica rapa]
Length=426

 Score =   187 bits (475),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK IEKKIDE+VEE+VE
Sbjct  321  RGHSLADPDELRDAAEKAKYAARDPITALKKYLVENKLANEGELKTIEKKIDELVEEAVE  380

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  381  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  426


 Score = 97.4 bits (241),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  273  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  321



>emb|CDX90009.1| BnaA10g00730D [Brassica napus]
Length=426

 Score =   187 bits (475),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK IEKKIDE+VEE+VE
Sbjct  321  RGHSLADPDELRDAAEKAKYAARDPITALKKYLVENKLANEGELKTIEKKIDELVEEAVE  380

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  381  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  426


 Score = 97.4 bits (241),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  273  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  321



>ref|XP_009118790.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Brassica rapa]
 emb|CDY32445.1| BnaA09g51510D [Brassica napus]
Length=425

 Score =   187 bits (476),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK IEKKIDE+VEE+VE
Sbjct  320  RGHSLADPDELRDAAEKAKYAARDPITALKKYLIENKLAKEGELKTIEKKIDELVEEAVE  379

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  380  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  425


 Score = 97.1 bits (240),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  272  KKGPAFGMPGVHVDGMDVLKVREVAKEAVIRARRGEGPTLVECETYRFR  320



>ref|XP_012083102.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Jatropha curcas]
 gb|KDP28414.1| hypothetical protein JCGZ_14185 [Jatropha curcas]
Length=434

 Score =   188 bits (478),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYAARDPI +LKKYL +NKLA+E ELKAIEKKIDE++E++VE
Sbjct  329  RGHSLADPDELRDPAEKAHYAARDPITSLKKYLIENKLASEAELKAIEKKIDEVLEDAVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  389  FADGSPHPPRSQLLENVFADPKGFGIGPDGQYRCEDPKFTEGTAHV  434


 Score = 96.3 bits (238),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RAR GEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGVHVDGMDVLKVREVAKEAIRRARSGEGPTLVECETYRFR  329



>ref|XP_006418380.1| hypothetical protein EUTSA_v10007695mg [Eutrema salsugineum]
 gb|ESQ36733.1| hypothetical protein EUTSA_v10007695mg [Eutrema salsugineum]
Length=429

 Score =   187 bits (476),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E +LK+IEKKIDE+VEE+VE
Sbjct  324  RGHSLADPDELRDAAEKAKYAARDPITALKKYLIENKLANEADLKSIEKKIDELVEEAVE  383

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTAQV
Sbjct  384  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV  429


 Score = 96.7 bits (239),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  276  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGDGPTLVECETYRFR  324



>emb|CDY15202.1| BnaC05g00810D [Brassica napus]
Length=429

 Score =   187 bits (474),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA+E ELK IEKKIDE+VEE+VE
Sbjct  324  RGHSLADPDELRDAAEKAKYAARDPITALKKYLVENKLASEGELKTIEKKIDELVEEAVE  383

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFT+GTAQV
Sbjct  384  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTQGTAQV  429


 Score = 97.4 bits (241),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  276  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  324



>dbj|BAQ95526.1| pyruvate dehydrogenase, partial [Gentiana triflora]
Length=437

 Score =   191 bits (484),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPIAALK+YLF+N LA+E ELKAI+KKIDE+VEE+VE
Sbjct  332  RGHSLADPDELRDPAEKAKYAARDPIAALKRYLFENNLASEAELKAIDKKIDEVVEEAVE  391

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD+SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  392  FADKSPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  437


 Score = 93.6 bits (231),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVRE+A+EA+ RAR GEGPTLVECETYRF+
Sbjct  284  KKGPAFGMPGFHVDGMDVLKVREIAKEAVDRARSGEGPTLVECETYRFR  332



>gb|KHN06367.1| Pyruvate dehydrogenase E1 component subunit alpha [Glycine soja]
Length=432

 Score =   188 bits (478),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK HYA RDPI ALK+YL +N LA E+ELKAIEKKIDEI+E++VE
Sbjct  327  RGHSLADPDELRDPAEKEHYAGRDPITALKQYLIENNLANEQELKAIEKKIDEILEDAVE  386

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  387  FADSSPLPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  432


 Score = 95.5 bits (236),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMD+LKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  279  KKGPAFGMPGVHVDGMDILKVREVAKEAVERARRGDGPTLVECETYRFR  327



>ref|XP_010522887.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Tarenaya hassleriana]
Length=428

 Score =   185 bits (470),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKY+ +NK+A+E ELK+IEKKIDE+VE++VE
Sbjct  323  RGHSLADPDELRDAAEKAKYAARDPITALKKYMIENKMASEAELKSIEKKIDEVVEDAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP PAR+QLLENVFADP+GFGIGPDGRYRCEDPKFT+GTA V
Sbjct  383  FADASPQPARSQLLENVFADPKGFGIGPDGRYRCEDPKFTQGTAHV  428


 Score = 97.8 bits (242),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  323



>ref|XP_009401925.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=429

 Score =   185 bits (470),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HYAARDPI  LKKY+ +N LA+E ELKAIEKKIDE++E+SVE
Sbjct  324  RGHSLADPDELRKPDEKAHYAARDPIITLKKYILENSLASETELKAIEKKIDELIEDSVE  383

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  384  FADSSPPPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  429


 Score = 97.1 bits (240),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA EAIGRAR GEGPTLVECETYRF+
Sbjct  276  KKGPAFGMPGVHVDGMDVLKVREVAVEAIGRARSGEGPTLVECETYRFR  324



>gb|KHN11375.1| Pyruvate dehydrogenase E1 component subunit alpha [Glycine soja]
Length=427

 Score =   184 bits (468),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+HYA RDPI+ALKKY+ +NKLA+E+ELK I+KKI+E+VE++VE
Sbjct  322  RGHSLADPDELRDPAEKAHYAGRDPISALKKYMIENKLASEQELKTIDKKIEEVVEDAVE  381

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R+Q LENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  382  FADESPHPPRSQPLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  427


 Score = 97.8 bits (242),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  274  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  322



>ref|XP_010056032.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW72611.1| hypothetical protein EUGRSUZ_E01071 [Eucalyptus grandis]
Length=439

 Score =   182 bits (461),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK+ YAARDPIAALKKY+ ++KLA+E ELKAI+KKIDE+VE++VE
Sbjct  334  RGHSLADPDELREPAEKAKYAARDPIAALKKYMIESKLASEAELKAIDKKIDEVVEDAVE  393

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDP FT GTA+V
Sbjct  394  FADASPQPPRSQLLENVFADPKGFGIGPDGRYRCEDPNFTAGTAKV  439


 Score =   100 bits (249),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+GRARRGEGPTLVECETYRF+
Sbjct  286  KKGPAFGMPGVHVDGMDVLKVREVAKEAVGRARRGEGPTLVECETYRFR  334



>ref|XP_003580308.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Brachypodium distachyon]
Length=424

 Score =   183 bits (465),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI +LKKY+ +  LA+E ELK+IEKKID++VEE+VE
Sbjct  319  RGHSLADPDELRRPDEKSHYAARDPITSLKKYIIEQNLASEAELKSIEKKIDDVVEEAVE  378

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  379  FADASPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  424


 Score = 97.8 bits (242),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  271  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPTLVECETYRFR  319



>gb|ABR18203.1| unknown [Picea sitchensis]
Length=438

 Score =   185 bits (470),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK+HYAARDPI +LKKYL +N LA E +LK+IEKKIDEI+EE+VE
Sbjct  333  RGHSLADPDELRNPAEKAHYAARDPIVSLKKYLIENNLANESDLKSIEKKIDEIIEEAVE  392

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R QLLENVFADP+GFGIGPDGRYRCEDP FT GTAQV
Sbjct  393  FADASPLPQRGQLLENVFADPKGFGIGPDGRYRCEDPGFTAGTAQV  438


 Score = 95.5 bits (236),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +KGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRG+GPTLVECETYRF+
Sbjct  285  EKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGDGPTLVECETYRFR  333



>ref|XP_006491368.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like isoform X1 [Citrus sinensis]
 gb|KDO86614.1| hypothetical protein CISIN_1g013928mg [Citrus sinensis]
Length=434

 Score =   184 bits (467),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL ++ LA+E ELKAIEKKIDE+VE++VE
Sbjct  329  RGHSLADPDELRDPAEKARYAARDPITALKKYLIESSLASEAELKAIEKKIDEVVEDAVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADES  P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  389  FADESAPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  434


 Score = 96.7 bits (239),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGFHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  329



>dbj|BAJ95313.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91067.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=419

 Score =   183 bits (464),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI +LKKY+ +  LA+E ELK+IEKKID++VEE+VE
Sbjct  314  RGHSLADPDELRRPDEKSHYAARDPITSLKKYIIEQNLASEAELKSIEKKIDDVVEEAVE  373

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  374  FADASPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  419


 Score = 97.8 bits (242),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  266  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPTLVECETYRFR  314



>ref|XP_010251507.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Nelumbo nucifera]
Length=438

 Score =   182 bits (461),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ Y+ARDPI ALKKY+ +N L  E ELKAIE++IDE++E++VE
Sbjct  333  RGHSLADPDELRDPAEKARYSARDPITALKKYMIENNLVNEAELKAIERRIDEVIEDAVE  392

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            F D+SP+P+R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTA V
Sbjct  393  FGDKSPLPSRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAHV  438


 Score = 99.0 bits (245),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  285  KKGPAFGMPGVHVDGMDVLKVREVAKEAIARARRGEGPTLVECETYRFR  333



>ref|XP_006491369.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like isoform X2 [Citrus sinensis]
 gb|KDO86615.1| hypothetical protein CISIN_1g013928mg [Citrus sinensis]
Length=427

 Score =   184 bits (466),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL ++ LA+E ELKAIEKKIDE+VE++VE
Sbjct  322  RGHSLADPDELRDPAEKARYAARDPITALKKYLIESSLASEAELKAIEKKIDEVVEDAVE  381

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADES  P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  382  FADESAPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  427


 Score = 96.3 bits (238),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  274  KKGPAFGMPGFHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  322



>ref|XP_006653118.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Oryza brachyantha]
Length=458

 Score =   182 bits (463),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  353  RGHSLADPDELRKPDEKSHYAARDPITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  412

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVF+DP+GFGIGPDG+YRCEDP FT+GTAQV
Sbjct  413  FADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQGTAQV  458


 Score = 97.1 bits (240),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  305  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  353



>gb|EMT15607.1| Pyruvate dehydrogenase E1 component subunit alpha [Aegilops tauschii]
Length=420

 Score =   182 bits (461),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI +LKKY+ +  LA+E ELK IEKKID++VEE+VE
Sbjct  315  RGHSLADPDELRRPDEKSHYAARDPITSLKKYIIEQNLASEAELKNIEKKIDDVVEEAVE  374

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  375  FADASPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  420


 Score = 97.8 bits (242),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  267  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRGEGPTLVECETYRFR  315



>ref|XP_006444730.1| hypothetical protein CICLE_v10020210mg [Citrus clementina]
 gb|ESR57970.1| hypothetical protein CICLE_v10020210mg [Citrus clementina]
Length=434

 Score =   183 bits (464),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL ++ LA+E ELKAIEK+IDE+VE++VE
Sbjct  329  RGHSLADPDELRDPAEKARYAARDPITALKKYLIESSLASEAELKAIEKRIDEVVEDAVE  388

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADES  P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  389  FADESAPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  434


 Score = 96.7 bits (239),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  281  KKGPAFGMPGFHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  329



>gb|EAY92846.1| hypothetical protein OsI_14647 [Oryza sativa Indica Group]
Length=425

 Score =   182 bits (462),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  320  RGHSLADPDELRKPDEKSHYAARDPITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  379

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVF+DP+GFGIGPDG+YRCEDP FT+GTAQV
Sbjct  380  FADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQGTAQV  425


 Score = 97.4 bits (241),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  272  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  320



>emb|CAH65949.1| H0716A07.7 [Oryza sativa Indica Group]
Length=425

 Score =   182 bits (461),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  320  RGHSLADPDELRRPDEKSHYAARDPITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  379

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVF+DP+GFGIGPDG+YRCEDP FT+GTAQV
Sbjct  380  FADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQGTAQV  425


 Score = 97.4 bits (241),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  272  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  320



>ref|XP_006444729.1| hypothetical protein CICLE_v10020210mg [Citrus clementina]
 gb|ESR57969.1| hypothetical protein CICLE_v10020210mg [Citrus clementina]
Length=427

 Score =   183 bits (464),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL ++ LA+E ELKAIEK+IDE+VE++VE
Sbjct  322  RGHSLADPDELRDPAEKARYAARDPITALKKYLIESSLASEAELKAIEKRIDEVVEDAVE  381

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADES  P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  382  FADESAPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  427


 Score = 96.3 bits (238),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  274  KKGPAFGMPGFHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  322



>ref|XP_002446057.1| hypothetical protein SORBIDRAFT_06g001120 [Sorghum bicolor]
 gb|EES10385.1| hypothetical protein SORBIDRAFT_06g001120 [Sorghum bicolor]
Length=431

 Score =   183 bits (464),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HYAARDPI ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  326  RGHSLADPDELRKPDEKTHYAARDPITALKKYIIEENLATESELKSIEKKIDDVVEEAVE  385

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  386  FADASPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  431


 Score = 95.9 bits (237),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGP+FGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  278  KKGPSFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  326



>ref|NP_001052065.1| Os04g0119400 [Oryza sativa Japonica Group]
 sp|Q7XTJ3.2|ODPA3_ORYSJ RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic; Flags: Precursor [Oryza sativa Japonica 
Group]
 emb|CAE01294.2| OSJNBa0020P07.11 [Oryza sativa Japonica Group]
 dbj|BAF13979.1| Os04g0119400 [Oryza sativa Japonica Group]
 gb|EAZ29517.1| hypothetical protein OsJ_13591 [Oryza sativa Japonica Group]
 dbj|BAG91364.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   182 bits (461),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EKSHYAARDPI ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  320  RGHSLADPDELRRPDEKSHYAARDPITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  379

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVF+DP+GFGIGPDG+YRCEDP FT+GTAQV
Sbjct  380  FADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQGTAQV  425


 Score = 97.1 bits (240),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  272  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  320



>ref|XP_001775995.1| predicted protein [Physcomitrella patens]
 gb|EDQ59187.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   190 bits (482),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P+EK+HYAARDPI ALKKYL DN++ATE ELK+IEKKIDE+VE++VE
Sbjct  335  RGHSLADPDELRAPAEKAHYAARDPIVALKKYLLDNEIATEAELKSIEKKIDEVVEDAVE  394

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDGRYRCEDP FT GTAQV
Sbjct  395  FADASPLPGRSQLLENVFADPKGFGIGPDGRYRCEDPGFTAGTAQV  440


 Score = 88.6 bits (218),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGM   HVDGMDVLKVREVA+EA+ RARRG+GPTL+ECETYRF+
Sbjct  287  KKGPAFGMASAHVDGMDVLKVREVAKEAVERARRGDGPTLIECETYRFR  335



>gb|KDO86617.1| hypothetical protein CISIN_1g013928mg [Citrus sinensis]
Length=339

 Score =   183 bits (464),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI ALKKYL ++ LA+E ELKAIEKKIDE+VE++VE
Sbjct  234  RGHSLADPDELRDPAEKARYAARDPITALKKYLIESSLASEAELKAIEKKIDEVVEDAVE  293

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADES  P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  294  FADESAPPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  339


 Score = 95.5 bits (236),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG HVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  186  KKGPAFGMPGFHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  234



>ref|XP_004981196.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Setaria italica]
Length=428

 Score =   181 bits (459),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HYAARDPI ALKKY+ +  LATE ELK+IEK ID +VEE+VE
Sbjct  323  RGHSLADPDELRKPDEKTHYAARDPITALKKYIIEQNLATEPELKSIEKNIDNVVEEAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  383  FADASPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  428


 Score = 97.4 bits (241),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  323



>ref|XP_008667490.1| PREDICTED: uncharacterized protein LOC100272834 isoform X1 [Zea 
mays]
 tpg|DAA38707.1| TPA: hypothetical protein ZEAMMB73_885772 [Zea mays]
Length=428

 Score =   181 bits (458),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HYAARD I ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  323  RGHSLADPDELRKPDEKTHYAARDSITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  383  FADASPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  428


 Score = 97.4 bits (241),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  323



>ref|XP_009384635.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=430

 Score =   181 bits (460),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EKSHYAARDPI +LKKY+ +  LA+E ELKAIEKKID+I+EE+VE
Sbjct  325  RGHSLADPDELRKADEKSHYAARDPIVSLKKYILEKNLASESELKAIEKKIDDIIEEAVE  384

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  385  FADSSPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  430


 Score = 96.3 bits (238),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA EAI RAR GEGPTLVECETYRF+
Sbjct  277  KKGPAFGMPGVHVDGMDVLKVREVAMEAIARARNGEGPTLVECETYRFR  325



>ref|NP_001140759.1| uncharacterized protein LOC100272834 [Zea mays]
 gb|ACF78361.1| unknown [Zea mays]
 gb|ACF84561.1| unknown [Zea mays]
 gb|ACF85238.1| unknown [Zea mays]
Length=341

 Score =   180 bits (457),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HYAARD I ALKKY+ +  LATE ELK+IEKKID++VEE+VE
Sbjct  236  RGHSLADPDELRKPDEKTHYAARDSITALKKYIIEQNLATESELKSIEKKIDDVVEEAVE  295

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  296  FADASPHPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  341


 Score = 97.1 bits (240),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARRGEGPTLVECETYRF+
Sbjct  188  KKGPAFGMPGVHVDGMDVLKVREVAKEAIERARRGEGPTLVECETYRFR  236



>ref|XP_010556630.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Tarenaya hassleriana]
Length=429

 Score =   180 bits (456),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKY+ + KL +E ELK IEK+IDE+VEE+VE
Sbjct  324  RGHSLADPDELRDAAEKAKYAARDPITALKKYMIEKKLVSEGELKKIEKRIDEVVEEAVE  383

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRYRCEDPKFTEGTA V
Sbjct  384  FADSSPQPPRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAHV  429


 Score = 97.1 bits (240),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGP+LVECETYRF+
Sbjct  276  KKGPAFGMPGVHVDGMDVLKVREVAKEAVARARRGEGPSLVECETYRFR  324



>ref|XP_001782068.1| predicted protein [Physcomitrella patens]
 gb|EDQ53132.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   187 bits (475),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P+EK+HYAARDPI ALKKYL +N++ATE ELK IEKKIDE+VE++VE
Sbjct  336  RGHSLADPDELREPAEKAHYAARDPIVALKKYLLENEIATEAELKTIEKKIDEVVEDAVE  395

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDGRYRCEDP FT GTAQV
Sbjct  396  FADASPLPERSQLLENVFADPKGFGIGPDGRYRCEDPGFTAGTAQV  441


 Score = 88.2 bits (217),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGM   HVDGMDVLKVREVA+EA+ RARRG+GPTL+ECETYRF+
Sbjct  288  KKGPAFGMASAHVDGMDVLKVREVAREAVERARRGDGPTLIECETYRFR  336



>emb|CCW28725.1| putative transketolase [Arachis duranensis]
Length=431

 Score =   182 bits (462),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+ YAARDPI+ALKKY+ +NKLA E+ELK+IEKKIDE+++++VE
Sbjct  326  RGHSLADPDELRDPAEKARYAARDPISALKKYMIENKLANEQELKSIEKKIDEVLDDAVE  385

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            F+DESP+P R+QLLENVFAD +GFGIGPDG+YRCEDPKFT+GTA V
Sbjct  386  FSDESPLPPRSQLLENVFADSKGFGIGPDGKYRCEDPKFTQGTAHV  431


 Score = 93.6 bits (231),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGM GVHVDGMDVLKVREVA+EAI RARRG+GPTLVECETYRF+
Sbjct  278  KKGPAFGMAGVHVDGMDVLKVREVAKEAIERARRGDGPTLVECETYRFR  326



>ref|XP_010940832.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate dehydrogenase E1 component 
subunit alpha-3, chloroplastic-like [Elaeis guineensis]
Length=436

 Score =   179 bits (455),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+HY ARDPI ALKKY+ ++ LA E ELK+IEKKID+++E++VE
Sbjct  331  RGHSLADPDELRKPDEKAHYTARDPILALKKYILEHDLAGESELKSIEKKIDDVIEDAVE  390

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  391  FADASPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  436


 Score = 93.6 bits (231),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVR VA+EAI RARRGEGPT++ECETYRF+
Sbjct  283  KKGPAFGMPGVHVDGMDVLKVRAVAKEAIERARRGEGPTVIECETYRFR  331



>ref|XP_008777457.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic [Phoenix dactylifera]
Length=433

 Score =   179 bits (453),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR+P EK+HYAARDPI ALKK++ ++ LA E +LK IEKKID+++E++VE
Sbjct  328  RGHSLADPDELRNPDEKAHYAARDPILALKKHIIEHDLANESDLKGIEKKIDDVIEDAVE  387

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADP+GFGIGPDG+YRCEDPKFTEGTAQV
Sbjct  388  FADASPLPPRSQLLENVFADPKGFGIGPDGKYRCEDPKFTEGTAQV  433


 Score = 94.0 bits (232),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVR VA+EAI RAR+GEGPTLVECETYRF+
Sbjct  280  KKGPAFGMPGVHVDGMDVLKVRAVAKEAIERARKGEGPTLVECETYRFR  328



>ref|XP_002968875.1| hypothetical protein SELMODRAFT_227859 [Selaginella moellendorffii]
 gb|EFJ29991.1| hypothetical protein SELMODRAFT_227859 [Selaginella moellendorffii]
Length=436

 Score =   178 bits (452),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P +K+ YA RDPIAA KKYL +N LA+E +LKAIEKKIDEIVE++VE
Sbjct  331  RGHSLADPDELRKPEQKNKYAVRDPIAAFKKYLLENGLASEADLKAIEKKIDEIVEDAVE  390

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADPRGFGIGPDG+YRCEDP FT GTA+V
Sbjct  391  FADASPLPPRSQLLENVFADPRGFGIGPDGKYRCEDPAFTAGTAEV  436


 Score = 93.2 bits (230),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKG AFGMPGVHVDGMDVLKVREVA+EAI RARRG+GPTLVECETYR++
Sbjct  283  KKGEAFGMPGVHVDGMDVLKVREVAKEAIARARRGDGPTLVECETYRYR  331



>ref|XP_002974096.1| hypothetical protein SELMODRAFT_149464 [Selaginella moellendorffii]
 gb|EFJ25051.1| hypothetical protein SELMODRAFT_149464 [Selaginella moellendorffii]
Length=435

 Score =   177 bits (448),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P +K+ YA RDPIAA KKYL +N LA+E +LK IEKKIDEIVE++VE
Sbjct  330  RGHSLADPDELRKPEQKNKYAVRDPIAAFKKYLLENGLASEADLKTIEKKIDEIVEDAVE  389

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP+P R+QLLENVFADPRGFGIGPDG+YRCEDP FT GTA+V
Sbjct  390  FADASPLPPRSQLLENVFADPRGFGIGPDGKYRCEDPAFTAGTAEV  435


 Score = 93.2 bits (230),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKG AFGMPGVHVDGMDVLKVREVA+EAI RARRG+GPTLVECETYR++
Sbjct  282  KKGEAFGMPGVHVDGMDVLKVREVAKEAIARARRGDGPTLVECETYRYR  330



>emb|CDY37428.1| BnaC08g45660D [Brassica napus]
Length=147

 Score =   182 bits (461),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPI ALKKYL +NKLA E ELK IEKKID++VEE+VE
Sbjct  42   RGHSLADPDELRDAAEKAKYAARDPITALKKYLIENKLANEGELKTIEKKIDDLVEEAVE  101

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FAD SP P R+QLLENVFADP+GFGIGPDGRY CEDPKFTEGTAQV
Sbjct  102  FADASPQPGRSQLLENVFADPKGFGIGPDGRYMCEDPKFTEGTAQV  147


 Score = 83.6 bits (205),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  932  MPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            MPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  1    MPGVHVDGMDVLKVREVAKEAVSRARRGEGPTLVECETYRFR  42



>gb|AAF26472.1|AC007323_13 T25K16.8 [Arabidopsis thaliana]
Length=679

 Score =   163 bits (412),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK+ YAARDPIAALKKYL +NKLA E ELK+IEKKIDE+VEE+VE
Sbjct  323  RGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENKLAKEAELKSIEKKIDELVEEAVE  382

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCE  524
            FAD SP P R+QLLENVFADP+GFGIGPDGRYR +
Sbjct  383  FADASPQPGRSQLLENVFADPKGFGIGPDGRYRSQ  417


 Score = 98.6 bits (244),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EA+ RARRGEGPTLVECETYRF+
Sbjct  275  KKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFR  323



>gb|KIY99248.1| pyruvate dehydrogenase E1 component subunit alpha [Monoraphidium 
neglectum]
Length=405

 Score =   145 bits (367),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK+ YAARDPI  LK Y+  N LATE ++K I  K+   VE+SV+
Sbjct  299  RGHSLADPDELRSKEEKAKYAARDPIPQLKDYMLANGLATEADIKEIHDKVMAEVEDSVK  358

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P + QLLENVFADPRGFGI PDGRYR E P FT GTAQV
Sbjct  359  FADESPKPDKGQLLENVFADPRGFGIAPDGRYRYELPGFTTGTAQV  404


 Score = 94.7 bits (234),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVAQEAI RARRG+GPTL+E ETYRF+
Sbjct  251  KKGPAFGMPGVHVDGMDVLKVREVAQEAIARARRGDGPTLIEAETYRFR  299



>ref|XP_005845662.1| hypothetical protein CHLNCDRAFT_32109 [Chlorella variabilis]
 gb|EFN53560.1| hypothetical protein CHLNCDRAFT_32109 [Chlorella variabilis]
Length=348

 Score =   150 bits (378),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK HYAARDPI    KY+  N LATE ++KA+E K+ E+V++ VE
Sbjct  242  RGHSLADPDELRRKEEKEHYAARDPIPQFAKYMVANGLATESDIKALEAKVKEVVDDCVE  301

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            +A+ SP P  +QLLENVFADP+GFGIGPDGRYR E+P FT GTA+V
Sbjct  302  YAENSPKPDMSQLLENVFADPKGFGIGPDGRYRYENPGFTAGTAEV  347


 Score = 89.7 bits (221),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDV+KVREVA EA+ RARRGEGPTL+E ETYR++
Sbjct  194  KKGPAFGMPGVHVDGMDVMKVREVAMEAVERARRGEGPTLIEAETYRYR  242



>ref|XP_002950542.1| hypothetical protein VOLCADRAFT_104783 [Volvox carteri f. nagariensis]
 gb|EFJ48288.1| hypothetical protein VOLCADRAFT_104783 [Volvox carteri f. nagariensis]
Length=431

 Score =   143 bits (361),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK+ Y ARDPI  LKKY+ ++ LATE ++KA+E K+ E+VE+ V+
Sbjct  317  RGHSLADPDELRSKDEKAKYLARDPIPQLKKYMLEHGLATEADIKALEDKVAEVVEDCVK  376

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R QLLENVFADPRGFGI  DGRYR +   F+ GTA V
Sbjct  377  FADESPKPERGQLLENVFADPRGFGIAEDGRYRYQQAGFSSGTAVV  422


 Score = 89.0 bits (219),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGV VDGMDVLKVR+VAQEA+ RARRGEGPTL+E ETYRF+
Sbjct  269  KKGPAFGMPGVLVDGMDVLKVRQVAQEAVERARRGEGPTLIEAETYRFR  317



>gb|EMS48424.1| Pyruvate dehydrogenase E1 component subunit alpha [Triticum urartu]
Length=436

 Score =   157 bits (397),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  763  EKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVEFADESPVPARTQLLE  584
            EKSHYAARDPI +LKKY+ +  LA+E ELK+IEKKID++VEE+VEFAD SP+P R+QLLE
Sbjct  346  EKSHYAARDPITSLKKYIIEQNLASEAELKSIEKKIDDVVEEAVEFADASPLPPRSQLLE  405

Query  583  NVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            NVFADP+GFGIGPDG+YRCEDPKFT+GTAQV
Sbjct  406  NVFADPKGFGIGPDGKYRCEDPKFTQGTAQV  436


 Score = 68.6 bits (166),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGE  846
            KKGPAFGMPGVHVDGMDVLKVREVA+EAI RARR E
Sbjct  311  KKGPAFGMPGVHVDGMDVLKVREVAKEAIDRARRDE  346



>ref|XP_011399872.1| Pyruvate dehydrogenase E1 component subunit alpha [Auxenochlorella 
protothecoides]
 gb|KFM26924.1| Pyruvate dehydrogenase E1 component subunit alpha [Auxenochlorella 
protothecoides]
Length=418

 Score =   133 bits (334),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK HYAARDPI  L+ Y+  + LA+E +L  +   +   V++ VE
Sbjct  312  RGHSLADPDELRSREEKEHYAARDPIPQLRAYMLKHGLASETDLAELHASVAAEVDDCVE  371

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            +AD SP P  +QLLENVFADP+GFGI PDGRYR E P FT GTA+V
Sbjct  372  YADASPKPDMSQLLENVFADPKGFGIAPDGRYRYELPGFTAGTAEV  417


 Score = 89.0 bits (219),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVL VRE A EA+ RARRGEGPTL+E ETYRF+
Sbjct  264  KKGPAFGMPGVHVDGMDVLAVREAALEAVARARRGEGPTLIEAETYRFR  312



>gb|KJB49643.1| hypothetical protein B456_008G131200 [Gossypium raimondii]
Length=127

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -2

Query  769  PSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVEFADESPVPARTQL  590
            PSEK+HYAARDPI ALKKYL +N+LA+E +LKAI+KKIDE+VE++VEFADESPVP R+QL
Sbjct  35   PSEKAHYAARDPITALKKYLIENRLASEADLKAIDKKIDEVVEDAVEFADESPVPPRSQL  94

Query  589  LENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            LENVFADP+GFGIGPD RYRCEDPKFTEGTAQV
Sbjct  95   LENVFADPKGFGIGPDDRYRCEDPKFTEGTAQV  127



>ref|XP_005643628.1| hypothetical protein COCSUDRAFT_31344 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19084.1| hypothetical protein COCSUDRAFT_31344 [Coccomyxa subellipsoidea 
C-169]
Length=436

 Score =   145 bits (365),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK HY ARDPI  LKKY+ +  L +E ++K IEK + EIV+E+V+
Sbjct  330  RGHSLADPDELRKKEEKEHYQARDPIPQLKKYIMEAGLLSEGQIKDIEKDVIEIVDEAVK  389

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADESP P R QLLENVFADP+GFGI PDGRYR E P F+ GTA V
Sbjct  390  FADESPKPVRGQLLENVFADPKGFGIAPDGRYRYELPGFSAGTAVV  435


 Score = 67.8 bits (164),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGV VDGMDV KVREVA EAI RARRG+GPTL+E ETYRF+
Sbjct  282  KKGPAFGMPGVLVDGMDVRKVREVAAEAIARARRGDGPTLIEAETYRFR  330



>gb|KDD73866.1| dehydrogenase E1, partial [Helicosporidium sp. ATCC 50920]
Length=310

 Score =   124 bits (312),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  Y ARDPI  L+  L +  + +E ++ AI+K++++ VE++V 
Sbjct  204  RGHSLADPDELRSAAEKEAYVARDPIPGLRNVLLEQGVLSETDIAAIDKEVEDEVEDAVA  263

Query  628  FADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FA+ S  P  +QLLENVFADP+GFGI  DGRYR E P FT GTA V
Sbjct  264  FAESSDKPEMSQLLENVFADPKGFGIAADGRYRYELPGFTSGTAAV  309


 Score = 84.0 bits (206),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPA+GMPGV VDGMDVL +R+VA+EAI RARRG+GPTL+E ETYRF+
Sbjct  156  KKGPAYGMPGVLVDGMDVLAMRKVAEEAIARARRGDGPTLIEAETYRFR  204



>ref|XP_008245109.1| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic-like [Prunus mume]
Length=185

 Score =   141 bits (356),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 87/126 (69%), Gaps = 20/126 (16%)
 Frame = -2

Query  808  RGHSLADPDELRDPSE------------KSHYAAR--------DPIAALKKYLFDNKLAT  689
            RGHSLADPDELRDP E            K  YA+          P    KKY+ +N LAT
Sbjct  60   RGHSLADPDELRDPGEMLMLLLLRFFELKFVYASMRRHTMLPETPSQPQKKYILENNLAT  119

Query  688  EEELKAIEKKIDEIVEESVEFADESPVPARTQLLENVFADPRGFGIGPDGRYRCEDPKFT  509
            E+ELKAI KKIDE+VE+ VEFADE P+P R+QLLENVFADP+GFGI PDG YRC DP+FT
Sbjct  120  EQELKAIHKKIDELVEDGVEFADERPLPPRSQLLENVFADPKGFGIRPDGSYRCADPEFT  179

Query  508  EGTAQV  491
            +GTA V
Sbjct  180  QGTAHV  185


 Score = 52.0 bits (123),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  893  VREVAQEAIGRARRGEGPTLVECETYRFQ  807
            VREV +EAIGRARR EGPTLVECET+RF+
Sbjct  32   VREVVKEAIGRARRREGPTLVECETHRFR  60



>gb|AFB33324.1| hypothetical protein 2_3307_01, partial [Pinus mugo]
 gb|AFB33325.1| hypothetical protein 2_3307_01, partial [Pinus mugo]
Length=89

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  757  SHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVEFADESPVPARTQLLENV  578
            +HYAARDPI + +KYL +N LA E +LK+IEKKIDEI+E++VEFAD SP+P R QLLENV
Sbjct  1    AHYAARDPIVSFRKYLIENNLANESDLKSIEKKIDEIIEDAVEFADASPLPQRGQLLENV  60

Query  577  FADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADP+GFGIGPDGRYRCE+P FT G AQV
Sbjct  61   FADPKGFGIGPDGRYRCEEPGFTAGIAQV  89



>gb|AEW08220.1| hypothetical protein 2_3307_01, partial [Pinus radiata]
 gb|AFG70487.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70488.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70489.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70490.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70491.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70492.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70493.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70494.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70495.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70496.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70497.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70498.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70499.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70500.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70501.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
 gb|AFG70502.1| hypothetical protein 2_3307_01, partial [Pinus taeda]
Length=89

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  757  SHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVEFADESPVPARTQLLENV  578
            +HYAARDPI + +KYL +N LA E +LK+IEKKIDEI+E++VEFAD SP+P R QLLENV
Sbjct  1    AHYAARDPIVSFRKYLIENNLANESDLKSIEKKIDEIIEDAVEFADASPLPQRGQLLENV  60

Query  577  FADPRGFGIGPDGRYRCEDPKFTEGTAQV  491
            FADP+GFG GPDGRYRCE+P FT G AQV
Sbjct  61   FADPKGFGFGPDGRYRCEEPGFTAGIAQV  89



>gb|KHG08766.1| Pyruvate dehydrogenase E1 component subunit alpha [Gossypium 
arboreum]
 gb|KHG24752.1| Pyruvate dehydrogenase E1 component subunit alpha [Gossypium 
arboreum]
 gb|KHG26133.1| Pyruvate dehydrogenase E1 component subunit alpha [Gossypium 
arboreum]
 gb|KHG27465.1| Pyruvate dehydrogenase E1 component subunit alpha [Gossypium 
arboreum]
Length=283

 Score =   100 bits (250),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGVHVDGMDVLKVREVA+EAIGRARRGEGPTLVECETYRF+
Sbjct  186  KKGPAFGMPGVHVDGMDVLKVREVAKEAIGRARRGEGPTLVECETYRFR  234


 Score = 84.3 bits (207),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKK  659
            RGHSLADPD+LRDP+EK+HYAARDPI ALKKYL +N LA E +LKAI+K+
Sbjct  234  RGHSLADPDKLRDPAEKAHYAARDPITALKKYLIENSLANEADLKAIDKR  283



>ref|WP_015219261.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Cyanobacterium aponinum]
 gb|AFZ53532.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanobacterium aponinum PCC 10605]
Length=343

 Score =   102 bits (253),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK  + A+DPI    KY+ DNK+AT EEL AI+KKI+ ++EE+VE
Sbjct  263  RGHSLADPDELRDPAEKEFWNAKDPIIQFGKYITDNKIATREELDAIDKKINALIEEAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFAD
Sbjct  323  FAESSPEPDGSELYRYVFAD  342


 Score = 68.9 bits (167),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMD+L VR+VAQ+AI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMEGYEVDGMDLLAVRDVAQKAIARARAGEGPTLIETLTYRFR  263



>ref|WP_014276531.1| pyruvate dehydrogenase E1 subunit alpha [Arthrospira platensis]
 dbj|BAI92470.1| pyruvate dehydrogenase E1 alpha subunit [Arthrospira platensis 
NIES-39]
 gb|KDR54332.1| pyruvate dehydrogenase [Arthrospira platensis str. Paraca]
Length=343

 Score = 85.1 bits (209),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI     YL ++ LA  +ELKAI+KK+ +++ ++VE
Sbjct  263  RGHSLADPDELRDRDEKEFWFARDPINKFFAYLTEHNLADSDELKAIDKKVQDVINDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   V+AD
Sbjct  323  FAQTSPEPDPSELYRYVYAD  342


 Score = 82.4 bits (202),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMDVL VREVAQ+AI RAR GEGPTL+E  TYRF+
Sbjct  215  KKGPAFGMPGYEVDGMDVLAVREVAQKAIARARAGEGPTLIEALTYRFR  263



>ref|WP_006623993.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Arthrospira]
 gb|EDZ92117.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Arthrospira maxima CS-328]
 emb|CCE18250.1| Pyruvate dehydrogenase E1 component subunit alpha [Arthrospira 
sp. PCC 8005]
 gb|EKD08214.1| pyruvate dehydrogenase (acetyl-transferring) E1 component alphasubunit 
[Arthrospira platensis C1]
 emb|CDM97013.1| Pyruvate dehydrogenase E1 component subunit alpha [Arthrospira 
sp. PCC 8005]
Length=343

 Score = 84.0 bits (206),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI     YL ++ LA  +ELKAI+KK+ +++ ++VE
Sbjct  263  RGHSLADPDELRDRDEKEFWFARDPINKFFAYLTEHNLADSDELKAIDKKVQDLINDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   ++AD
Sbjct  323  FAQTSPEPDPSELYRYIYAD  342


 Score = 82.4 bits (202),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMDVL VREVAQ+AI RAR GEGPTL+E  TYRF+
Sbjct  215  KKGPAFGMPGYEVDGMDVLAVREVAQKAIARARAGEGPTLIEALTYRFR  263



>ref|WP_009555730.1| pyruvate dehydrogenase E1 component, alpha subunit [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ71072.1| pyruvate dehydrogenase E1 component, alpha subunit [Oscillatoriales 
cyanobacterium JSC-12]
Length=343

 Score = 89.0 bits (219),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK H+ +RDPI     YL +  LAT+EEL+ I+KK+  +V+++++
Sbjct  263  RGHSLADPDELRSKAEKEHWFSRDPIKKFAAYLIEQNLATQEELQEIDKKVQAVVDDAIQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA ESP P   +L + VFA+
Sbjct  323  FALESPEPDANELYKYVFAE  342


 Score = 77.4 bits (189),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG+ VDGMDV+ V  VAQEAI RAR GEGPTL+EC TYRF+
Sbjct  215  KKASVFGMPGIEVDGMDVMAVYSVAQEAIARARAGEGPTLIECLTYRFR  263



>ref|WP_013191125.1| pyruvate dehydrogenase E1 subunit alpha [Trichormus azollae]
 gb|ADI64108.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit ['Nostoc azollae' 0708]
Length=345

 Score = 93.2 bits (230),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++ +RDPI  L  YL +  LAT EELKAIEKKI E+++E+V+
Sbjct  264  RGHSLADPDELRSKEEKEYWFSRDPIKKLATYLVEQNLATGEELKAIEKKIQEVIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAESSPEPDASELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_011244460.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Synechococcus]
 dbj|BAD80340.1| pyruvate dehydrogenase E1 component alpha subunit [Synechococcus 
elongatus PCC 6301]
 gb|ABB57974.1| Pyruvate dehydrogenase (lipoamide) [Synechococcus elongatus PCC 
7942]
 gb|AJD57546.1| pyruvate dehydrogenase [Synechococcus sp. UTEX 2973]
Length=342

 Score = 84.0 bits (206),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPGV VDGMDVL VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  214  KKGPAFGMPGVEVDGMDVLAVRAVAQEAIARARAGEGPTLIEALTYRFR  262


 Score = 82.0 bits (201),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI     +L +  LAT EELKAI+KKI+ +V E+VE
Sbjct  262  RGHSLADPDELRSKEEKEFWLARDPIKRFAAHLTEFNLATHEELKAIDKKIEALVAEAVE  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   ++A+
Sbjct  322  FAISSPEPKPEELTRYIWAE  341



>ref|WP_016951883.1| pyruvate dehydrogenase E1 subunit alpha [Anabaena sp. PCC 7108]
Length=345

 Score = 92.0 bits (227),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI  L  YL D  LA E ELKAIEKKI +I++E+V+
Sbjct  264  RGHSLADPDELRSKAEKEFWFARDPIKKLAAYLLDKNLADESELKAIEKKIQDIIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAESSPEPDPSELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_012305987.1| pyruvate dehydrogenase E1 subunit alpha [Synechococcus sp. PCC 
7002]
 gb|ACA98363.1| pyruvate dehydrogenase E1 component, alpha chain [Synechococcus 
sp. PCC 7002]
Length=343

 Score = 90.9 bits (224),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDPI   +K++ +  LAT EELKAIEKKI E+V ESV 
Sbjct  263  RGHSLADPDELRSAEEKEFWAQRDPIKRFEKFVTNRGLATAEELKAIEKKIQEVVNESVT  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P   +L + +FA+
Sbjct  323  FAESSPEPNPAELRKYIFAE  342


 Score = 73.2 bits (178),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL +R+VAQ+A+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMPGYEVDGMDVLAMRDVAQKAVARARAGEGPTLIEALTYRFR  263



>ref|WP_036001760.1| pyruvate dehydrogenase [Leptolyngbya sp. JSC-1]
Length=343

 Score = 83.6 bits (205),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDP+  L  +L D +L   +ELKAIEK+I   V+E+VE
Sbjct  262  RGHSLADPDELRSKAEKETWLARDPLKKLANHLIDQQLVQADELKAIEKRIQAEVDEAVE  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   VFA+
Sbjct  322  FAQSSPEPDPSELYRFVFAE  341


 Score = 79.7 bits (195),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG+ VDGMDVL VR VAQEA+ RAR GEGPTL+EC TYRF+
Sbjct  214  KKASVFGMPGIEVDGMDVLAVRTVAQEAVARARAGEGPTLIECLTYRFR  262



>ref|WP_015144713.1| pyruvate dehydrogenase E1 component subunit alpha [Pleurocapsa 
minor]
 gb|AFY78413.1| pyruvate dehydrogenase E1 component, alpha subunit [Pleurocapsa 
sp. PCC 7327]
Length=344

 Score = 88.2 bits (217),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI     YLF++ LA  EELK IE+++  I++++V+
Sbjct  263  RGHSLADPDELRSQDEKQFWGARDPIKKFAAYLFEHNLAEHEELKEIERRVQAIIDDAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA ESP P  ++L   VFA+
Sbjct  323  FAQESPEPDPSELYRYVFAE  342


 Score = 74.7 bits (182),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F MPGV VDGMDVL VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFQMPGVEVDGMDVLAVRSVAQEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_045056773.1| pyruvate dehydrogenase [Chroococcales cyanobacterium CENA595]
 gb|KJH69838.1| pyruvate dehydrogenase [Chroococcales cyanobacterium CENA595]
Length=345

 Score = 92.0 bits (227),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL ++ LATE ELK IE+KI ++++E+V+
Sbjct  264  RGHSLADPDELRSKEEKEFWFSRDPIKKLANYLTEHNLATESELKEIERKISQLIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP PA  +L   VFA+
Sbjct  324  FAEESPEPAANELYRFVFAE  343


 Score = 70.5 bits (171),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VR VA+EA+ RAR GEGPT++E  TYRF+
Sbjct  216  KKAHAFGMAGVEVDGMDVLAVRAVAKEAVERARAGEGPTVIEALTYRFR  264



>ref|WP_015785134.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Cyanothece]
 gb|ACK68083.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanothece sp. PCC 8801]
 gb|ACV02983.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanothece sp. PCC 8802]
Length=344

 Score = 89.4 bits (220),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK  + ARDPI  L  YL ++ LA  +ELK IEK++ E + E+V+
Sbjct  263  RGHSLADPDELRAPDEKQFWGARDPITKLATYLVEHNLANSQELKDIEKRVQETINEAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAENSPEPDPSELYRYIFAE  342


 Score = 72.8 bits (177),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFSMAGVEVDGMDVLAVRSVAQEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_008180311.1| pyruvate dehydrogenase E1 subunit alpha [Moorea producens]
 gb|EGJ34445.1| pyruvate dehydrogenase E1 component, alpha subunit [Moorea producens 
3L]
Length=342

 Score = 89.0 bits (219),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  +  YL +N LAT EELKAIE KI E++ ++VE
Sbjct  262  RGHSLADPDELRSKEEKEFWLTRDPIKNMASYLTENHLATPEELKAIESKIQEVINDAVE  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   VFA+
Sbjct  322  FAQASPEPDPSELHRYVFAE  341


 Score = 73.6 bits (179),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGM GV VDGMDV+ VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  214  KKASVFGMAGVEVDGMDVMAVRTVAQEAIARARAGEGPTLIEALTYRFR  262



>ref|WP_012161918.1| pyruvate dehydrogenase E1 subunit alpha [Acaryochloris marina]
 gb|ABW26384.1| pyruvate dehydrogenase E1 component, alpha subunit [Acaryochloris 
marina MBIC11017]
Length=342

 Score = 88.2 bits (217),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI   K YL D KL  E+EL  I++KI  ++EE+V+
Sbjct  262  RGHSLADPDELRSAAEKEEWLARDPITKFKSYLVDQKLVKEQELLDIDRKIQTLIEEAVQ  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P    L   +F D
Sbjct  322  FAEESPDPKPEDLYRYIFVD  341


 Score = 73.6 bits (179),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGM GV VDGMDVL VREVAQ AI RAR GEGPTL+E  TYRF+
Sbjct  214  KKAKVFGMEGVEVDGMDVLAVREVAQTAIARARAGEGPTLIEALTYRFR  262



>ref|WP_015132096.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Calothrix sp. PCC 7507]
 gb|AFY36307.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Calothrix sp. PCC 7507]
Length=344

 Score = 90.1 bits (222),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + ARDPI  L  YL +  LA +EELKAIEKKI E+++++V+
Sbjct  263  RGHSLADPDEMRSKAEKEFWFARDPIKKLAAYLIEQNLADQEELKAIEKKIQEVIDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAESSPEPDPSELYRFVFAE  342


 Score = 71.2 bits (173),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_024544584.1| pyruvate dehydrogenase [Synechococcus sp. NKBG15041c]
Length=343

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK+ +A RDPI   +K++ +  LAT EELKAIEK++ E+V +SV 
Sbjct  263  RGHSLADPDELRSAEEKAFWAQRDPITRFEKFVTNRGLATAEELKAIEKRVQEVVNDSVT  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L + +FA+
Sbjct  323  FAENSPEPNPADLRKYIFAE  342


 Score = 73.2 bits (178),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL +R+VAQ+A+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMPGYEVDGMDVLAMRDVAQKAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015213298.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Anabaena cylindrica]
 gb|AFZ56646.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Anabaena cylindrica PCC 7122]
Length=345

 Score = 89.0 bits (219),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL + KLA E ELK +EKKI +I++E+V+
Sbjct  264  RGHSLADPDELRSKEEKEFWFARDPIKKLAAYLLEKKLADEAELKGVEKKIQDIIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAETSPEPDPSELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_015172813.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Geitlerinema sp. PCC 7407]
 gb|AFY67249.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Geitlerinema sp. PCC 7407]
Length=343

 Score = 84.3 bits (207),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI     YL +  LAT+E+LKAI+++I  ++E++V+
Sbjct  263  RGHSLADPDELRSKEEKEEWFARDPIKKFSAYLTEQNLATQEDLKAIDQRIQAVIEDAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L   +FA+
Sbjct  323  FAESSPEPNPQDLYRYIFAE  342


 Score = 76.6 bits (187),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL VR+VA+EA+ RAR GEGPTL+EC TYRF+
Sbjct  215  KKASVFGMPGHEVDGMDVLAVRQVAKEAVARARAGEGPTLIECLTYRFR  263



>ref|WP_006102809.1| pyruvate dehydrogenase E1 subunit alpha [Coleofasciculus chthonoplastes]
 gb|EDX74048.1| pyruvate dehydrogenase E1 component, alpha subunit [Coleofasciculus 
chthonoplastes PCC 7420]
Length=343

 Score = 86.7 bits (213),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L  YL +  LA EEELKAI+K+I E++ ++V+
Sbjct  263  RGHSLADPDELRTSEEKDFWMTRDPIKKLTAYLTEQNLADEEELKAIDKRIQEVLNDAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P +++L   +FA+
Sbjct  323  FAQTSPEPDKSELHRYIFAE  342


 Score = 73.9 bits (180),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG+ VDGMDVL V  VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMPGIEVDGMDVLAVHSVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015201162.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Crinalium epipsammum]
 gb|AFZ11018.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Crinalium epipsammum PCC 9333]
Length=344

 Score = 89.7 bits (221),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI  L  Y+ +  LAT+EELK IE+K+  +++++V+
Sbjct  263  RGHSLADPDELRSKAEKEMWLARDPIKKLAAYMIEQNLATQEELKQIEQKVQAVIDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P  ++L   VFA+
Sbjct  323  FAEESPEPDPSELYRYVFAE  342


 Score = 70.9 bits (172),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VR VAQEAI RAR GEG T++E  TYRF+
Sbjct  215  KKAEAFGMVGVEVDGMDVLAVRAVAQEAIARARAGEGATVIEALTYRFR  263



>ref|WP_028090740.1| pyruvate dehydrogenase [Dolichospermum circinale]
Length=345

 Score = 88.6 bits (218),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL +  LATE ELK IE+KI  I+EE+V+
Sbjct  264  RGHSLADPDELRSKEEKEFWFARDPIKKLAGYLLEQNLATEAELKDIERKIQGIIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FA+
Sbjct  324  FAQSSPEPDPSELYRFIFAE  343


 Score = 72.0 bits (175),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_017285746.1| pyruvate dehydrogenase E1 subunit alpha [Leptolyngbya boryana]
Length=343

 Score = 84.7 bits (208),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDP+  L  YL +  L T+ ELK IEKK+  +VE++V+
Sbjct  263  RGHSLADPDELRSKEEKEAWLARDPLKKLSAYLIEQSLVTQSELKDIEKKVQAVVEDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            F  ESP P  ++L + +FA+
Sbjct  323  FGLESPEPDPSELYKYIFAE  342


 Score = 75.9 bits (185),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL VR VAQEA+ RAR GEGPTL+EC TYRF+
Sbjct  215  KKASVFGMPGYEVDGMDVLAVRGVAQEAVRRARAGEGPTLIECLTYRFR  263



>ref|WP_008309458.1| pyruvate dehydrogenase E1 component, alpha subunit [Leptolyngbya 
sp. PCC 6406]
Length=342

 Score = 82.4 bits (202),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDP+   + YL    LATE +LK I ++I  +V+E+V 
Sbjct  262  RGHSLADPDELRSKEEKEEWLARDPLKRFETYLMTQDLATEADLKTIRQRIQTVVDEAVT  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P   +L   +FAD
Sbjct  322  FAEQSPEPDPGELYRYIFAD  341


 Score = 77.8 bits (190),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K   FGMPGV VDGMDV+ VR+VAQ AI RAR GEGPTL+EC TYRF+
Sbjct  214  RKASVFGMPGVEVDGMDVMAVRDVAQTAIARARAGEGPTLIECLTYRFR  262



>ref|WP_015116622.1| pyruvate dehydrogenase E1 component subunit alpha [Rivularia 
sp. PCC 7116]
 gb|AFY53044.1| pyruvate dehydrogenase E1 component, alpha subunit [Rivularia 
sp. PCC 7116]
Length=344

 Score = 83.6 bits (205),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R   EK  + +RDPI     YL +  LA++EELK IE+KI   V+E+VE
Sbjct  263  RGHSLADPDEMRSKEEKEFWLSRDPIKKFAAYLVEQNLASQEELKDIERKIQATVDEAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FA+
Sbjct  323  FAQSSPEPDASELHRFIFAE  342


 Score = 76.3 bits (186),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPGV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMPGVEVDGMDVLAVRSVAQEAVLRARSGEGPTLIEALTYRFR  263



>ref|WP_012597993.1| pyruvate dehydrogenase E1 subunit alpha [Cyanothece sp. PCC 7424]
 gb|ACK69046.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanothece sp. PCC 7424]
Length=344

 Score = 87.8 bits (216),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  ++ARDPI+    +L ++ LAT+EEL  IEKK+ +++E++V+
Sbjct  263  RGHSLADPDELRSSDEKQFWSARDPISRFGSFLLEHDLATQEELTEIEKKVQKVIEDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA ESP P  ++L   +FA+
Sbjct  323  FAQESPEPDPSELRRYIFAE  342


 Score = 72.0 bits (175),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F +PGV VDGMDVL VR VA+EAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFDLPGVEVDGMDVLAVRNVAKEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_028083643.1| pyruvate dehydrogenase [Dolichospermum circinale]
Length=345

 Score = 87.4 bits (215),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL ++ LATE ELK +EKKI  +++E+V+
Sbjct  264  RGHSLADPDELRSKEEKEFWFARDPIKKLAAYLLEHDLATEAELKDVEKKIQAVIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAESSPEPDPSELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_015083169.1| pyruvate dehydrogenase E1 component subunit alpha [Anabaena sp. 
90]
 gb|AFW96613.1| pyruvate dehydrogenase E1 component subunit alpha [Anabaena sp. 
90]
Length=345

 Score = 87.4 bits (215),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R   EK  + ARDPI  L  YL +  LATE ELK IEKKI  ++E++V+
Sbjct  264  RGHSLADPDEMRSKEEKEFWFARDPIKKLAAYLLEQNLATEAELKDIEKKIQAVIEDAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FA+
Sbjct  324  FAQSSPEPDPSELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEALTYRFR  264



>dbj|BAQ64837.1| pyruvate dehydrogenase E1 component alpha subunit [Geminocystis 
sp. NIES-3709]
Length=344

 Score = 93.2 bits (230),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP EK  + ARDPI    KYL +N + T+ EL AI++K++E ++E+VE
Sbjct  264  RGHSLADPDELRDPQEKEFWNARDPIIKFAKYLTENNIVTQAELDAIDRKVEETIQEAVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAESSPEPDPSELYRYIFAE  343


 Score = 66.2 bits (160),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMD+L VR+VA++AI RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMEGYEVDGMDLLAVRDVAKKAIERARAGEGPTLIEALTYRFR  264



>ref|WP_017293986.1| pyruvate dehydrogenase E1 subunit alpha [Geminocystis herdmanii]
Length=344

 Score = 90.9 bits (224),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP EK  + ARDPI    KYL +N + T+ EL AI+KK+ + ++E+VE
Sbjct  264  RGHSLADPDELRDPQEKEFWNARDPIIKFAKYLTENNIVTQGELDAIDKKVQKTIDEAVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAEASPEPDPSELYRYIFAE  343


 Score = 68.6 bits (166),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMD+L VREVAQ AI RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMEGYEVDGMDLLAVREVAQRAIERARAGEGPTLIEALTYRFR  264



>ref|WP_039199282.1| pyruvate dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG43210.1| pyruvate dehydrogenase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=345

 Score = 87.0 bits (214),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL +  LATE ELK +EKKI  +++E+V 
Sbjct  264  RGHSLADPDELRSKEEKEFWFARDPIKKLAGYLLEQNLATEAELKDVEKKIQAVIDEAVR  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAETSPEPDPSELYRFIFAE  343


 Score = 72.4 bits (176),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_017306355.1| pyruvate dehydrogenase E1 subunit alpha [Spirulina subsalsa]
Length=347

 Score = 86.3 bits (212),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L   L +  LA+EE+LK I++KI  +V ESV+
Sbjct  268  RGHSLADPDELRSAPEKEFWLSRDPIKKLAGQLIERNLASEEDLKGIDQKIQNLVNESVK  327

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P  ++L   +FAD
Sbjct  328  FAEESPEPDPSELYRYIFAD  347


 Score = 73.2 bits (178),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGM GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  220  KKASVFGMVGVEVDGMDVLAVRKVAQEAVARARAGEGPTLIEALTYRFR  268



>ref|WP_030006129.1| pyruvate dehydrogenase [Synechococcus sp. NKBG042902]
Length=343

 Score = 86.3 bits (212),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDP+   +K++ +  LAT EELKAIEKK+  +V ESV 
Sbjct  263  RGHSLADPDELRSAEEKEFWAQRDPLKRFEKFVTNRGLATAEELKAIEKKVQAVVNESVT  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L + +FA+
Sbjct  323  FAESSPEPNPADLRKYIFAE  342


 Score = 73.2 bits (178),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL +R+VAQ+A+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMPGYEVDGMDVLAMRDVAQKAVARARAGEGPTLIEALTYRFR  263



>ref|WP_012411829.1| pyruvate dehydrogenase E1 subunit alpha [Nostoc punctiforme]
 gb|ACC83885.1| dehydrogenase, E1 component [Nostoc punctiforme PCC 73102]
Length=344

 Score = 86.7 bits (213),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + ARDPI  L  YL +  LA E E+KAI++KI ++++E+V+
Sbjct  263  RGHSLADPDEMRSKAEKEFWFARDPIKKLAAYLLEQNLANEGEIKAIDRKIQDVIDEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAESSPEPDPSELYRFVFAE  342


 Score = 72.4 bits (176),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AF M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASAFNMVGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015195309.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Stanieria cyanosphaera]
 gb|AFZ37655.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Stanieria cyanosphaera PCC 7437]
Length=343

 Score = 89.0 bits (219),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK ++A +DPI    KYL +N LA+ EELK I+KKI   ++E+V+
Sbjct  263  RGHSLADPDELRSPEEKEYWAEKDPIERFAKYLQNNSLASSEELKEIQKKIQAEIDEAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P+ ++L   +FA+
Sbjct  323  FAETSPEPSPSELHRYIFAE  342


 Score = 70.1 bits (170),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMDVL VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFDMAGYEVDGMDVLAVRAVAQEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_006276818.1| pyruvate dehydrogenase E1 subunit alpha [Cylindrospermopsis raciborskii]
 gb|EFA70237.1| Dehydrogenase, E1 component [Cylindrospermopsis raciborskii CS-505]
Length=345

 Score = 86.7 bits (213),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL ++ LA E +LK IEKKI  ++E++V 
Sbjct  264  RGHSLADPDELRSKEEKEFWFSRDPIKKLGAYLVEHNLAVESDLKQIEKKIQSLIEDAVS  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA ESP P  ++L   +FA+
Sbjct  324  FAQESPEPDSSELYRFIFAE  343


 Score = 72.0 bits (175),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_013321798.1| pyruvate dehydrogenase E1 subunit alpha [Cyanothece sp. PCC 7822]
 gb|ADN13691.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanothece sp. PCC 7822]
Length=344

 Score = 85.5 bits (210),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  ++ARDPI+ L  YL ++ LA++E+L  IEKK+  I+EE+V 
Sbjct  263  RGHSLADPDELRSSDEKQFWSARDPISRLGSYLLEHDLASQEDLTQIEKKVQGIIEEAVT  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA++S  P  ++L   +FA+
Sbjct  323  FAEQSKEPDPSELRRYIFAE  342


 Score = 73.6 bits (179),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F MPG+ VDGMDVL VR VA+EAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMPGIEVDGMDVLAVRTVAKEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_015221634.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Cyanobacterium stanieri]
 gb|AFZ46314.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanobacterium stanieri PCC 7202]
Length=341

 Score = 88.6 bits (218),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI    +YL +N + T+ EL AI+KK+ E +E++V+
Sbjct  263  RGHSLADPDELRDAKEKEFWNARDPIKKFAQYLTENNIVTQAELDAIDKKVMETIEDAVK  322

Query  628  FADESPVPARTQLLENVFA  572
            FA+ESP P  ++L + +FA
Sbjct  323  FAEESPEPDPSELYDYIFA  341


 Score = 70.5 bits (171),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMDVL VR+VAQ+AI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMEGYEVDGMDVLAVRDVAQKAIARARAGEGPTLIEALTYRFR  263



>ref|WP_025924769.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_495L20]
Length=357

 Score = 89.0 bits (219),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDPI  L + L DNKLATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKELWAKRDPIKKLAQELLDNKLATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A ++P P  T+L + ++A+
Sbjct  337  NAIDAPEPPSTELTKYIWAE  356


 Score = 69.7 bits (169),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYRF+
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRFR  277



>ref|WP_009343327.1| pyruvate dehydrogenase E1 subunit alpha [Raphidiopsis brookii]
 gb|EFA72806.1| Dehydrogenase, E1 component [Raphidiopsis brookii D9]
Length=345

 Score = 86.3 bits (212),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL ++ LA E +LK IEKKI  ++E++V 
Sbjct  264  RGHSLADPDELRSKEEKEFWFSRDPIKKLGAYLVEHNLAIESDLKQIEKKIQSLIEDAVS  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA ESP P  ++L   +FA+
Sbjct  324  FAQESPEPDSSELYRFIFAE  343


 Score = 72.0 bits (175),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_026103513.1| pyruvate dehydrogenase [Pseudanabaena sp. PCC 6802]
Length=341

 Score = 80.9 bits (198),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI      L ++ LA+E++LK I+KKI  IVEESV 
Sbjct  260  RGHSLADPDELRPKEEKDEWFGRDPIEIFASKLMEHGLASEKQLKEIDKKIQTIVEESVR  319

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P+  +L    FA+
Sbjct  320  FAEQSPEPSPDELYRYQFAE  339


 Score = 77.4 bits (189),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGMPG  VDGMDVL VR+ AQEAI RAR GEGPTL+EC TYRF+
Sbjct  212  KKAAAFGMPGYEVDGMDVLAVRKYAQEAIRRARAGEGPTLLECMTYRFR  260



>ref|WP_015147267.1| pyruvate dehydrogenase E1 component subunit alpha [Oscillatoria 
acuminata]
 gb|AFY80617.1| pyruvate dehydrogenase E1 component, alpha subunit [Oscillatoria 
acuminata PCC 6304]
Length=343

 Score = 89.0 bits (219),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL +  LAT EELK IE KI  IV+ESV+
Sbjct  263  RGHSLADPDELRSKEEKEFWLSRDPIKQLSAYLTEKNLATAEELKEIENKIQAIVDESVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAENSPEPDPSELYRYVFAE  342


 Score = 69.3 bits (168),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VR  A EA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKAAAFGMVGVEVDGMDVLAVRTAALEAVERARAGEGPTLIEAMTYRFR  263



>ref|WP_009787238.1| pyruvate dehydrogenase E1 subunit alpha [Lyngbya sp. PCC 8106]
 gb|EAW34150.1| Dehydrogenase, E1 component [Lyngbya sp. PCC 8106]
Length=346

 Score = 82.0 bits (201),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + +RDPI  L  YL +  LA+ E+LK I+ KI  +V+++VE
Sbjct  265  RGHSLADPDELRDQEEKDFWFSRDPIKKLANYLIEKNLASAEQLKEIDHKIQAVVDDAVE  324

Query  628  FADESPVPARTQLLENVFADPR  563
            FA+ S  P  ++L   VFA+ +
Sbjct  325  FAESSSEPDPSELYRFVFAEDK  346


 Score = 75.9 bits (185),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMD+L V  +A+EA+ RAR GEGPTL+E  TYRF+
Sbjct  217  KKGPAFGMPGYEVDGMDILAVHTLAKEAVARARAGEGPTLIEALTYRFR  265



>ref|WP_027404647.1| pyruvate dehydrogenase [Aphanizomenon flos-aquae]
Length=345

 Score = 87.0 bits (214),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL +  LATE ELK +EKKI  +++E+V 
Sbjct  264  RGHSLADPDELRSKEEKEFWFARDPIKKLAGYLLEQNLATEAELKDVEKKIQAVIDEAVR  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAETSPEPDPSELYRFIFAE  343


 Score = 70.5 bits (171),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD L VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDALAVRQVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_006197352.1| pyruvate dehydrogenase E1 subunit alpha [Nodularia spumigena]
 gb|EAW44452.1| Dehydrogenase, E1 component [Nodularia spumigena CCY9414]
 gb|AHJ26929.1| Pyruvate dehydrogenase E1 component alpha subunit [Nodularia 
spumigena CCY9414]
Length=344

 Score = 85.9 bits (211),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + +RDPI  L  YL +  LA + ELKAI++KI E+++E+V+
Sbjct  263  RGHSLADPDEMRSKAEKEFWFSRDPIKKLAAYLLEQNLADDAELKAIDRKIQEVIDEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAESSPEPDPSELYRFVFAE  342


 Score = 71.2 bits (173),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_023064139.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Lyngbya aestuarii]
 gb|ERT09639.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Lyngbya aestuarii BL J]
Length=346

 Score = 82.0 bits (201),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + +RDPI  L  YL +  LA+ E+LK I++KI  +V+++VE
Sbjct  265  RGHSLADPDELRDQEEKEFWFSRDPIKKLANYLIEKDLASAEQLKEIDQKIQAVVDDAVE  324

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ S  P  ++L   VFA+
Sbjct  325  FAESSSEPDPSELYRFVFAE  344


 Score = 75.1 bits (183),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMD+L V  +A+EA+ RAR GEGPTL+E  TYRF+
Sbjct  217  KKGPAFGMPGYEVDGMDILAVHTLAKEAVTRARAGEGPTLIEALTYRFR  265



>ref|WP_015169202.1| pyruvate dehydrogenase E1 component subunit alpha [Synechococcus 
sp. PCC 7502]
 gb|AFY74547.1| pyruvate dehydrogenase E1 component, alpha subunit [Synechococcus 
sp. PCC 7502]
Length=337

 Score = 80.5 bits (197),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  +  RDPI  L   L    L +E+ELKAI+KKI  +VE+SV+
Sbjct  256  RGHSLADPDELRPKTEKDEWFGRDPIKILAAKLLSAGLTSEQELKAIDKKIQTLVEDSVK  315

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P+  +L    FA+
Sbjct  316  FAESSPEPSPDELYRFQFAE  335


 Score = 77.0 bits (188),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL VR+V QEAI RAR GEGPTL+EC TYRF+
Sbjct  208  KKAAVFGMPGFEVDGMDVLAVRQVTQEAIRRARAGEGPTLLECMTYRFR  256



>ref|WP_017653143.1| pyruvate dehydrogenase E1 subunit alpha [Microchaete sp. PCC 
7126]
Length=344

 Score = 86.3 bits (212),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + ARDPI  L  YL +  LA +EELKAIE KI  +++++V+
Sbjct  263  RGHSLADPDEMRSKAEKEFWFARDPIKKLGAYLIEQNLADQEELKAIEHKIQAVIDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAESSPEPDPSELYRFVFAE  342


 Score = 70.9 bits (172),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015111181.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Nostoc sp. PCC 7107]
 gb|AFY40939.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Nostoc sp. PCC 7107]
Length=344

 Score = 87.4 bits (215),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + +RDPI  L  Y+ +  LA+E ELKAI++KI E+++E+V+
Sbjct  263  RGHSLADPDELRSKAEKEFWFSRDPIKKLAAYMVEQNLASEAELKAIDQKIQEVIDEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAESSPEPDPSELYRFIFAE  342


 Score = 69.7 bits (169),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL V  VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVHSVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_006454326.1| pyruvate dehydrogenase E1 subunit alpha [Synechococcus sp. PCC 
7335]
 gb|EDX84579.1| pyruvate dehydrogenase E1 component, alpha subunit [Synechococcus 
sp. PCC 7335]
Length=342

 Score = 85.9 bits (211),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHS+ADPDELRDP EK  +  RDPI   + YL +  L +E ELKA+  KI ++VE+S+ 
Sbjct  262  RGHSVADPDELRDPDEKKFWRDRDPIKRFEAYLLEQSLVSEAELKAVRDKITDVVEDSLT  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P+   L + +FA+
Sbjct  322  FAEESPNPSPDDLYKYIFAE  341


 Score = 71.2 bits (173),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL VR  A+ AI RAR GEGPTL+EC TYR++
Sbjct  214  KKASVFGMPGYEVDGMDVLAVRAAAKTAIDRARAGEGPTLLECLTYRYR  262



>ref|WP_041035191.1| pyruvate dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ77533.1| pyruvate dehydrogenase [Tolypothrix campylonemoides VB511288]
Length=345

 Score = 85.9 bits (211),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI     Y+ +  LA+ EELKA++ KI ++++E+V+
Sbjct  264  RGHSLADPDELRSKAEKEFWFARDPIKKFAAYMVEQNLASHEELKAVDHKIQQVIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAENSPEPDPSELYRFVFAE  343


 Score = 71.2 bits (173),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD+L VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMAGVEVDGMDILAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_015188060.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Gloeocapsa sp. PCC 7428]
 gb|AFZ30185.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Gloeocapsa sp. PCC 7428]
Length=343

 Score = 82.4 bits (202),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL +  LA++ ELK IE+KI + ++E+V+
Sbjct  263  RGHSLADPDELRSKDEKEFWFARDPIKKLAAYLTEQNLASQAELKQIEQKIQQEIDEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P   +L   +FA+
Sbjct  323  FAESSPEPDPNELYRYIFAE  342


 Score = 74.3 bits (181),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGM GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFGMAGVEVDGMDVLAVRQVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015124179.1| pyruvate dehydrogenase E1 component subunit alpha [Synechococcus 
sp. PCC 6312]
 gb|AFY60635.1| pyruvate dehydrogenase E1 component, alpha subunit [Synechococcus 
sp. PCC 6312]
Length=346

 Score = 85.1 bits (209),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L  Y+ + KLAT  ELK I+ KI  +V+++VE
Sbjct  267  RGHSLADPDELRSKEEKDFWFTRDPIKKLAAYMIEKKLATAAELKDIDNKIQAVVDDAVE  326

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FAD
Sbjct  327  FAEASPEPDTSELHHYIFAD  346


 Score = 72.0 bits (175),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +KG AFG+ GV VDGMDVL VR VA+EA+ RAR GEGPTL+E  TYRF+
Sbjct  219  QKGKAFGIVGVEVDGMDVLAVRAVAKEAVARARAGEGPTLIEALTYRFR  267



>ref|WP_010996861.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Nostocaceae]
 dbj|BAB74407.1| pyruvate dehydrogenase E1 component, alpha subunit [Nostoc sp. 
PCC 7120]
 gb|ABA23875.1| Dehydrogenase, E1 component [Anabaena variabilis ATCC 29413]
Length=344

 Score = 85.5 bits (210),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + +RDPI  L  YL +  LA E ELKAIE+KI ++++++V+
Sbjct  263  RGHSLADPDEMRSKAEKEFWFSRDPIKKLAAYLIEQNLADEAELKAIERKIQDVIDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  323  FAESSPEPDPSELYRFVFAE  342


 Score = 71.2 bits (173),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015205680.1| pyruvate dehydrogenase E1 component, alpha subunit [Cylindrospermum 
stagnale]
 gb|AFZ22421.1| pyruvate dehydrogenase E1 component, alpha subunit [Cylindrospermum 
stagnale PCC 7417]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI  L   L + KL  E ELKAIE+KI  +++E+V+
Sbjct  264  RGHSLADPDELRSKAEKDFWFARDPIKKLAADLLEKKLVDEAELKAIERKIQAVIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPDPSELYRFVFAE  343


 Score = 72.0 bits (175),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMAGVEVDGMDVLAVRAVAQEAVARARAGEGPTLIEAMTYRFR  264



>ref|WP_045874564.1| pyruvate dehydrogenase [Tolypothrix sp. PCC 7601]
 gb|EKE96916.1| pyruvate dehydrogenase E1 component, alpha subunit [Tolypothrix 
sp. PCC 7601]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI  L  YL ++ L+ +EELK I++KI  +++++V+
Sbjct  264  RGHSLADPDELRSKAEKEFWFARDPIKKLAAYLVEHNLSDQEELKGIDRKIQGVIDDAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPDPSELYRFVFAE  343


 Score = 72.0 bits (175),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AF M GV VDGMDVL VR VAQEA+ RAR GEGPT++E  TYRF+
Sbjct  216  KKASAFNMAGVEVDGMDVLAVRAVAQEAVARARAGEGPTVIEALTYRFR  264



>ref|NP_053877.1| pyruvate dehydrogenase E1 component alpha subunit [Porphyra purpurea]
 sp|P51267.1|ODPA_PORPU RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha 
(chloroplast) [Porphyra purpurea]
 gb|AAC08153.1| pyruvate dehydrogenase E1 component, alpha subunit (chloroplast) 
[Porphyra purpurea]
Length=344

 Score = 82.4 bits (202),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKK++ DN++A+ +EL  I+  +   +E+SVE
Sbjct  264  RGHSLADPDELRSRQEKEAWVARDPIKKLKKHILDNQIASSDELNDIQSSVKIDLEQSVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FAD
Sbjct  324  FAMSSPEPNISELKRYLFAD  343


 Score = 73.2 bits (178),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDVL VR+VA++A+ RAR+G+GPTL+E  TYRF+
Sbjct  216  KKAEAFGLPGIEVDGMDVLAVRQVAEKAVERARQGQGPTLIEALTYRFR  264



>ref|WP_039728256.1| MULTISPECIES: pyruvate dehydrogenase [Oscillatoriophycideae]
 gb|KIF15958.1| pyruvate dehydrogenase [Aphanocapsa montana BDHKU210001]
 gb|KIF40882.1| pyruvate dehydrogenase [Lyngbya confervoides BDU141951]
Length=342

 Score = 80.5 bits (197),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDP+   + YL   KL   EELKAI  KI ++V+++V 
Sbjct  262  RGHSLADPDELRTKEEKEEWLSRDPLKRFETYLLGQKLVKAEELKAIRDKIQQVVDDAVT  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P  ++L   +FA+
Sbjct  322  FAEQSPEPDPSELRRYIFAE  341


 Score = 75.1 bits (183),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPGV VDGMDVL VR+ A+ A+ RAR GEGPTL+EC TYRF+
Sbjct  214  KKASVFGMPGVEVDGMDVLAVRDAAKTAVDRARAGEGPTLIECLTYRFR  262



>ref|YP_009027551.1| pyruvate dehydrogenase E1 component, alpha subunit [Pyropia perforata]
 gb|AGQ17089.1| pyruvate dehydrogenase E1 component, alpha subunit [Pyropia perforata]
 gb|AHB35045.1| pyruvate dehydrogenase E1 component alpha subunit (chloroplast) 
[Pyropia perforata]
 gb|AHB35254.1| pyruvate dehydrogenase E1 component alpha subunit (chloroplast) 
[Pyropia perforata]
 gb|AIA19416.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA19625.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA19834.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA20043.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA20252.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA20461.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA20670.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA20879.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
 gb|AIA21088.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia perforata]
Length=344

 Score = 82.8 bits (203),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LK+Y+ DNK+A  +EL  I+  + + +EESVE
Sbjct  264  RGHSLADPDELRSRQEKEAWIARDPIKKLKQYILDNKIADIDELNQIQTDVKKELEESVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +F+D
Sbjct  324  FAISSPEPNISELKRYLFSD  343


 Score = 72.4 bits (176),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PGV VDGMDVL VR+ A +A+ RAR+GEGPTL+E  TYRF+
Sbjct  216  KKAEAFGLPGVEVDGMDVLAVRQAAIQAVQRARQGEGPTLIEALTYRFR  264



>gb|KIJ81314.1| pyruvate dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=345

 Score = 85.1 bits (209),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI  L  YL +  LA+ EELKAI+++I + ++E+V+
Sbjct  264  RGHSLADPDELRSKAEKEFWFARDPIKKLATYLVEQNLASGEELKAIDRQIQQEIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPNPSELYRFVFAE  343


 Score = 70.1 bits (170),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K   F M GV VDGMD+L VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  RKASVFNMAGVEVDGMDILAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_017316476.1| pyruvate dehydrogenase E1 subunit alpha [Mastigocladopsis repens]
Length=345

 Score = 85.5 bits (210),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R  +EK  + ARDP+     YL +  L + EELKAI++++ ++++E+V+
Sbjct  264  RGHSLADPDEMRSKAEKEFWFARDPVKKFAAYLVEQNLTSHEELKAIDRQVQQVIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P +++L   VFA+
Sbjct  324  FAESSPEPDKSELYRFVFAE  343


 Score = 69.3 bits (168),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K   F M GV VDGMD+L VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  QKASVFNMVGVEVDGMDILAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>gb|AFC39936.1| pyruvate dehydrogenase E1 component alpha subunit [Porphyra umbilicalis]
Length=344

 Score = 80.9 bits (198),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKKY+ DNK+A   EL  I+  +   +++SVE
Sbjct  264  RGHSLADPDELRSRQEKEAWVARDPIKKLKKYILDNKIADLNELNDIQSAVKIDLQKSVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   +FAD
Sbjct  324  FAMSSPEPNILELKRYLFAD  343


 Score = 74.3 bits (181),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PGV VDGMDVL VR+VA++A+ RAR+G+GPTL+E  TYRF+
Sbjct  216  KKAEAFGLPGVEVDGMDVLAVRQVAEKAVKRARQGQGPTLIEALTYRFR  264



>ref|WP_011614263.1| pyruvate dehydrogenase E1 subunit alpha [Trichodesmium erythraeum]
 gb|ABG53970.1| Pyruvate dehydrogenase (lipoamide) [Trichodesmium erythraeum 
IMS101]
Length=343

 Score = 83.6 bits (205),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK ++ +RDPI     YL +N L    EL AI+KKI+ ++ E+V+
Sbjct  263  RGHSLADPDELRDQEEKQYWFSRDPIKKFTTYLTENNLVDVAELVAIDKKIENLITEAVD  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   +FA+
Sbjct  323  FATNSPEPGSDELYRYIFAE  342


 Score = 70.9 bits (172),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMD+L V   AQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKAHAFGMVGVEVDGMDILAVHSAAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_040055045.1| pyruvate dehydrogenase [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41119.1| pyruvate dehydrogenase E1 component, alpha subunit [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=343

 Score = 82.8 bits (203),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  +DPI  L  YL    +A + EL AI+KK+ E+++++VE
Sbjct  263  RGHSLADPDELRKSDEKKFWEQKDPIQKLSNYLISQNIANQAELDAIQKKVKEVIDDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P   +L   VF +
Sbjct  323  FAEQSPEPKANELYRYVFVE  342


 Score = 71.6 bits (174),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VA+EAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKAAVFNMVGVEVDGMDVLAVRQVAKEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_012626468.1| pyruvate dehydrogenase E1 subunit alpha [Cyanothece sp. PCC 7425]
 gb|ACL43370.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Cyanothece sp. PCC 7425]
Length=342

 Score = 84.3 bits (207),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  SEK  + ARDPI     YL +  LA ++ELKAI+KKI  ++E++V+
Sbjct  262  RGHSLADPDELRSKSEKETWLARDPIKKFAAYLVEQNLAQDKELKAIDKKIQAVIEDAVK  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P   +L   VF +
Sbjct  322  FAETSPEPDPKELYRYVFVE  341


 Score = 70.1 bits (170),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  214  KKAEVFNMHGVEVDGMDVMAVRSVAQEAIRRARAGEGPTLIEALTYRFR  262



>ref|WP_008231351.1| Pyruvate dehydrogenase E1 component alpha subunit [Richelia intracellularis]
 emb|CCH66169.1| Pyruvate dehydrogenase E1 component alpha subunit [Richelia intracellularis 
HH01]
Length=342

 Score = 85.5 bits (210),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  SEK  +  RDPI     Y+ +  LAT+EELKAI+ +I E++EE+VE
Sbjct  264  RGHSLADPDELRSKSEKEEWLLRDPIKKFAAYVTEIGLATQEELKAIDIQIQELIEEAVE  323

Query  628  FADESPVPARTQLLENVFA  572
            FA+ SP P    L   VFA
Sbjct  324  FAESSPEPDAQDLYRFVFA  342


 Score = 68.9 bits (167),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEA+ RAR G+GPTL+E  TYRF+
Sbjct  216  KKATMFNMTGVEVDGMDVIAVRAVAQEAVARARAGDGPTLIEALTYRFR  264



>dbj|BAQ62043.1| pyruvate dehydrogenase E1 component alpha subunit [Geminocystis 
sp. NIES-3708]
Length=342

 Score = 85.1 bits (209),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD +EK  + ARDPI     YL +N + ++ EL AI+KK+ + ++E+VE
Sbjct  262  RGHSLADPDELRDATEKEFWNARDPIKKFATYLTENNIVSQTELDAIDKKVQQDIDEAVE  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  322  FAEASPEPDPSELYRYIFAE  341


 Score = 69.3 bits (168),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M G  VDGMD+L VR+VAQ+AI RAR GEGPTL+E  TYRF+
Sbjct  214  KKASVFNMEGYEVDGMDLLAVRDVAQKAIARARAGEGPTLIEALTYRFR  262



>ref|WP_009631809.1| pyruvate dehydrogenase E1 component, alpha subunit [Synechocystis 
sp. PCC 7509]
Length=345

 Score = 84.7 bits (208),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL ++ LA+E ELK IE KI+++++E+V+
Sbjct  264  RGHSLADPDELRAKEEKDFWFSRDPIKKLAAYLTEHNLASESELKEIEGKINQVIDEAVK  323

Query  628  FADESPVPARTQLLENVFADPR  563
            FA+ SP P+  +L   +FA+ +
Sbjct  324  FAETSPEPSPEELYRFIFAEDK  345


 Score = 69.7 bits (169),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VR  A EA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKAHAFGMAGVEVDGMDVLAVRAAATEAVERARAGEGPTLIEALTYRFR  264



>gb|AIA21296.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia kanakaensis]
Length=344

 Score = 82.0 bits (201),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKKY+ DNK+A   EL  I+  + + +E+SVE
Sbjct  264  RGHSLADPDELRSRQEKEAWIARDPIKNLKKYILDNKIADISELNDIQTIVKKELEQSVE  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +F+D
Sbjct  324  FAISSPEPNISELKRYLFSD  343


 Score = 72.4 bits (176),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDV+ VR+ A +A+ RAR+GEGPTL+E  TYRF+
Sbjct  216  KKAEAFGLPGIEVDGMDVIAVRQAASQAVHRARQGEGPTLIEALTYRFR  264



>ref|WP_015182305.1| pyruvate dehydrogenase E1 component subunit alpha [Microcoleus 
sp. PCC 7113]
 gb|AFZ18155.1| pyruvate dehydrogenase E1 component, alpha subunit [Microcoleus 
sp. PCC 7113]
Length=344

 Score = 78.2 bits (191),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  +DPI  L  YL ++ LA +EEL  I+ +I E++ ++V+
Sbjct  263  RGHSLADPDELRSKEEKEFWFPKDPIKKLAAYLTEHNLADQEELSGIDHRIQEVINDAVQ  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAESSPEPDPSELYRYIFAE  342


 Score = 75.5 bits (184),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VR VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKAAAFGMAGVEVDGMDVLAVRAVAQEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_016868968.1| pyruvate dehydrogenase E1 subunit alpha [Fischerella muscicola]
Length=344

 Score = 84.0 bits (206),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI     YL +  LAT EELK I++KI + +EE+V+
Sbjct  264  RGHSLADPDELRSKDEKEFWFARDPIKKFAAYLTERNLATTEELKEIDRKIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPDPSELYRYVFAE  343


 Score = 69.7 bits (169),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_007355519.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Kamptonema]
 emb|CBN56307.1| pyruvate dehydrogenase (lipoamide) [ [[Oscillatoria] sp. PCC 
6506]
Length=344

 Score = 78.6 bits (192),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++  RDPI  L   L +  LAT EELK IE+KI  +V+++VE
Sbjct  263  RGHSLADPDELRSKEEKEYWFPRDPIKKLAADLTERNLATVEELKEIEQKIQALVDDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P  ++L   ++A+
Sbjct  323  FAEKSPEPDPSELYRFIYAE  342


 Score = 75.1 bits (183),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM G  VDGMDVL VREVAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKAHAFGMAGFEVDGMDVLAVREVAQEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_015135286.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Leptolyngbya sp. PCC 7376]
 gb|AFY39541.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Leptolyngbya sp. PCC 7376]
Length=342

 Score = 82.0 bits (201),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A +DPI   + ++   KLAT EELKAI  KI   V ESV 
Sbjct  263  RGHSLADPDELRSADEKEFWAKKDPITQFESFILGRKLATAEELKAIADKIQAEVNESVT  322

Query  628  FADESPVPARTQLLENVFAD  569
            +A+ SP P  ++L + +FAD
Sbjct  323  YAESSPEPDPSELRKYIFAD  342


 Score = 71.6 bits (174),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F MPG  VDGMDVL +R+VAQ+A+ RAR GEGPTLVE  TYRF+
Sbjct  215  KKASVFNMPGYEVDGMDVLAMRDVAQKAVARARAGEGPTLVEALTYRFR  263



>ref|WP_009756662.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Fischerella]
 gb|EHC16226.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Fischerella sp. JSC-11]
Length=344

 Score = 84.0 bits (206),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI     YL +  LAT EELK I++KI + +EE+V+
Sbjct  264  RGHSLADPDELRSKDEKEFWFARDPIKKFAAYLTERNLATAEELKEIDRKIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPDPSELYRYVFAE  343


 Score = 69.7 bits (169),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD++ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDIMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_016873792.1| pyruvate dehydrogenase E1 subunit alpha [Chlorogloeopsis fritschii]
Length=344

 Score = 83.6 bits (205),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI     YL +  LAT+EELK I++ I + ++E+V+
Sbjct  264  RGHSLADPDELRSKTEKEFWFARDPIKKFAAYLTEQNLATDEELKQIDRHIQQEIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P+ ++L   +FA+
Sbjct  324  FAETSPEPSPSELYRYIFAE  343


 Score = 69.7 bits (169),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|YP_007947796.1| pyruvate dehydrogenase E1 component alpha subunit (chloroplast) 
[Pyropia haitanensis]
 gb|AGG37045.1| pyruvate dehydrogenase E1 component alpha subunit (chloroplast) 
[Pyropia haitanensis]
Length=344

 Score = 82.0 bits (201),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKKY+ DNK+A   EL  I+  + + +E+SV+
Sbjct  264  RGHSLADPDELRSRQEKEAWIARDPIKKLKKYILDNKIADISELNEIQTAVKKDLEQSVQ  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +F+D
Sbjct  324  FAISSPEPNISELKRYLFSD  343


 Score = 71.2 bits (173),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDVL VR+ A +A+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKAEAFGLPGMEVDGMDVLAVRQAAIQAVQRARHGEGPTLIEALTYRFR  264



>ref|WP_029985298.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_498B23]
Length=345

 Score = 85.1 bits (209),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++AD
Sbjct  325  NAIEAPEPPSEELTKYIWAD  344


 Score = 68.2 bits (165),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_015199024.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Calothrix parietina]
 gb|AFZ02397.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Calothrix sp. PCC 6303]
Length=344

 Score = 85.1 bits (209),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L   L D  LAT EELKAI+KKI   VEESV 
Sbjct  263  RGHSLADPDELRSKEEKEFWLARDPIKKLAGQLVDMNLATAEELKAIDKKIQLEVEESVT  322

Query  628  FADESPVPARTQLLENVFADPR  563
            FA+ SP P   +L   +FA+ +
Sbjct  323  FAESSPEPDPRELYRYIFAEDK  344


 Score = 68.2 bits (165),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F MPGV VDGMDVL V   A+EA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMPGVEVDGMDVLAVYTTAKEAVRRARAGEGPTLIEALTYRFR  263



>ref|WP_035153086.1| pyruvate dehydrogenase [Calothrix sp. 336/3]
 gb|KFB83481.1| pyruvate dehydrogenase [Calothrix sp. 336/3]
Length=345

 Score = 84.7 bits (208),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI  L  YL +  LAT  ELKAI++KI E +EE+V+
Sbjct  264  RGHSLADPDELRSKEEKDFWFSRDPIKKLATYLTEQNLATAAELKAIDQKIQENIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  324  FAESSPEPDPSELYRFIFAE  343


 Score = 68.2 bits (165),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VA EA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVLAVRQVALEAVRRARAGEGPTLIEALTYRFR  264



>ref|XP_006837866.2| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha-3, 
chloroplastic isoform X2 [Amborella trichopoda]
Length=282

 Score = 93.6 bits (231),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETY  816
            KKGPAFGMPG+HVDGMDVLKVREVA+EAIGRARRGEGPTLVECE Y
Sbjct  185  KKGPAFGMPGIHVDGMDVLKVREVAKEAIGRARRGEGPTLVECEAY  230


 Score = 59.3 bits (142),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -2

Query  808  RGHSLADPDELRD---PSEKSHYAARDPIAALKKYLFDNKLATEEELKAI  668
            RGHS+ DPDE  D    +EK+HY  RDPI ALKKY+ + KL+ E ELKAI
Sbjct  233  RGHSVLDPDEPPDRVVAAEKAHYVTRDPIKALKKYIVEKKLSNESELKAI  282



>ref|YP_536948.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia yezoensis]
 sp|Q1XDM0.1|ODPA_PYRYE RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha 
(chloroplast) [Pyropia yezoensis]
 dbj|BAE92391.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia yezoensis]
 gb|AGH27592.1| pyruvate dehydrogenase E1 component alpha subunit (chloroplast) 
[Pyropia yezoensis]
Length=346

 Score = 80.5 bits (197),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKKY+ DN++A   EL  I+  +   +E++V+
Sbjct  266  RGHSLADPDELRSRQEKEAWVARDPIKKLKKYILDNEIANIGELNEIQNAVKTELEQAVK  325

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FAD
Sbjct  326  FAISSPEPNMSELKRYLFAD  345


 Score = 72.4 bits (176),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDVL VR+ A++A+ RAR+G+GPTL+E  TYRF+
Sbjct  218  KKAEAFGLPGIEVDGMDVLAVRQAAKQAVQRARQGDGPTLIEALTYRFR  266



>ref|WP_029981554.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_518I6]
Length=345

 Score = 83.6 bits (205),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 69.3 bits (168),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYRF+
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRFR  265



>ref|WP_025973497.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_528P18]
Length=357

 Score = 84.7 bits (208),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATE+ELK IEKKIDE + ESV+
Sbjct  277  RGHSLADPDELRSEEEKEFWGKRDPIKKLAKEIIDGKFATEQELKIIEKKIDEEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSQELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>emb|CDJ27426.1| pyruvate dehydrogenase, putative [Eimeria mitis]
Length=679

 Score = 82.0 bits (201),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK+ +A RDPI   ++Y+ +   A EE L+   KK+ EIV+E+VE
Sbjct  546  RGHSLADPDELRCTHEKAAFAVRDPIKHFEQYMLEMGYANEETLELTRKKMREIVDEAVE  605

Query  628  FADESPVPARTQLLENVFA---DPRGF  557
            FAD SP P  T   +  FA   + +GF
Sbjct  606  FADNSPAPDPTTAGDTTFAPAYEAKGF  632


 Score = 70.9 bits (172),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            ++GP FG+P + VDGMDVL VR  A++AI RARRGEGP+L+E  TYRF+
Sbjct  498  QRGPPFGVPSIEVDGMDVLAVRAAARQAIDRARRGEGPSLIEALTYRFR  546



>ref|WP_040898162.1| pyruvate dehydrogenase [Xenococcus sp. PCC 7305]
Length=343

 Score = 83.2 bits (204),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++A +DPI     YL   KLAT +ELK ++KK+ EI+ ++V 
Sbjct  263  RGHSLADPDELRSAEEKEYWATKDPITRFADYLTKQKLATAQELKDLDKKVQEIINDAVA  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAESSPEPDPSELRRYIFAE  342


 Score = 69.3 bits (168),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR  AQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFSMAGVEVDGMDVLAVRAAAQEAVERARAGEGPTLIEALTYRFR  263



>ref|WP_025957935.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_518J7]
Length=357

 Score = 84.3 bits (207),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWAKRDPIKKLAKEIVDGKFATEEELKIIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>gb|ELS02452.1| pyruvate dehydrogenase E1 component, alpha subunit [Xenococcus 
sp. PCC 7305]
Length=377

 Score = 83.2 bits (204),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++A +DPI     YL   KLAT +ELK ++KK+ EI+ ++V 
Sbjct  297  RGHSLADPDELRSAEEKEYWATKDPITRFADYLTKQKLATAQELKDLDKKVQEIINDAVA  356

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  357  FAESSPEPDPSELRRYIFAE  376


 Score = 69.7 bits (169),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR  AQEA+ RAR GEGPTL+E  TYRF+
Sbjct  249  KKASVFSMAGVEVDGMDVLAVRAAAQEAVERARAGEGPTLIEALTYRFR  297



>ref|WP_009546784.1| MULTISPECIES: pyruvate dehydrogenase E1 subunit alpha [Cyanothece]
 gb|ACB49643.1| pyruvate dehydrogenase E1 component alpha subunit [Cyanothece 
sp. ATCC 51142]
Length=343

 Score = 80.9 bits (198),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK  + ++DPI  L+ YL ++ LA + EL  I++K+   V+++V+
Sbjct  263  RGHSLADPDELRSPDEKQFWGSKDPIQRLEAYLIEHNLANQSELDEIKQKVQASVDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P   +L   VFA+
Sbjct  323  FAEESPEPDPKELYRYVFAE  342


 Score = 71.6 bits (174),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEAI RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFDMVGVEVDGMDVLAVRKVAQEAIARARAGEGPTLIEALTYRFR  263



>ref|WP_025939676.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_520B18]
Length=357

 Score = 84.3 bits (207),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWAKRDPIKKLAKEIVDGKFATEEELKIIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_017662830.1| pyruvate dehydrogenase E1 subunit alpha [Geitlerinema sp. PCC 
7105]
Length=344

 Score = 84.0 bits (206),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI   + YL +  LA+ EELK I+KKI E++++SVE
Sbjct  263  RGHSLADPDELRSKEEKEIWFSRDPIHRFENYLTEENLASAEELKDIQKKIQEVIDDSVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAESSPEPDPSELRRFIFAE  342


 Score = 68.6 bits (166),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR  AQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMAGVEVDGMDVMAVRAAAQEAVDRARAGEGPTLIEALTYRFR  263



>ref|WP_037216252.1| pyruvate dehydrogenase [Richelia intracellularis]
 emb|CDN10094.1| Pyruvate dehydrogenase E1 component alpha subunit [Richelia intracellularis]
Length=345

 Score = 81.3 bits (199),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI     Y+ +  L T+EELKAI+++I E+++E+V+
Sbjct  264  RGHSLADPDELRSKWEKEEWFSRDPIKKFAAYVTEQNLVTQEELKAIDRQIQELIDEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L   VFA+
Sbjct  324  FAEISPEPDARDLYRFVFAE  343


 Score = 70.9 bits (172),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMAGVEVDGMDVMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_032518250.1| pyruvate dehydrogenase [Prochlorococcus marinus]
 gb|KGG02795.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
marinus str. MIT 9321]
 gb|KGG05428.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
marinus str. MIT 9322]
 gb|KGG09402.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
marinus str. MIT 9401]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +A RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKGFWAKRDPIKKLAQEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMQGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_016860018.1| pyruvate dehydrogenase E1 subunit alpha [Fischerella muscicola]
Length=345

 Score = 83.2 bits (204),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++ +RDPI     YL +  LAT EELK I++KI + +EE+V+
Sbjct  264  RGHSLADPDELRTKDEKEYWFSRDPIKKFAAYLTERNLATAEELKEIDRKIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFADPR  563
            FA+ SP P  ++L   +FA+ +
Sbjct  324  FAESSPEPDPSELYRYIFAEDK  345


 Score = 68.9 bits (167),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD++ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDLMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|XP_003626604.1| Pyruvate dehydrogenase E1 component subunit alpha [Medicago truncatula]
Length=136

 Score = 98.2 bits (243),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGP FGMPGVHVDGMDVLKVR+VA+EAIGRARRGEGPTL+ECETYRF+
Sbjct  33   KKGPTFGMPGVHVDGMDVLKVRQVAKEAIGRARRGEGPTLIECETYRFR  81


 Score = 53.9 bits (128),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 15/54 (28%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEI  647
            RGHSLADPDEL +P E  HY               NKLA+E+ELK IEKKI +I
Sbjct  81   RGHSLADPDELCNPGEHLHY---------------NKLASEQELKTIEKKIQQI  119



>gb|AIA21502.1| pyruvate dehydrogenase E1 component alpha subunit [Pyropia fucicola]
Length=346

 Score = 79.3 bits (194),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LKKY+ DN++A   EL  I+  +   +E++V+
Sbjct  266  RGHSLADPDELRSRQEKEAWVARDPIKKLKKYILDNEIADIGELNQIQTAVKTELEQAVK  325

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P  ++L   +FAD
Sbjct  326  FAISSPEPNISELKRYLFAD  345


 Score = 72.8 bits (177),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDVL VR+ A++A+ RAR+G+GPTL+E  TYRF+
Sbjct  218  KKAEAFGLPGIEVDGMDVLAVRQAAKQAVQRARKGDGPTLIEALTYRFR  266



>ref|WP_011142838.1| pyruvate dehydrogenase E1 subunit alpha [Gloeobacter violaceus]
 ref|NP_925790.1| pyruvate dehydrogenase E1 alpha-subunit [Gloeobacter violaceus 
PCC 7421]
 dbj|BAC90785.1| pyruvate dehydrogenase E1 alpha-subunit [Gloeobacter violaceus 
PCC 7421]
Length=331

 Score = 77.4 bits (189),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK+H+  +DP+  L+ +L +  LA+ E+LK IE+++   V+++V+
Sbjct  250  RGHSLADPDELRDPAEKAHWRKQDPLPRLRVWLEEQGLASVEDLKRIEQEVRAEVDDAVQ  309

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P   +L    FA+
Sbjct  310  FAEDSPEPPLDELYRFQFAE  329


 Score = 74.7 bits (182),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PGV VDGMDVL VR VA+EA+ RAR G GPTL+EC TYRF+
Sbjct  202  KKADAFGIPGVRVDGMDVLAVRAVAKEAVERARTGGGPTLIECTTYRFR  250



>ref|WP_026732160.1| pyruvate dehydrogenase [Fischerella sp. PCC 9605]
Length=344

 Score = 82.4 bits (202),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI     YL +  L T++ELK I+++I + +EE+V+
Sbjct  264  RGHSLADPDELRSKAEKEFWFARDPIKKFAAYLTEQNLTTDQELKEIDRRIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   VFA+
Sbjct  324  FAESSPEPDPSELYRYVFAE  343


 Score = 69.7 bits (169),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDVMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_027847037.1| pyruvate dehydrogenase [Mastigocoleus testarum]
Length=344

 Score = 82.4 bits (202),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDE+R   EK ++ +RDPI     YL +  LA++ E+K+I+KKI E+++E+V+
Sbjct  263  RGHSLADPDEMRTQDEKEYWFSRDPIKKFAAYLQEQNLASQGEIKSIDKKIQELIDEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P  ++L   +FA+
Sbjct  323  FAESSPEPDPSELYRFIFAE  342


 Score = 69.7 bits (169),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL V EVA+EA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVHEVAKEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_025972417.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_527L22]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + L D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQELIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.6 bits (166),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMQGEEVDGMDVLAVRGAAQRAIDRARAGEGPTLLECLTYRYR  277



>gb|KGG00227.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
marinus str. MIT 9314]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D KLATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKLATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMQGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_009626838.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Pseudanabaena biceps]
 gb|ELS33025.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Pseudanabaena biceps PCC 7429]
Length=342

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGMPG  VDGMDVL VRE AQEAI RAR GEGPT++EC TYRF+
Sbjct  213  KKAEAFGMPGFEVDGMDVLSVREYAQEAIRRARAGEGPTVLECMTYRFR  261


 Score = 73.9 bits (180),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   +K  +  RDPI      + ++ L TE +LK I+KKI ++VEE V 
Sbjct  261  RGHSLADPDELRSKEDKDKWFGRDPIKIFASRVLEHGLVTESQLKDIDKKIRDVVEECVR  320

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L    FA+
Sbjct  321  FAETSPEPDPKDLFRYQFAE  340



>ref|WP_025937490.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_519O21]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + L D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQELIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.6 bits (166),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMQGEEVDGMDVLAVRGAAQRAIDRARAGEGPTLLECLTYRYR  277



>ref|WP_032516396.1| pyruvate dehydrogenase [Prochlorococcus marinus]
Length=357

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D KLATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKLATEEELKIIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMQGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_011863403.1| pyruvate dehydrogenase E1 subunit alpha [Prochlorococcus marinus]
 gb|ABO18096.1| Pyruvate dehydrogenase E1 alpha subunit [Prochlorococcus marinus 
str. MIT 9301]
Length=357

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKVIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_026720629.1| pyruvate dehydrogenase [Fischerella sp. PCC 9431]
Length=345

 Score = 82.0 bits (201),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI     YL +  LAT EELK I++KI + +EE+V+
Sbjct  264  RGHSLADPDELRTKDEKEFWFSRDPIKKFAAYLTEKNLATTEELKEIDRKIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFADPR  563
            FA+ SP P  ++L   +FA+ +
Sbjct  324  FAETSPEPDPSELYRYIFAEDK  345


 Score = 69.7 bits (169),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD++ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDIMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_035985435.1| pyruvate dehydrogenase [Leptolyngbya sp. KIOST-1]
Length=342

 Score = 79.7 bits (195),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPGV VDGMDV+ VR VAQEAI RAR GEGPTL+EC TYRF+
Sbjct  214  KKASVFGMPGVEVDGMDVMAVRAVAQEAIARARAGEGPTLIECLTYRFR  262


 Score = 72.0 bits (175),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI   + YL ++ LA E  LK +  +I   +++++ 
Sbjct  262  RGHSLADPDELRSKAEKETWLARDPIKRFEAYLLEHNLADEGALKEVRDRIQTRIDDALT  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA++SP P+   L + +FA+
Sbjct  322  FAEDSPEPSPDDLYKYIFAE  341



>ref|WP_029975736.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_529J15]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSQKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_015163657.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit 
alpha [Pseudanabaena sp. PCC 7367]
 gb|AFY68683.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Pseudanabaena sp. PCC 7367]
Length=342

 Score = 77.4 bits (189),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + +RDPI     YL ++ L+ + +LKAI+K+I  +VE +V+
Sbjct  261  RGHSLADPDELRPKEEKDEWFSRDPIKLFSSYLIEHGLSNQADLKAIDKRIQTLVEAAVK  320

Query  628  FADESPVPARTQLLENVFAD  569
            F +ESP P+  +L    FA+
Sbjct  321  FGEESPEPSPDELYRFQFAE  340


 Score = 74.3 bits (181),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG  VDGMDVL VR+ AQ AI RAR GEGPTL+EC TYRF+
Sbjct  213  KKAAVFGMPGYEVDGMDVLAVRKHAQTAIARARAGEGPTLLECMTYRFR  261



>ref|WP_025933867.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_498A3]
Length=357

 Score = 82.8 bits (203),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + L D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEREKEFWGKRDPIKKLAQELIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.6 bits (166),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMQGEEVDGMDVLAVRGAAQRAIDRARAGEGPTLLECLTYRYR  277



>ref|WP_029972030.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_495D8]
Length=345

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_025965833.1| pyruvate dehydrogenase, partial [Prochlorococcus sp. scB243_496M6]
Length=209

 Score = 82.0 bits (201),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  129  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKIIEKKIDAEISESVK  188

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  189  NAIEAPEPPSEELTKYIWAE  208


 Score = 69.3 bits (168),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYRF+
Sbjct  81   RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRFR  129



>ref|WP_017301098.1| pyruvate dehydrogenase E1 subunit alpha [Nodosilinea nodulosa]
Length=342

 Score = 78.6 bits (192),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   FGMPG+ VDGMDV+ VR VAQEA+ RAR GEGPTL+EC TYRF+
Sbjct  214  KKAAVFGMPGIEVDGMDVMAVRAVAQEAVARARAGEGPTLIECLTYRFR  262


 Score = 73.2 bits (178),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR  +EK  + ARDPI   + YL ++ L  E  LK +  +I   +++++ 
Sbjct  262  RGHSLADPDELRSKAEKEAWLARDPIKRFEAYLLEHNLTDEGGLKDVRDRIQTRIDDALT  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P+   L + +FAD
Sbjct  322  FAEESPEPSPDDLYKYIFAD  341



>gb|KGG09007.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
marinus str. SB]
Length=345

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L++ ++A+
Sbjct  325  NAIEAPEPPSEELIKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_025975942.1| pyruvate dehydrogenase, partial [Prochlorococcus sp. scB243_495N3]
Length=267

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + + K ATEEELK IEKKID  + ESV+
Sbjct  187  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIEGKFATEEELKIIEKKIDAEISESVK  246

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++AD
Sbjct  247  NAIEAPEPPSEELTKYIWAD  266


 Score = 67.8 bits (164),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  139  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  187



>ref|WP_032520254.1| pyruvate dehydrogenase [Prochlorococcus marinus]
Length=357

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKIIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L++ ++A+
Sbjct  337  NAIEAPEPPSEELIKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_023173177.1| pyruvate dehydrogenase E1 component, alpha subunit [Gloeobacter 
kilaueensis]
 gb|AGY58053.1| pyruvate dehydrogenase E1 component, alpha subunit [Gloeobacter 
kilaueensis JS1]
Length=332

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFG+PGV VDGMDVL VR+VA+EAI RAR GEGPTL+EC TYRF+
Sbjct  203  RKADAFGIPGVRVDGMDVLAVRDVAKEAIQRARAGEGPTLIECTTYRFR  251


 Score = 73.6 bits (179),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK  +  +DPI  L  ++ +   A  +ELK I+++I   VEE+V 
Sbjct  251  RGHSLADPDELRDPAEKEFWRQQDPIPRLAAFIAEQGFAGPDELKLIDQEIRSEVEEAVV  310

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P   +L    FA+
Sbjct  311  FAEESPEPPVDELYRFQFAE  330



>emb|CDJ40271.1| pyruvate dehydrogenase, putative [Eimeria tenella]
Length=542

 Score = 81.3 bits (199),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+ +A RDPI   ++Y+ +   A +E L+   +K+ EIVE++V+
Sbjct  409  RGHSLADPDELRCPHEKAAFAVRDPIKHFEQYMLEMGYANDETLELTRRKMKEIVEDAVQ  468

Query  628  FADESPVPARTQLLENVFA---DPRGF  557
            FA+ SP+P      +  FA   +P+GF
Sbjct  469  FAEASPLPDPATAGDTTFAPAYEPKGF  495


 Score = 70.1 bits (170),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            ++GP FG+P V VDGMDVL VR  A++AI RAR+GEGP+L+E  TYRF+
Sbjct  361  QRGPPFGVPSVEVDGMDVLAVRAAARQAIERARKGEGPSLIEALTYRFR  409



>ref|WP_025963883.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_520F22]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDREISESVK  336

Query  628  FADESPVPARTQLLENVFA  572
             A E+P P   +L + ++A
Sbjct  337  NAIEAPEPPSEELTKYIWA  355


 Score = 67.8 bits (164),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_025894873.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_497J18]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQVIIDGKFATEEELKTIEKKIDAEITESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_029984869.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_496A2]
Length=345

 Score = 83.6 bits (205),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIVDGKFATEEELKIIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSGELTKYIWAE  344


 Score = 67.8 bits (164),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>gb|AIQ95599.1| Pyruvate dehydrogenase E1 component alpha subunit [Prochlorococcus 
sp. MIT 0604]
Length=345

 Score = 84.0 bits (206),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDTEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSQELTKYIWAE  344


 Score = 67.4 bits (163),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ A+ RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAVERARAGEGPTLLECLTYRYR  265



>ref|WP_042850841.1| pyruvate dehydrogenase [Prochlorococcus sp. MIT 0604]
Length=357

 Score = 84.0 bits (206),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSQELTKYIWAE  356


 Score = 67.4 bits (163),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ A+ RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAVERARAGEGPTLLECLTYRYR  277



>ref|WP_025900779.1| MULTISPECIES: pyruvate dehydrogenase [Prochlorococcus]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFA  572
             A E+P P   +L + ++A
Sbjct  337  NAIEAPEPPSEELTKYIWA  355


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_025882077.1| MULTISPECIES: pyruvate dehydrogenase [Prochlorococcus]
Length=357

 Score = 83.2 bits (204),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFA  572
             A E+P P   +L + ++A
Sbjct  337  NAIEAPEPPSEELTKYIWA  355


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_015178608.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Oscillatoria nigro-viridis]
 gb|AFZ09384.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha 
subunit [Oscillatoria nigro-viridis PCC 7112]
Length=345

 Score = 75.9 bits (185),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++  RDPI  L   L D  LAT EELK I+ KI  +++++V+
Sbjct  264  RGHSLADPDELRSKEEKEYWFPRDPIKKLAAELIDRTLATAEELKEIDNKIQAVIDDAVD  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA++S  P  ++L   ++A+
Sbjct  324  FAEKSAEPDPSELYRFIYAE  343


 Score = 75.1 bits (183),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFGM GV VDGMDVL VREVA+EA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKAHAFGMAGVEVDGMDVLAVREVAKEAVARARAGEGPTLIEALTYRFR  264



>ref|YP_008144878.1| pyruvate dehydrogenase E1 component subunit alpha [Grateloupia 
taiwanensis]
 gb|AGO19814.1| pyruvate dehydrogenase E1 component subunit alpha [Grateloupia 
taiwanensis]
Length=347

 Score = 77.4 bits (189),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PG+ VDGMDVL VREVAQ++I RAR GEGPTL+E  TYRF+
Sbjct  214  KKANAFGLPGIEVDGMDVLAVREVAQKSIDRARSGEGPTLIEALTYRFR  262


 Score = 73.2 bits (178),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  LK YL +N + + + + +I  K  + ++++++
Sbjct  262  RGHSLADPDELRSQKEKEAWLARDPIKRLKNYLINNNIVSNDMIDSIHIKTKQAIDDAID  321

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P    L   +FAD
Sbjct  322  FALSSPEPEVKDLKRYLFAD  341



>ref|WP_017312723.1| pyruvate dehydrogenase E1 subunit alpha [Fischerella sp. PCC 
9339]
Length=344

 Score = 81.3 bits (199),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK ++ +RDPI     YL +  LAT E+LK I++KI + +EE+V+
Sbjct  264  RGHSLADPDELRTKDEKEYWFSRDPIKKFAAYLTEKNLATAEQLKEIDRKIQQEIEEAVK  323

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P   +L   +FA+
Sbjct  324  FAETSPEPDPGELYRYIFAE  343


 Score = 69.7 bits (169),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMD++ VR VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KKASVFNMVGVEVDGMDIMAVRAVAQEAVARARAGEGPTLIEALTYRFR  264



>ref|WP_025961427.1| pyruvate dehydrogenase, partial [Prochlorococcus sp. scB245a_519L21]
Length=194

 Score = 82.4 bits (202),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  114  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKTIEKKIDAEITESVK  173

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  174  NAIEAPEPPSEELTKYIWAE  193


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  66   RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  114



>emb|CDJ70250.1| pyruvate dehydrogenase, putative [Eimeria necatrix]
Length=542

 Score = 80.5 bits (197),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK+ +A RDPI   ++Y+ +   A +E L+   +K+ EIVE++V+
Sbjct  409  RGHSLADPDELRCPQEKAAFAVRDPIKHFEQYMLEMGYANDETLELTRRKMKEIVEDAVQ  468

Query  628  FADESPVPARTQLLENVFA---DPRGF  557
            FA+ SP P  +   +  FA   +P+GF
Sbjct  469  FAEASPPPDPSTAGDTTFAPAYEPKGF  495


 Score = 70.5 bits (171),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            ++GP FG+P V VDGMDVL VR  A++AI RAR+GEGP+L+E  TYRF+
Sbjct  361  QRGPPFGVPSVEVDGMDVLAVRAAARQAIERARKGEGPSLIEALTYRFR  409



>ref|WP_025928734.1| pyruvate dehydrogenase [Prochlorococcus sp. scB243_495G23]
Length=357

 Score = 82.4 bits (202),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKTIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_025969423.1| pyruvate dehydrogenase, partial [Prochlorococcus sp. scB245a_519G16]
Length=229

 Score = 82.4 bits (202),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK IEKKID  + ESV+
Sbjct  149  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKYATEEELKLIEKKIDAEISESVK  208

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  209  NAIEAPEPPSEELTKYIWAE  228


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  101  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  149



>ref|WP_025913752.1| MULTISPECIES: pyruvate dehydrogenase [Prochlorococcus]
Length=357

 Score = 81.6 bits (200),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + L D K AT+EELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQELIDGKFATKEELKIIEKKIDTEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.6 bits (166),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMQGEEVDGMDVLAVRGAAQRAIDRARAGEGPTLLECLTYRYR  277



>ref|WP_015160492.1| pyruvate dehydrogenase E1 component, alpha subunit [Chamaesiphon 
minutus]
 gb|AFY94357.1| pyruvate dehydrogenase E1 component, alpha subunit [Chamaesiphon 
minutus PCC 6605]
Length=343

 Score = 79.3 bits (194),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L  YL    LAT +EL A++++I ++V++SVE
Sbjct  263  RGHSLADPDELRPREEKDFWFARDPIKKLANYLIAEGLATADELAALDREIQDLVDDSVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P   +L   +FA+
Sbjct  323  FAENSPEPDPRELRRYIFAE  342


 Score = 70.9 bits (172),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  950  KGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KG AFGM GV VDGMDVL V  VA+EA+ RAR GEGPTL+E  TYRF+
Sbjct  216  KGAAFGMHGVQVDGMDVLAVYSVAKEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_011141528.1| pyruvate dehydrogenase E1 subunit alpha [Gloeobacter violaceus]
 ref|NP_924475.1| pyruvate dehydrogenase E1 component alpha [Gloeobacter violaceus 
PCC 7421]
 dbj|BAC89470.1| pyruvate dehydrogenase E1 component alpha [Gloeobacter violaceus 
PCC 7421]
Length=334

 Score = 75.1 bits (183),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK  AFG+PGV VDGMDVL VR VA+EAI RAR G GPTL+EC TYRF+
Sbjct  205  KKADAFGIPGVRVDGMDVLAVRAVAKEAIERARAGGGPTLIECTTYRFR  253


 Score = 75.1 bits (183),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRDP+EK  +  +DPI  L  ++ + +LA+ EELKAI+++I   ++++V 
Sbjct  253  RGHSLADPDELRDPAEKEFWRKQDPIPRLAAFVREQELASAEELKAIDQEIRAEIDDAVL  312

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P   +L    FA+
Sbjct  313  FAEESPEPPIDELYRFQFAE  332



>ref|WP_029977208.1| pyruvate dehydrogenase [Prochlorococcus sp. scB245a_520K10]
Length=345

 Score = 82.0 bits (201),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAREIIDGKFATEEELKNIEKKIDAEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NALEAPEPPSKELTKYIWAE  344


 Score = 68.2 bits (165),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_028948828.1| pyruvate dehydrogenase [Synechocystis sp. PCC 6714]
 gb|AIE73955.1| Pyruvate dehydrogenase E1 component alpha subunit [Synechocystis 
sp. PCC 6714]
Length=342

 Score = 83.6 bits (205),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +AARDPI     ++ +++LA+ EELKAIEK+I  ++++++ 
Sbjct  263  RGHSLADPDELRSAEEKQFWAARDPIKKFGAFMTEHELASNEELKAIEKRIQGVIDDALT  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P    L + +FAD
Sbjct  323  FAESSPEPNPEDLRKYIFAD  342


 Score = 66.6 bits (161),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDV+ V +VA EA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMAGVEVDGMDVVAVHKVATEAVARARAGEGPTLIEALTYRFR  263



>ref|WP_025922531.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_529D18]
Length=357

 Score = 82.0 bits (201),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D   ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGNFATEEELKIIEKKIDAEISESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSQELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_029960454.1| MULTISPECIES: pyruvate dehydrogenase [Prochlorococcus]
Length=345

 Score = 82.0 bits (201),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKDIEKKIDSEISESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NALEAPEPPSQELTKYIWAE  344


 Score = 67.8 bits (164),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_025889000.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_526B17]
Length=357

 Score = 80.1 bits (196),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L   + + K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAHEIIEGKFATEEELKTIEKKIDAEITESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 70.1 bits (170),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +KG AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKGSAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_026786093.1| MULTISPECIES: pyruvate dehydrogenase [Planktothrix]
Length=343

 Score = 85.1 bits (209),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI     +L ++ LAT EELKAI++++  I++++VE
Sbjct  263  RGHSLADPDELRDKDEKEFWFARDPIKKFAAHLTEHNLATHEELKAIDQQVQAIIDDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   ++AD
Sbjct  323  FAQSSPEPDPKELYRYIYAD  342


 Score = 65.1 bits (157),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMDVL VREVA++A+ RAR GEGPTLVE  TYRF+
Sbjct  215  KKGPAFGMPGYEVDGMDVLAVREVAKKAVARARAGEGPTLVEALTYRFR  263



>ref|WP_011818906.1| pyruvate dehydrogenase E1 subunit alpha [Prochlorococcus marinus]
 gb|ABM70770.1| Pyruvate dehydrogenase E1 alpha subunit [Prochlorococcus marinus 
str. AS9601]
Length=357

 Score = 81.6 bits (200),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L + + D K ATEEELK IEKKID  + ESV+
Sbjct  277  RGHSLADPDELRSEKEKEFWGKRDPIKKLAQEIIDGKFATEEELKIIEKKIDAEIAESVK  336

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  337  NAIEAPEPPSEELTKYIWAE  356


 Score = 68.2 bits (165),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  229  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  277



>ref|WP_019489774.1| pyruvate dehydrogenase E1 subunit alpha [Calothrix sp. PCC 7103]
Length=344

 Score = 83.2 bits (204),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  + ARDPI  L   L + KL T +ELKAI+KKI   VEE+V+
Sbjct  263  RGHSLADPDELRSKEEKEFWFARDPIKKLASELIERKLVTADELKAIDKKIQTEVEEAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ SP P+  +L   +FA+
Sbjct  323  FAESSPEPSPDELYRFIFAE  342


 Score = 66.6 bits (161),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL V  VA+EA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFNMVGVEVDGMDVLAVYSVAKEAVRRARSGEGPTLIEALTYRFR  263



>ref|WP_029976517.1| pyruvate dehydrogenase [Prochlorococcus sp. scB241_528N17]
Length=345

 Score = 82.0 bits (201),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR   EK  +  RDPI  L K + D K ATEEELK I+KKID  + ESV+
Sbjct  265  RGHSLADPDELRSEKEKEFWGKRDPIKKLAKEIIDGKFATEEELKIIDKKIDAEITESVK  324

Query  628  FADESPVPARTQLLENVFAD  569
             A E+P P   +L + ++A+
Sbjct  325  NAIEAPEPPSEELTKYIWAE  344


 Score = 67.8 bits (164),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            +K  AFGM G  VDGMDVL VR  AQ AI RAR GEGPTL+EC TYR++
Sbjct  217  RKASAFGMHGEEVDGMDVLAVRGAAQRAIERARAGEGPTLLECLTYRYR  265



>ref|WP_026794738.1| MULTISPECIES: pyruvate dehydrogenase [Planktothrix]
Length=343

 Score = 84.7 bits (208),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI     +L ++ LAT EELKAI++++  I++++VE
Sbjct  263  RGHSLADPDELRDKDEKEFWFARDPIKKFAAHLTEHNLATHEELKAIDQQVQAIIDDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   ++AD
Sbjct  323  FAQSSPEPDPKELYRYIYAD  342


 Score = 64.7 bits (156),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMDVL VREVA++A+ RAR GEGPTLVE  TYRF+
Sbjct  215  KKGPAFGMPGYEVDGMDVLAVREVAKKAVARARAGEGPTLVEALTYRFR  263



>ref|WP_042155681.1| pyruvate dehydrogenase [Planktothrix agardhii]
 gb|KEI68314.1| PdhA [Planktothrix agardhii NIVA-CYA 126/8]
Length=343

 Score = 84.7 bits (208),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELRD  EK  + ARDPI     +L ++ LAT EELKAI++++  I++++VE
Sbjct  263  RGHSLADPDELRDKDEKEFWFARDPIKKFAAHLTEHNLATHEELKAIDQQVQAIIDDAVE  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA  SP P   +L   ++AD
Sbjct  323  FAQSSPEPDPKELYRYIYAD  342


 Score = 64.7 bits (156),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KKGPAFGMPG  VDGMDVL VREVA++A+ RAR GEGPTLVE  TYRF+
Sbjct  215  KKGPAFGMPGYEVDGMDVLAVREVAKKAVARARAGEGPTLVEALTYRFR  263



>ref|WP_007307445.1| pyruvate dehydrogenase E1 subunit alpha [Crocosphaera watsonii]
 gb|EAM48787.1| Pyruvate dehydrogenase (lipoamide) [Crocosphaera watsonii WH 
8501]
 gb|EHJ10556.1| Pyruvate dehydrogenase E1 component alpha subunit [Crocosphaera 
watsonii WH 0003]
 emb|CCQ63588.1| Pyruvate dehydrogenase E1 component alpha subunit [Crocosphaera 
watsonii WH 0401]
 emb|CCQ50454.1| Pyruvate dehydrogenase E1 component alpha subunit [Crocosphaera 
watsonii WH 8502]
 emb|CCQ56477.1| Pyruvate dehydrogenase E1 component alpha subunit [Crocosphaera 
watsonii WH 0005]
Length=343

 Score = 79.3 bits (194),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK  +  +DPI  L+ YL ++ LA + EL  I++K+   V+++V+
Sbjct  263  RGHSLADPDELRSPDEKQFWGNKDPIQRLEAYLIEHNLANQSELDEIKQKVQASVDDAVK  322

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P   +L   +FA+
Sbjct  323  FAEESPEPDPKELYRYIFAE  342


 Score = 70.1 bits (170),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  215  KKASVFDMVGVEVDGMDVLAVRKVAQEAVDRARAGEGPTLIEALTYRFR  263



>emb|CCQ68831.1| Pyruvate dehydrogenase E1 component alpha subunit [Crocosphaera 
watsonii WH 0402]
Length=337

 Score = 79.3 bits (194),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  808  RGHSLADPDELRDPSEKSHYAARDPIAALKKYLFDNKLATEEELKAIEKKIDEIVEESVE  629
            RGHSLADPDELR P EK  +  +DPI  L+ YL ++ LA + EL  I++K+   V+++V+
Sbjct  257  RGHSLADPDELRSPDEKQFWGNKDPIQRLEAYLIEHNLANQSELDEIKQKVQASVDDAVK  316

Query  628  FADESPVPARTQLLENVFAD  569
            FA+ESP P   +L   +FA+
Sbjct  317  FAEESPEPDPKELYRYIFAE  336


 Score = 70.1 bits (170),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  953  KKGPAFGMPGVHVDGMDVLKVREVAQEAIGRARRGEGPTLVECETYRFQ  807
            KK   F M GV VDGMDVL VR+VAQEA+ RAR GEGPTL+E  TYRF+
Sbjct  209  KKASVFDMVGVEVDGMDVLAVRKVAQEAVDRARAGEGPTLIEALTYRFR  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295928061616