BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4271

Length=878
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009799931.1|  PREDICTED: ruBisCO large subunit-binding pro...    403   1e-133   Nicotiana sylvestris
ref|XP_004251160.1|  PREDICTED: ruBisCO large subunit-binding pro...    403   1e-133   Solanum lycopersicum
ref|XP_009612336.1|  PREDICTED: ruBisCO large subunit-binding pro...    402   3e-133   Nicotiana tomentosiformis
ref|XP_006340213.1|  PREDICTED: ruBisCO large subunit-binding pro...    400   2e-132   Solanum tuberosum [potatoes]
ref|XP_010043791.1|  PREDICTED: ruBisCO large subunit-binding pro...    396   8e-131   Eucalyptus grandis [rose gum]
dbj|BAE71304.1|  putative rubisco subunit binding-protein alpha s...    391   1e-130   Trifolium pratense [peavine clover]
ref|XP_003637523.1|  RuBisCO large subunit-binding protein subuni...    390   3e-130   
gb|KCW85781.1|  hypothetical protein EUGRSUZ_B02532                     396   4e-130   Eucalyptus grandis [rose gum]
ref|XP_010109474.1|  RuBisCO large subunit-binding protein subuni...    394   5e-130   Morus notabilis
ref|XP_002277357.2|  PREDICTED: ruBisCO large subunit-binding pro...    394   6e-130   Vitis vinifera
gb|AFK40829.1|  unknown                                                 393   2e-129   Medicago truncatula
ref|XP_004506047.1|  PREDICTED: ruBisCO large subunit-binding pro...    392   2e-129   Cicer arietinum [garbanzo]
ref|XP_010253951.1|  PREDICTED: ruBisCO large subunit-binding pro...    392   3e-129   Nelumbo nucifera [Indian lotus]
ref|XP_010253953.1|  PREDICTED: ruBisCO large subunit-binding pro...    392   3e-129   Nelumbo nucifera [Indian lotus]
dbj|BAE71227.1|  putative rubisco subunit binding-protein alpha s...    392   3e-129   Trifolium pratense [peavine clover]
dbj|BAE71231.1|  putative rubisco subunit binding-protein alpha s...    392   5e-129   Trifolium pratense [peavine clover]
dbj|BAE71311.1|  putative rubisco subunit binding-protein alpha s...    391   6e-129   Trifolium pratense [peavine clover]
emb|CDY68896.1|  BnaAnng28680D                                          382   1e-128   Brassica napus [oilseed rape]
ref|XP_010241852.1|  PREDICTED: ruBisCO large subunit-binding pro...    389   1e-128   Nelumbo nucifera [Indian lotus]
dbj|BAE71302.1|  putative rubisco subunit binding-protein alpha s...    390   2e-128   Trifolium pratense [peavine clover]
gb|KCW85780.1|  hypothetical protein EUGRSUZ_B02532                     392   3e-128   Eucalyptus grandis [rose gum]
ref|XP_002313525.1|  RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT      389   4e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010241851.1|  PREDICTED: ruBisCO large subunit-binding pro...    389   4e-128   Nelumbo nucifera [Indian lotus]
sp|P08926.2|RUBA_PEA  RecName: Full=RuBisCO large subunit-binding...    389   7e-128   Pisum sativum [garden pea]
gb|KDO60186.1|  hypothetical protein CISIN_1g007985mg                   384   1e-127   Citrus sinensis [apfelsine]
ref|XP_011000529.1|  PREDICTED: ruBisCO large subunit-binding pro...    387   2e-127   Populus euphratica
gb|KDO60187.1|  hypothetical protein CISIN_1g007985mg                   384   2e-127   Citrus sinensis [apfelsine]
ref|XP_012064751.1|  PREDICTED: ruBisCO large subunit-binding pro...    387   3e-127   Jatropha curcas
ref|XP_008226152.1|  PREDICTED: ruBisCO large subunit-binding pro...    386   4e-127   Prunus mume [ume]
ref|XP_004291571.1|  PREDICTED: ruBisCO large subunit-binding pro...    386   7e-127   Fragaria vesca subsp. vesca
ref|XP_010521741.1|  PREDICTED: ruBisCO large subunit-binding pro...    386   7e-127   Tarenaya hassleriana [spider flower]
ref|XP_006424517.1|  hypothetical protein CICLE_v10028085mg             384   8e-127   
ref|XP_007204982.1|  hypothetical protein PRUPE_ppa003328mg             385   2e-126   Prunus persica
ref|XP_006488046.1|  PREDICTED: ruBisCO large subunit-binding pro...    384   3e-126   Citrus sinensis [apfelsine]
ref|XP_006424516.1|  hypothetical protein CICLE_v10028085mg             384   3e-126   Citrus clementina [clementine]
gb|KFK32357.1|  hypothetical protein AALP_AA6G231100                    383   5e-126   Arabis alpina [alpine rockcress]
ref|XP_008465363.1|  PREDICTED: ruBisCO large subunit-binding pro...    384   5e-126   Cucumis melo [Oriental melon]
ref|XP_011089934.1|  PREDICTED: ruBisCO large subunit-binding pro...    384   5e-126   Sesamum indicum [beniseed]
ref|XP_009376066.1|  PREDICTED: ruBisCO large subunit-binding pro...    383   6e-126   Pyrus x bretschneideri [bai li]
ref|XP_010689095.1|  PREDICTED: ruBisCO large subunit-binding pro...    384   6e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009356893.1|  PREDICTED: ruBisCO large subunit-binding pro...    383   9e-126   Pyrus x bretschneideri [bai li]
ref|XP_008385355.1|  PREDICTED: ruBisCO large subunit-binding pro...    383   1e-125   Malus domestica [apple tree]
ref|XP_006384931.1|  RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT      383   1e-125   
ref|XP_009367033.1|  PREDICTED: ruBisCO large subunit-binding pro...    382   1e-125   Pyrus x bretschneideri [bai li]
ref|XP_011089255.1|  PREDICTED: ruBisCO large subunit-binding pro...    383   2e-125   
ref|XP_004145754.1|  PREDICTED: ruBisCO large subunit-binding pro...    382   2e-125   Cucumis sativus [cucumbers]
ref|XP_007016822.1|  RuBisCO large subunit-binding protein subuni...    382   2e-125   
emb|CDX83280.1|  BnaA03g22260D                                          382   2e-125   
ref|XP_009103638.1|  PREDICTED: ruBisCO large subunit-binding pro...    382   3e-125   Brassica rapa
gb|AFK45390.1|  unknown                                                 381   4e-125   Lotus japonicus
dbj|BAD95121.1|  putative rubisco subunit binding-protein alpha s...    372   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542582.1|  PREDICTED: ruBisCO large subunit-binding pro...    381   5e-125   Tarenaya hassleriana [spider flower]
gb|ACJ85785.1|  unknown                                                 381   5e-125   Medicago truncatula
emb|CDY31190.1|  BnaC03g47010D                                          381   7e-125   Brassica napus [oilseed rape]
emb|CDY04527.1|  BnaA07g13530D                                          381   9e-125   
ref|XP_008359517.1|  PREDICTED: ruBisCO large subunit-binding pro...    380   1e-124   
ref|XP_007132293.1|  hypothetical protein PHAVU_011G082600g             379   2e-124   Phaseolus vulgaris [French bean]
ref|XP_009140840.1|  PREDICTED: ruBisCO large subunit-binding pro...    379   2e-124   Brassica rapa
emb|CDX77147.1|  BnaC04g39420D                                          380   3e-124   
ref|XP_010940621.1|  PREDICTED: ruBisCO large subunit-binding pro...    379   4e-124   Elaeis guineensis
ref|XP_010940622.1|  PREDICTED: ruBisCO large subunit-binding pro...    379   4e-124   Elaeis guineensis
gb|KJB83861.1|  hypothetical protein B456_013G268400                    379   4e-124   Gossypium raimondii
gb|EPS67631.1|  hypothetical protein M569_07141                         379   5e-124   Genlisea aurea
ref|XP_006827424.1|  PREDICTED: ruBisCO large subunit-binding pro...    378   5e-124   Amborella trichopoda
gb|KJB83859.1|  hypothetical protein B456_013G268400                    378   7e-124   Gossypium raimondii
sp|P21239.2|RUB1_BRANA  RecName: Full=RuBisCO large subunit-bindi...    377   7e-124   Brassica napus [oilseed rape]
ref|XP_007016821.1|  RuBisCO large subunit-binding protein subuni...    378   1e-123   
ref|XP_009588017.1|  PREDICTED: ruBisCO large subunit-binding pro...    377   1e-123   Nicotiana tomentosiformis
emb|CDY30514.1|  BnaA04g16190D                                          377   2e-123   Brassica napus [oilseed rape]
ref|XP_010510705.1|  PREDICTED: chaperonin 60 subunit alpha 1, ch...    376   4e-123   Camelina sativa [gold-of-pleasure]
ref|XP_010470145.1|  PREDICTED: chaperonin 60 subunit alpha 1, ch...    376   5e-123   Camelina sativa [gold-of-pleasure]
gb|KHG19067.1|  RuBisCO large subunit-binding subunit alpha, chlo...    375   7e-123   Gossypium arboreum [tree cotton]
ref|XP_011040914.1|  PREDICTED: LOW QUALITY PROTEIN: ruBisCO larg...    375   1e-122   Populus euphratica
ref|XP_006293462.1|  hypothetical protein CARUB_v10022881mg             375   1e-122   Capsella rubella
ref|XP_010414593.1|  PREDICTED: chaperonin 60 subunit alpha 1, ch...    375   2e-122   
gb|AAM63618.1|  putative rubisco subunit binding-protein alpha su...    374   5e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56194.1|  hypothetical protein B456_009G109900                    373   5e-122   Gossypium raimondii
ref|NP_180367.1|  chaperonin-60 alpha                                   373   6e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04080.1|  RuBisCO large subunit-binding subunit alpha, chlo...    371   3e-121   Gossypium arboreum [tree cotton]
ref|XP_009384573.1|  PREDICTED: ruBisCO large subunit-binding pro...    371   3e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935727.1|  PREDICTED: ruBisCO large subunit-binding pro...    370   1e-120   Elaeis guineensis
ref|XP_003558045.1|  PREDICTED: ruBisCO large subunit-binding pro...    370   1e-120   Brachypodium distachyon [annual false brome]
ref|XP_008800531.1|  PREDICTED: ruBisCO large subunit-binding pro...    369   2e-120   Phoenix dactylifera
ref|XP_009757979.1|  PREDICTED: ruBisCO large subunit-binding pro...    369   3e-120   Nicotiana sylvestris
ref|XP_003581066.1|  PREDICTED: ruBisCO large subunit-binding pro...    368   4e-120   Brachypodium distachyon [annual false brome]
ref|XP_002880957.1|  CPN60A                                             369   4e-120   Arabidopsis lyrata subsp. lyrata
ref|XP_009386348.1|  PREDICTED: ruBisCO large subunit-binding pro...    367   2e-119   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT15819.1|  putative RuBisCO large subunit-binding protein su...    364   2e-119   
gb|EMS63359.1|  RuBisCO large subunit-binding protein subunit alp...    364   3e-119   Triticum urartu
gb|ABG00012.1|  RuBisCO subunit binding-protein alpha subunit, ch...    363   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001276148.1|  ruBisCO large subunit-binding protein subuni...    365   6e-119   
sp|P08823.1|RUBA_WHEAT  RecName: Full=RuBisCO large subunit-bindi...    364   7e-119   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006652052.1|  PREDICTED: ruBisCO large subunit-binding pro...    365   8e-119   Oryza brachyantha
ref|XP_006347191.1|  PREDICTED: chaperonin 60 subunit alpha 1, ch...    365   8e-119   Solanum tuberosum [potatoes]
gb|EMT15798.1|  putative RuBisCO large subunit-binding protein su...    364   1e-118   
gb|KHM98926.1|  RuBisCO large subunit-binding protein subunit alp...    365   1e-118   Glycine soja [wild soybean]
gb|KHN38733.1|  RuBisCO large subunit-binding protein subunit alp...    364   2e-118   Glycine soja [wild soybean]
dbj|BAJ93636.1|  predicted protein                                      364   2e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004241283.1|  PREDICTED: ruBisCO large subunit-binding pro...    365   2e-118   Solanum lycopersicum
ref|XP_006591127.1|  PREDICTED: ruBisCO large subunit-binding pro...    363   6e-118   Glycine max [soybeans]
gb|EAY92674.1|  hypothetical protein OsI_14427                          363   7e-118   Oryza sativa Indica Group [Indian rice]
gb|EYU18802.1|  hypothetical protein MIMGU_mgv1a003263mg                363   9e-118   Erythranthe guttata [common monkey flower]
gb|AAP44754.1|  putative rubisco subunit binding-protein alpha su...    362   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066567.1|  Os12g0277500                                       361   4e-117   
ref|XP_006653189.1|  PREDICTED: ruBisCO large subunit-binding pro...    359   1e-116   Oryza brachyantha
ref|XP_004962429.1|  PREDICTED: ruBisCO large subunit-binding pro...    358   2e-116   Setaria italica
gb|ABR18037.1|  unknown                                                 359   3e-116   Picea sitchensis
emb|CAN69818.1|  hypothetical protein VITISV_037064                     357   5e-116   Vitis vinifera
gb|AAC68501.1|  chaperonin 60 alpha subunit                             356   2e-115   Canavalia lineata
ref|XP_002440887.1|  hypothetical protein SORBIDRAFT_09g014430          356   2e-115   Sorghum bicolor [broomcorn]
gb|ACL53491.1|  unknown                                                 352   4e-115   Zea mays [maize]
ref|XP_002463468.1|  hypothetical protein SORBIDRAFT_01g000380          355   4e-115   Sorghum bicolor [broomcorn]
emb|CDP07072.1|  unnamed protein product                                355   1e-114   Coffea canephora [robusta coffee]
ref|XP_008789558.1|  PREDICTED: ruBisCO large subunit-binding pro...    354   1e-114   Phoenix dactylifera
ref|XP_010918680.1|  PREDICTED: ruBisCO large subunit-binding pro...    354   1e-114   Elaeis guineensis
ref|XP_010918679.1|  PREDICTED: ruBisCO large subunit-binding pro...    354   1e-114   Elaeis guineensis
ref|XP_004980958.1|  PREDICTED: ruBisCO large subunit-binding pro...    353   2e-114   Setaria italica
ref|NP_001148093.1|  LOC100281701                                       353   5e-114   Zea mays [maize]
emb|CAB51619.1|  unnamed protein product                                350   6e-114   Ricinus communis
ref|XP_001755211.1|  predicted protein                                  351   7e-114   
sp|P08824.1|RUBA_RICCO  RecName: Full=RuBisCO large subunit-bindi...    348   3e-113   Ricinus communis
ref|XP_002973702.1|  hypothetical protein SELMODRAFT_99807              346   8e-112   
ref|XP_001769377.1|  predicted protein                                  347   1e-111   
ref|XP_008649582.1|  PREDICTED: ruBisCO large subunit-binding pro...    346   1e-111   
gb|EMS55766.1|  RuBisCO large subunit-binding protein subunit alp...    347   3e-111   Triticum urartu
sp|P34794.1|RUB2_BRANA  RecName: Full=RuBisCO large subunit-bindi...    345   3e-111   Brassica napus [oilseed rape]
emb|CBI17177.3|  unnamed protein product                                340   2e-109   Vitis vinifera
gb|AFW77798.1|  chloroplast protein synthesis2                          328   4e-104   
ref|XP_001703692.1|  chaperonin 60A                                     320   2e-101   Chlamydomonas reinhardtii
sp|Q42694.1|RUBA_CHLRE  RecName: Full=RuBisCO large subunit-bindi...    320   2e-101   Chlamydomonas reinhardtii
ref|XP_002951916.1|  hypothetical protein VOLCADRAFT_105311             318   5e-101   Volvox carteri f. nagariensis
gb|ABR25547.1|  rubisco large subunit-binding protein subunit alpha     300   2e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_001774009.1|  predicted protein                                  308   1e-96    
ref|XP_005644409.1|  chaperonin 60A                                     303   1e-94    Coccomyxa subellipsoidea C-169
ref|XP_005843628.1|  hypothetical protein CHLNCDRAFT_59237              301   2e-94    Chlorella variabilis
ref|XP_007510926.1|  chaperonin GroEL                                   296   3e-92    Bathycoccus prasinos
ref|XP_009593108.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    296   3e-92    Nicotiana tomentosiformis
ref|XP_002534347.1|  rubisco subunit binding-protein alpha subuni...    293   5e-92    
ref|XP_009773217.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    296   6e-92    Nicotiana sylvestris
ref|XP_002499889.1|  predicted protein                                  295   1e-91    Micromonas commoda
ref|XP_007214015.1|  hypothetical protein PRUPE_ppa005218mg             290   3e-91    
ref|XP_010260611.1|  PREDICTED: ruBisCO large subunit-binding pro...    294   3e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010260610.1|  PREDICTED: ruBisCO large subunit-binding pro...    294   4e-91    Nelumbo nucifera [Indian lotus]
ref|XP_011096811.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    292   1e-90    Sesamum indicum [beniseed]
ref|XP_008225833.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    292   2e-90    Prunus mume [ume]
ref|XP_008225834.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    292   2e-90    Prunus mume [ume]
ref|XP_006365041.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    291   6e-90    Solanum tuberosum [potatoes]
ref|XP_001420863.1|  chaperonin 60 alpha chain, chloroplast             289   1e-89    Ostreococcus lucimarinus CCE9901
ref|XP_006409816.1|  hypothetical protein EUTSA_v10016532mg             288   1e-89    
ref|XP_007041088.1|  TCP-1/cpn60 chaperonin family protein isoform 2    286   1e-89    
ref|XP_004145436.2|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    290   2e-89    Cucumis sativus [cucumbers]
ref|XP_006374694.1|  hypothetical protein POPTR_0015s15270g             286   2e-89    
ref|XP_010109832.1|  Chaperonin 60 subunit alpha 2                      288   3e-89    Morus notabilis
ref|XP_006374686.1|  hypothetical protein POPTR_0015s151902g            278   4e-89    
ref|XP_002991301.1|  hypothetical protein SELMODRAFT_133357             288   5e-89    
ref|XP_010317036.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    287   5e-89    
emb|CEF99984.1|  Chaperonin Cpn60                                       288   6e-89    Ostreococcus tauri
ref|XP_003082449.1|  RuBisCO subunit binding-protein alpha subuni...    288   6e-89    
ref|XP_004233243.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    288   8e-89    Solanum lycopersicum
emb|CDP11251.1|  unnamed protein product                                287   1e-88    Coffea canephora [robusta coffee]
ref|XP_002528171.1|  rubisco subunit binding-protein alpha subuni...    286   2e-88    
gb|ERN19685.1|  hypothetical protein AMTR_s00062p00185880               286   3e-88    Amborella trichopoda
ref|XP_007041090.1|  TCP-1/cpn60 chaperonin family protein isoform 4    285   3e-88    
ref|XP_011000174.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    286   3e-88    Populus euphratica
ref|XP_007041089.1|  TCP-1/cpn60 chaperonin family protein isoform 3    286   3e-88    
ref|XP_011000175.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    286   3e-88    Populus euphratica
ref|XP_011628474.1|  PREDICTED: ruBisCO large subunit-binding pro...    286   3e-88    Amborella trichopoda
ref|XP_011460484.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    283   4e-88    Fragaria vesca subsp. vesca
ref|XP_007041087.1|  TCP-1/cpn60 chaperonin family protein isoform 1    286   4e-88    
ref|XP_011401398.1|  RuBisCO large subunit-binding protein subuni...    285   4e-88    Auxenochlorella protothecoides
gb|EYU43672.1|  hypothetical protein MIMGU_mgv1a006437mg                281   8e-88    Erythranthe guttata [common monkey flower]
ref|XP_003055784.1|  predicted protein                                  285   9e-88    Micromonas pusilla CCMP1545
ref|XP_002987904.1|  hypothetical protein SELMODRAFT_183479             285   2e-87    
gb|KJB47908.1|  hypothetical protein B456_008G048200                    284   2e-87    Gossypium raimondii
emb|CDX71396.1|  BnaC04g16310D                                          283   2e-87    
gb|KJB47909.1|  hypothetical protein B456_008G048200                    284   2e-87    Gossypium raimondii
gb|KJB47910.1|  hypothetical protein B456_008G048200                    283   3e-87    Gossypium raimondii
ref|XP_004295490.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    283   5e-87    Fragaria vesca subsp. vesca
ref|XP_010054187.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    283   6e-87    Eucalyptus grandis [rose gum]
ref|XP_011460483.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    283   6e-87    Fragaria vesca subsp. vesca
ref|XP_008459023.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    282   9e-87    Cucumis melo [Oriental melon]
ref|XP_008798228.1|  PREDICTED: ruBisCO large subunit-binding pro...    282   1e-86    
gb|EYU42157.1|  hypothetical protein MIMGU_mgv1a019252mg                279   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_003607893.1|  RuBisCO large subunit-binding protein subuni...    278   3e-86    
ref|XP_004505302.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    281   5e-86    
ref|XP_009381752.1|  PREDICTED: ruBisCO large subunit-binding pro...    280   6e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927077.1|  PREDICTED: ruBisCO large subunit-binding pro...    280   8e-86    Elaeis guineensis
ref|XP_010927078.1|  PREDICTED: ruBisCO large subunit-binding pro...    279   1e-85    
ref|XP_003607892.1|  RuBisCO large subunit-binding protein subuni...    277   6e-85    
gb|ABC75363.2|  GroEL-like chaperone, ATPase                            278   7e-85    Medicago truncatula
ref|XP_012074228.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    277   1e-84    Jatropha curcas
ref|XP_007157774.1|  hypothetical protein PHAVU_002G097700g             273   2e-84    Phaseolus vulgaris [French bean]
ref|XP_009126286.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    276   2e-84    Brassica rapa
ref|XP_008339359.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin 6...    274   3e-84    
ref|XP_006661543.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    275   5e-84    Oryza brachyantha
emb|CDY47184.1|  BnaAnng08540D                                          275   5e-84    Brassica napus [oilseed rape]
ref|XP_006468488.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    275   6e-84    Citrus sinensis [apfelsine]
ref|XP_006448698.1|  hypothetical protein CICLE_v10014704mg             275   7e-84    Citrus clementina [clementine]
gb|KDO77362.1|  hypothetical protein CISIN_1g007834mg                   275   8e-84    Citrus sinensis [apfelsine]
gb|EPS71604.1|  hypothetical protein M569_03149                         273   1e-83    Genlisea aurea
ref|XP_006583922.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    271   1e-83    Glycine max [soybeans]
emb|CDY02601.1|  BnaC02g08340D                                          273   2e-83    
ref|XP_010648810.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    273   2e-83    Vitis vinifera
ref|XP_007157775.1|  hypothetical protein PHAVU_002G097700g             274   2e-83    Phaseolus vulgaris [French bean]
ref|XP_006605502.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    271   2e-83    Glycine max [soybeans]
ref|XP_008361665.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    274   4e-83    
ref|XP_008670053.1|  PREDICTED: ruBisCO large subunit-binding pro...    271   4e-83    Zea mays [maize]
ref|XP_010540667.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    269   5e-83    Tarenaya hassleriana [spider flower]
ref|XP_010420658.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    269   7e-83    Camelina sativa [gold-of-pleasure]
gb|KJB83860.1|  hypothetical protein B456_013G268400                    270   9e-83    Gossypium raimondii
ref|XP_010454134.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    268   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010238509.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    269   1e-82    Brachypodium distachyon [annual false brome]
ref|XP_008670052.1|  PREDICTED: ruBisCO large subunit-binding pro...    271   1e-82    
ref|XP_008378826.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    271   2e-82    
ref|XP_003528549.2|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    271   2e-82    Glycine max [soybeans]
ref|NP_197383.1|  protein CHAPERONIN-60ALPHA2                           270   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956159.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    270   4e-82    
ref|XP_002459819.1|  hypothetical protein SORBIDRAFT_02g011260          270   5e-82    Sorghum bicolor [broomcorn]
ref|XP_003556668.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    270   5e-82    Glycine max [soybeans]
ref|XP_010540666.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    269   7e-82    Tarenaya hassleriana [spider flower]
ref|XP_002871843.1|  EMB3007                                            269   7e-82    
gb|EMS58993.1|  RuBisCO large subunit-binding protein subunit alp...    268   1e-81    Triticum urartu
ref|XP_010420657.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    269   1e-81    Camelina sativa [gold-of-pleasure]
ref|WP_045871448.1|  molecular chaperone GroEL                          268   1e-81    Nostocales
ref|XP_006287368.1|  hypothetical protein CARUB_v10000568mg             268   1e-81    Capsella rubella
ref|XP_010454133.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    268   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010238508.1|  PREDICTED: ruBisCO large subunit-binding pro...    269   2e-81    Brachypodium distachyon [annual false brome]
ref|XP_010492919.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    265   2e-81    Camelina sativa [gold-of-pleasure]
gb|EMT23232.1|  putative RuBisCO large subunit-binding protein su...    268   2e-81    
gb|AGV54615.1|  RuBisCO large subunit-binding protein subunit alpha     267   5e-81    Phaseolus vulgaris [French bean]
ref|XP_010492918.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    266   2e-80    Camelina sativa [gold-of-pleasure]
gb|KDO77361.1|  hypothetical protein CISIN_1g007834mg                   265   4e-80    Citrus sinensis [apfelsine]
ref|XP_006400437.1|  hypothetical protein EUTSA_v10013085mg             265   5e-80    Eutrema salsugineum [saltwater cress]
ref|WP_015127399.1|  molecular chaperone GroEL                          263   1e-79    Calothrix sp. PCC 7507
ref|WP_041643235.1|  molecular chaperone GroEL                          263   1e-79    Trichormus azollae
gb|ADI64918.1|  chaperonin GroEL                                        263   2e-79    'Nostoc azollae' 0708
ref|WP_011610149.1|  molecular chaperone GroEL                          263   2e-79    Trichodesmium erythraeum
ref|WP_012407975.1|  molecular chaperone GroEL                          263   2e-79    Nostoc punctiforme
ref|WP_036001242.1|  molecular chaperone GroEL                          261   1e-78    [Leptolyngbya] sp. JSC-1
ref|WP_015219170.1|  molecular chaperone GroEL                          260   1e-78    Cyanobacterium aponinum
ref|WP_017652866.1|  molecular chaperone GroEL                          259   2e-78    Fortiea contorta
ref|WP_015221313.1|  chaperonin GroEL                                   259   3e-78    
dbj|BAG90839.1|  unnamed protein product                                253   4e-78    Oryza sativa Japonica Group [Japonica rice]
ref|WP_006278498.1|  molecular chaperone GroEL                          259   5e-78    Cylindrospermopsis raciborskii
ref|WP_015186725.1|  molecular chaperone GroEL                          259   5e-78    Gloeocapsa sp. PCC 7428
ref|WP_009343442.1|  molecular chaperone GroEL                          258   7e-78    Raphidiopsis brookii
ref|WP_041555042.1|  molecular chaperone GroEL                          258   7e-78    Nostoc sp. PCC 7524
ref|WP_015111848.1|  molecular chaperone GroEL                          258   8e-78    Nostoc sp. PCC 7107
gb|AFY45941.1|  chaperonin GroL                                         258   9e-78    Nostoc sp. PCC 7524
ref|WP_015230198.1|  chaperonin GroL                                    258   1e-77    Dactylococcopsis salina
ref|WP_022608771.1|  chaperonin GroL                                    257   2e-77    Rubidibacter lacunae
ref|WP_016949529.1|  molecular chaperone GroEL                          257   2e-77    Anabaena sp. PCC 7108
ref|WP_018399554.1|  molecular chaperone GroEL                          257   2e-77    filamentous cyanobacterium ESFC-1
ref|WP_035149954.1|  molecular chaperone GroEL                          257   3e-77    Calothrix sp. 336/3
ref|WP_015216715.1|  molecular chaperone GroEL                          256   6e-77    Anabaena cylindrica
ref|WP_009458011.1|  MULTISPECIES: molecular chaperone GroEL            256   6e-77    Fischerella
ref|WP_040938971.1|  molecular chaperone GroEL                          256   7e-77    
ref|WP_017295911.1|  hypothetical protein                               255   1e-76    Geminocystis herdmanii
ref|WP_019488785.1|  molecular chaperone GroEL                          255   1e-76    Calothrix sp. PCC 7103
ref|WP_040944510.1|  molecular chaperone GroEL                          255   2e-76    
ref|WP_029634993.1|  molecular chaperone GroEL [                        255   2e-76    [Scytonema hofmanni] UTEX B 1581
dbj|BAQ66593.1|  heat shock protein 60 family chaperone GroEL           254   2e-76    Geminocystis sp. NIES-3709
ref|WP_040931194.1|  molecular chaperone GroEL                          254   2e-76    
ref|WP_016865329.1|  molecular chaperone GroEL                          254   2e-76    Fischerella muscicola
ref|WP_024545682.1|  molecular chaperone GroEL                          254   2e-76    Synechococcus sp. NKBG15041c
ref|WP_010472301.1|  MULTISPECIES: molecular chaperone GroEL            254   3e-76    Acaryochloris
ref|WP_011429241.1|  molecular chaperone GroEL                          253   4e-76    Synechococcus
ref|WP_017321918.1|  molecular chaperone GroEL                          253   4e-76    cyanobacterium PCC 7702
ref|XP_010695948.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    254   5e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695947.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    254   5e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695946.1|  PREDICTED: chaperonin 60 subunit alpha 2, ch...    254   8e-76    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK26118.1|  hypothetical protein AALP_AA8G206100                    253   1e-75    Arabis alpina [alpine rockcress]
gb|ABA23371.1|  Chaperonin Cpn60/TCP-1                                  253   1e-75    Trichormus variabilis ATCC 29413
ref|WP_010996060.1|  molecular chaperone GroEL                          253   1e-75    Nostocaceae
ref|WP_011320465.1|  molecular chaperone GroEL                          253   1e-75    Trichormus variabilis
ref|WP_039737322.1|  molecular chaperone GroEL                          252   2e-75    
ref|WP_017316382.1|  molecular chaperone GroEL                          252   2e-75    Mastigocladopsis repens
ref|WP_019500096.1|  molecular chaperone GroEL                          252   2e-75    Pseudanabaena sp. PCC 6802
gb|EAZ10099.1|  hypothetical protein OsI_32408                          252   3e-75    Oryza sativa Indica Group [Indian rice]
ref|WP_015170801.1|  chaperonin GroEL                                   251   4e-75    
ref|WP_012594532.1|  MULTISPECIES: molecular chaperone GroEL            251   4e-75    
gb|EAW45429.1|  Chaperonin                                              251   5e-75    
ref|WP_042202155.1|  molecular chaperone GroEL                          251   5e-75    
ref|WP_017303097.1|  molecular chaperone GroEL                          251   6e-75    
ref|WP_011433315.1|  molecular chaperone GroEL                          250   7e-75    
ref|WP_006528647.1|  chaperonin GroL                                    250   7e-75    
ref|WP_039729087.1|  MULTISPECIES: molecular chaperone GroEL            250   7e-75    
ref|WP_015207554.1|  chaperonin GroL                                    250   1e-74    
ref|WP_015225564.1|  chaperonin GroEL                                   250   1e-74    
ref|WP_013324620.1|  molecular chaperone GroEL                          249   2e-74    
ref|WP_028085385.1|  molecular chaperone GroEL                          249   2e-74    
ref|WP_017288542.1|  molecular chaperone GroEL                          249   2e-74    
ref|WP_016873105.1|  molecular chaperone GroEL                          249   2e-74    
ref|WP_015079668.1|  chaperonin GroEL                                   249   2e-74    
ref|WP_015142786.1|  chaperonin GroL                                    249   2e-74    
ref|WP_014276880.1|  chaperonin GroEL                                   249   3e-74    
ref|WP_017296590.1|  molecular chaperone GroEL                          249   3e-74    
ref|WP_045056055.1|  molecular chaperone GroEL                          249   3e-74    
ref|WP_026722382.1|  molecular chaperone GroEL                          249   4e-74    
ref|WP_015195459.1|  molecular chaperone GroEL                          248   4e-74    
ref|WP_006510424.1|  chaperonin GroL                                    249   4e-74    
ref|WP_028089933.1|  molecular chaperone GroEL                          249   4e-74    
ref|WP_007353288.1|  MULTISPECIES: molecular chaperone GroEL            248   5e-74    
ref|WP_017746421.1|  molecular chaperone GroEL                          248   6e-74    
gb|KIJ81963.1|  molecular chaperone GroEL                               248   7e-74    
ref|WP_026733795.1|  molecular chaperone GroEL                          248   7e-74    
ref|WP_027846784.1|  molecular chaperone GroEL                          247   9e-74    
ref|WP_015161862.1|  chaperonin GroL                                    247   1e-73    
ref|WP_041033040.1|  molecular chaperone GroEL                          247   1e-73    
dbj|BAQ59925.1|  heat shock protein 60 family chaperone GroEL           247   1e-73    
ref|WP_015201979.1|  molecular chaperone GroEL                          247   1e-73    
ref|WP_009554131.1|  chaperonin GroL                                    247   1e-73    
ref|WP_016859319.1|  molecular chaperone GroEL                          247   1e-73    
ref|WP_015177119.1|  molecular chaperone GroEL                          247   2e-73    
ref|WP_006634424.1|  molecular chaperone GroEL                          246   3e-73    
ref|XP_008680541.1|  PREDICTED: ruBisCO large subunit-binding pro...    234   3e-73    
ref|WP_002750554.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_016516009.1|  hypothetical protein                               246   3e-73    
ref|WP_002776160.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_006099811.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_017311935.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_002802700.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_002788225.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_027404027.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_002737038.1|  hypothetical protein                               246   3e-73    
ref|WP_024970482.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_002759846.1|  molecular chaperone GroEL                          246   3e-73    
ref|WP_002797729.1|  MULTISPECIES: molecular chaperone GroEL            246   3e-73    
ref|WP_002784220.1|  molecular chaperone GroEL                          246   4e-73    
ref|WP_002742506.1|  chaperonin GroL                                    246   4e-73    
ref|WP_044452656.1|  molecular chaperone GroEL                          246   4e-73    
gb|EEE70234.1|  hypothetical protein OsJ_30349                          254   6e-73    
ref|WP_006625833.1|  MULTISPECIES: molecular chaperone GroEL            245   7e-73    
ref|WP_039715090.1|  molecular chaperone GroEL                          244   1e-72    
gb|ABD51945.1|  chaperonin Cpn60                                        240   2e-72    
ref|WP_009632953.1|  chaperonin GroL                                    244   2e-72    
ref|WP_004162218.1|  molecular chaperone GroEL                          244   2e-72    
ref|WP_015134386.1|  molecular chaperone GroEL                          244   2e-72    
ref|WP_002770556.1|  molecular chaperone GroEL                          244   2e-72    
ref|WP_015152570.1|  chaperonin GroEL                                   244   3e-72    
ref|WP_039201828.1|  molecular chaperone GroEL                          244   3e-72    
ref|WP_008273166.1|  molecular chaperone GroEL                          243   4e-72    
ref|WP_041739258.1|  molecular chaperone GroEL                          243   6e-72    
ref|WP_011141029.1|  molecular chaperone GroEL                          242   7e-72    
ref|WP_017324774.1|  molecular chaperone GroEL                          243   7e-72    
gb|AFZ00717.1|  60 kDa chaperonin                                       243   7e-72    
ref|WP_015954854.1|  molecular chaperone GroEL                          243   7e-72    
ref|WP_023175525.1|  chaperonin GroEL                                   242   8e-72    
ref|WP_023171298.1|  chaperonin GroEL                                   242   1e-71    
ref|WP_044106690.1|  molecular chaperone GroEL                          241   2e-71    
ref|WP_008230076.1|  Heat shock protein 60 family chaperone GroEL       241   3e-71    
ref|WP_012305785.1|  molecular chaperone GroEL                          241   4e-71    
ref|WP_007303269.1|  molecular chaperone GroEL                          241   4e-71    
ref|WP_030006718.1|  molecular chaperone GroEL                          241   4e-71    
ref|WP_017663465.1|  molecular chaperone GroEL                          241   4e-71    
ref|WP_009545495.1|  MULTISPECIES: molecular chaperone GroEL            241   5e-71    
ref|WP_024124271.1|  molecular chaperone GroEL                          240   5e-71    
ref|WP_015185157.1|  chaperonin GroL                                    240   6e-71    
ref|WP_015149515.1|  chaperonin GroL                                    240   6e-71    
ref|WP_017298742.1|  molecular chaperone GroEL                          240   6e-71    
gb|KIE11289.1|  molecular chaperone GroEL                               240   7e-71    
ref|WP_008178217.1|  molecular chaperone GroEL                          240   7e-71    
ref|WP_037217788.1|  molecular chaperone GroEL                          240   8e-71    
ref|WP_015119171.1|  chaperonin GroL                                    240   9e-71    
ref|WP_011142891.1|  molecular chaperone GroEL                          239   9e-71    
ref|WP_036536395.1|  molecular chaperone GroEL                          239   1e-70    
emb|CDN11427.1|  Heat shock protein 60 family chaperone GroEL           239   1e-70    
ref|XP_005718325.1|  Chaperonine 60                                     239   2e-70    
ref|WP_008233163.1|  Heat shock protein 60 family chaperone GroEL       239   2e-70    
ref|WP_035984973.1|  molecular chaperone GroEL                          238   3e-70    
ref|WP_036480285.1|  molecular chaperone GroEL                          238   3e-70    
ref|WP_011057252.1|  molecular chaperone GroEL                          237   9e-70    
ref|WP_042154611.1|  molecular chaperone GroEL                          236   2e-69    
ref|WP_026796686.1|  molecular chaperone GroEL                          236   2e-69    
ref|WP_035986963.1|  molecular chaperone GroEL                          236   2e-69    
ref|WP_026788053.1|  MULTISPECIES: molecular chaperone GroEL            236   2e-69    
ref|WP_026795295.1|  MULTISPECIES: molecular chaperone GroEL            236   3e-69    
ref|WP_013320553.1|  molecular chaperone GroEL                          235   3e-69    
ref|WP_035987603.1|  molecular chaperone GroEL                          235   3e-69    
ref|WP_019501755.1|  molecular chaperone GroEL                          235   5e-69    
ref|WP_011433224.1|  molecular chaperone GroEL                          235   5e-69    
ref|WP_015184308.1|  chaperonin GroL                                    234   6e-69    
ref|WP_015165611.1|  molecular chaperone GroEL                          235   6e-69    
dbj|BAD95013.1|  putative rubisco subunit binding-protein alpha s...    223   7e-69    
ref|WP_024545344.1|  molecular chaperone GroEL                          234   1e-68    
ref|WP_040054177.1|  molecular chaperone GroEL                          234   1e-68    
ref|WP_015205865.1|  chaperonin GroL                                    233   2e-68    
ref|WP_006101523.1|  molecular chaperone GroEL                          233   2e-68    
ref|WP_006633071.1|  molecular chaperone GroEL                          233   3e-68    
ref|WP_038056182.1|  molecular chaperone GroEL                          233   3e-68    
ref|WP_009626159.1|  molecular chaperone GroEL                          233   3e-68    
ref|WP_012953804.1|  molecular chaperone GroEL                          233   3e-68    
ref|WP_008312275.1|  chaperonin GroL                                    233   3e-68    
sp|O50323.2|CH601_THEVL  RecName: Full=60 kDa chaperonin 1; AltNa...    233   4e-68    
ref|WP_017711036.1|  molecular chaperone GroEL                          233   4e-68    
ref|WP_006194607.1|  molecular chaperone GroEL                          232   4e-68    
ref|WP_008180317.1|  molecular chaperone GroEL                          232   5e-68    
ref|WP_019504182.1|  molecular chaperone GroEL                          233   5e-68    
sp|Q7WVY0.1|CH602_ANASL  RecName: Full=60 kDa chaperonin 2; AltNa...    233   5e-68    
ref|WP_017321738.1|  molecular chaperone GroEL                          232   5e-68    
ref|WP_011320337.1|  molecular chaperone GroEL                          232   5e-68    
ref|WP_015174510.1|  molecular chaperone GroEL                          232   6e-68    
ref|WP_010997806.1|  molecular chaperone GroEL                          232   6e-68    
ref|WP_017717869.1|  molecular chaperone GroEL                          232   6e-68    
ref|WP_011430255.1|  molecular chaperone GroEL                          231   9e-68    
ref|WP_035999449.1|  molecular chaperone GroEL                          231   1e-67    
ref|WP_015186661.1|  molecular chaperone GroEL                          231   1e-67    
ref|WP_029638606.1|  molecular chaperone GroEL [                        231   1e-67    
ref|WP_012627767.1|  molecular chaperone GroEL                          231   1e-67    
dbj|BAF95909.1|  chaperonin GroEL                                       231   1e-67    
ref|WP_015167856.1|  chaperonin GroL                                    231   1e-67    
ref|WP_011243156.1|  MULTISPECIES: molecular chaperone GroEL            231   1e-67    
ref|WP_011056040.1|  molecular chaperone GroEL                          231   1e-67    
ref|WP_011613646.1|  molecular chaperone GroEL                          231   1e-67    
ref|WP_009342972.1|  molecular chaperone GroEL                          231   1e-67    
ref|WP_024124017.1|  heat shock protein 60 family chaperone GroEL1      231   2e-67    
ref|WP_044453149.1|  molecular chaperone GroEL                          230   2e-67    
ref|WP_004160014.1|  molecular chaperone GroEL                          230   2e-67    
ref|WP_012599165.1|  molecular chaperone GroEL                          230   2e-67    
ref|WP_017311910.1|  molecular chaperone GroEL                          230   3e-67    
gb|EDX84910.1|  chaperonin GroL                                         229   3e-67    
gb|AHY04389.1|  60 kDa chaperonin                                       230   3e-67    
ref|WP_016867666.1|  molecular chaperone GroEL                          230   3e-67    
ref|WP_041977667.1|  molecular chaperone GroEL                          230   3e-67    
ref|WP_009457507.1|  MULTISPECIES: molecular chaperone GroEL            230   3e-67    
ref|WP_044107155.1|  molecular chaperone GroEL                          230   4e-67    
ref|WP_030006933.1|  molecular chaperone GroEL                          229   4e-67    
ref|WP_017713500.1|  molecular chaperone GroEL                          230   4e-67    
ref|WP_038015768.1|  molecular chaperone GroEL                          229   4e-67    
ref|WP_017652696.1|  molecular chaperone GroEL                          229   5e-67    
ref|WP_015130974.1|  molecular chaperone GroEL                          229   5e-67    
ref|WP_012407589.1|  molecular chaperone GroEL                          229   5e-67    
ref|WP_009768317.1|  chaperonin GroL                                    229   7e-67    
ref|WP_025920905.1|  hypothetical protein                               221   7e-67    
ref|WP_036486076.1|  molecular chaperone GroEL                          229   9e-67    
ref|WP_009787539.1|  molecular chaperone GroEL                          229   9e-67    
ref|WP_022603714.1|  chaperonin GroL                                    229   1e-66    
ref|WP_024970847.1|  molecular chaperone GroEL                          229   1e-66    
ref|WP_002755764.1|  molecular chaperone GroEL                          229   1e-66    
ref|WP_015200995.1|  molecular chaperone GroEL                          229   1e-66    
ref|WP_007353485.1|  MULTISPECIES: molecular chaperone GroEL            229   1e-66    
ref|WP_009756747.1|  MULTISPECIES: molecular chaperone GroEL            229   1e-66    
ref|WP_016870295.1|  molecular chaperone GroEL                          228   1e-66    
ref|WP_013243356.1|  molecular chaperone GroEL                          228   1e-66    
ref|WP_015169314.1|  chaperonin GroL                                    228   1e-66    
ref|WP_006530607.1|  chaperonin GroL                                    228   1e-66    
ref|WP_015223059.1|  chaperonin GroEL                                   228   2e-66    
ref|WP_026148478.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_012308054.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_037220859.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_015206485.1|  thermosome subunit                                 228   2e-66    
ref|WP_002804201.1|  MULTISPECIES: molecular chaperone GroEL            228   2e-66    
ref|WP_006278400.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_002769846.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_016877280.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_011563800.1|  molecular chaperone GroEL                          228   2e-66    
dbj|BAQ66128.1|  heat shock protein 60 family chaperone GroEL           228   2e-66    
ref|WP_012267175.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_015147151.1|  chaperonin GroL                                    228   2e-66    
ref|WP_012596119.1|  MULTISPECIES: molecular chaperone GroEL            228   2e-66    
ref|WP_009629537.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_025561786.1|  molecular chaperone GroEL                          225   2e-66    
ref|WP_002744527.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_002792604.1|  molecular chaperone GroEL                          228   2e-66    
ref|YP_003735044.1|  60 kDa chaperonin                                  228   2e-66    
ref|WP_016863379.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_026722402.1|  molecular chaperone GroEL                          228   2e-66    
ref|WP_015142261.1|  chaperonin GroL                                    228   3e-66    
ref|WP_036919116.1|  MULTISPECIES: molecular chaperone GroEL            228   3e-66    
ref|WP_023068927.1|  chaperonin GroL                                    228   3e-66    
ref|WP_006622402.1|  MULTISPECIES: molecular chaperone GroEL            228   3e-66    
gb|KIJ82846.1|  molecular chaperone GroEL                               228   3e-66    
ref|WP_009553170.1|  chaperonin GroEL                                   227   3e-66    
ref|WP_027846173.1|  molecular chaperone GroEL                          227   3e-66    
ref|WP_039726130.1|  MULTISPECIES: molecular chaperone GroEL            227   4e-66    
ref|WP_009633919.1|  chaperonin GroL                                    227   4e-66    
gb|ACB37698.1|  GroEL                                                   226   4e-66    
ref|WP_015113913.1|  molecular chaperone GroEL                          227   4e-66    
ref|WP_016517225.1|  hypothetical protein                               227   4e-66    
ref|WP_045872371.1|  molecular chaperone GroEL                          227   5e-66    
ref|WP_035452757.1|  molecular chaperone GroEL                          227   5e-66    
gb|KIE07030.1|  molecular chaperone GroEL                               227   5e-66    
ref|WP_019506109.1|  molecular chaperone GroEL                          227   5e-66    
ref|WP_015193018.1|  molecular chaperone GroEL                          227   5e-66    
ref|WP_013755426.1|  molecular chaperone GroEL                          227   5e-66    
emb|CAJ72961.1|  stronlgy similar to 60 kDa chaperonin (GroEL pro...    227   6e-66    
ref|WP_015218965.1|  molecular chaperone GroEL                          227   6e-66    
ref|WP_019490875.1|  molecular chaperone GroEL                          226   7e-66    
ref|WP_015157755.1|  chaperonin GroL                                    226   7e-66    
ref|WP_039157374.1|  molecular chaperone GroEL                          226   8e-66    
ref|WP_003647726.1|  molecular chaperone GroEL                          226   8e-66    
ref|WP_039713349.1|  molecular chaperone GroEL                          226   9e-66    
ref|WP_020807874.1|  chaperonin GroEL                                   226   9e-66    
ref|WP_035829453.1|  molecular chaperone GroEL                          226   1e-65    
dbj|BAQ61558.1|  heat shock protein 60 family chaperone GroEL           226   1e-65    
ref|WP_003649363.1|  molecular chaperone GroEL                          226   1e-65    
ref|WP_017321482.1|  molecular chaperone GroEL                          226   1e-65    
ref|WP_006618363.1|  molecular chaperone GroEL                          226   1e-65    
ref|YP_004376636.1|  60 kDa chaperonin                                  226   1e-65    
ref|WP_019491742.1|  molecular chaperone GroEL                          226   1e-65    



>ref|XP_009799931.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Nicotiana sylvestris]
Length=589

 Score =   403 bits (1036),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 233/252 (92%), Positives = 244/252 (97%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DLGLL+E T VEALGIARKVTITKDSTTIIADAASKDEIQ+RIAQLK
Sbjct  338  DIAIVTGAEYQATDLGLLIEGTPVEALGIARKVTITKDSTTIIADAASKDEIQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIKD LEDADEKLGADI+Q+ALVAPASLIAQNAG+EGEVVVEK
Sbjct  458  IVPGGGAAFVHLSTYVPAIKDKLEDADEKLGADIIQRALVAPASLIAQNAGIEGEVVVEK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            VR+ +WE+GYNAMTD YENLV+AGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEK KPK
Sbjct  518  VREAEWEMGYNAMTDKYENLVDAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKAKPK  577

Query  157  tpapaaPQGLTV  122
            T APAAPQGLTV
Sbjct  578  TAAPAAPQGLTV  589



>ref|XP_004251160.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Solanum lycopersicum]
Length=588

 Score =   403 bits (1036),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 233/252 (92%), Positives = 244/252 (97%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DLGLLVENT VEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK
Sbjct  337  DIAIVTGAEYQATDLGLLVENTPVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIK+ +EDADE+LGADI+QKALVAPASLIAQNAGVEGEVVVEK
Sbjct  457  IVPGGGAAFVHLSTYVPAIKEKIEDADERLGADIIQKALVAPASLIAQNAGVEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASV+GMVLTTQAIVVEKPKPK
Sbjct  517  VKEAEWEMGYNAMTDQYENLVEAGVIDPAKVTRCALQNSASVSGMVLTTQAIVVEKPKPK  576

Query  157  tpapaaPQGLTV  122
              APAAPQGL V
Sbjct  577  VAAPAAPQGLQV  588



>ref|XP_009612336.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Nicotiana tomentosiformis]
Length=589

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 243/252 (96%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DLGLL+E T VEALGIARKVTITKDSTTIIADAASKDEIQ+RIAQLK
Sbjct  338  DIAIVTGAEYQATDLGLLIEGTPVEALGIARKVTITKDSTTIIADAASKDEIQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIKD LEDADEKLGADI+Q+ALVAPASLIAQNAG+EGEVVVEK
Sbjct  458  IVPGGGAAFVHLSTYVPAIKDKLEDADEKLGADIIQRALVAPASLIAQNAGIEGEVVVEK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            VR+ +WE+GYNAMTD YENLV+AGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEK KPK
Sbjct  518  VREAEWEMGYNAMTDKYENLVDAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKAKPK  577

Query  157  tpapaaPQGLTV  122
              APAAPQGL+V
Sbjct  578  AAAPAAPQGLSV  589



>ref|XP_006340213.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Solanum tuberosum]
Length=588

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DLGLLVENT VEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK
Sbjct  337  DIAIVTGAEYQATDLGLLVENTPVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIK  +ED DE+LGADI+QKALVAPASLIAQNAGVEGEVVVEK
Sbjct  457  IVPGGGAAFVHLSTYVPAIKAKIEDPDERLGADIIQKALVAPASLIAQNAGVEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++  WE+GYNAMTD YENLV+AGVIDPAKV RCALQNSASVAGMVLTTQAIVVEK KPK
Sbjct  517  VKEAKWEMGYNAMTDIYENLVDAGVIDPAKVIRCALQNSASVAGMVLTTQAIVVEKAKPK  576

Query  157  tpapaaPQGLTV  122
              APAAPQGL V
Sbjct  577  VAAPAAPQGLQV  588



>ref|XP_010043791.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Eucalyptus grandis]
Length=582

 Score =   396 bits (1017),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT VE LGIARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  331  DIAILTGAEYQASDLGLLVENTSVEQLGIARKVTISKDSTTIIADAASKDELQARIAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  KELSETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLS  VPAIKD LEDADEKLGADI+QKALVAPASLIAQNAG+EGEVVVEK
Sbjct  451  IVPGGGAAFVHLSACVPAIKDKLEDADEKLGADIIQKALVAPASLIAQNAGIEGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+ R+WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEK KPK
Sbjct  511  VKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKAKPK  570

Query  157  tpapaaPQGLTV  122
             PA A+PQGLTV
Sbjct  571  APAAASPQGLTV  582



>dbj|BAE71304.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
Length=461

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  210  DIAILTGAEYQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  269

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  270  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  329

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  330  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  389

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R+ +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  390  IRNGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  449

Query  157  tpapaaPQGLTV  122
             P P APQGLTV
Sbjct  450  APVPGAPQGLTV  461



>ref|XP_003637523.1| RuBisCO large subunit-binding protein subunit alpha [Medicago 
truncatula]
Length=467

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVE+T +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  216  DIAILTGAEFQASDLGLLVESTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  276  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  335

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  336  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  395

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R  +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  396  IRSGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  455

Query  157  tpapaaPQGLTV  122
              A AAPQGLTV
Sbjct  456  AAAAAAPQGLTV  467



>gb|KCW85781.1| hypothetical protein EUGRSUZ_B02532 [Eucalyptus grandis]
Length=656

 Score =   396 bits (1018),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT VE LGIARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  405  DIAILTGAEYQASDLGLLVENTSVEQLGIARKVTISKDSTTIIADAASKDELQARIAQLK  464

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  465  KELSETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  524

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLS  VPAIKD LEDADEKLGADI+QKALVAPASLIAQNAG+EGEVVVEK
Sbjct  525  IVPGGGAAFVHLSACVPAIKDKLEDADEKLGADIIQKALVAPASLIAQNAGIEGEVVVEK  584

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+ R+WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEK KPK
Sbjct  585  VKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKAKPK  644

Query  157  tpapaaPQGLTV  122
             PA A+PQGLTV
Sbjct  645  APAAASPQGLTV  656



>ref|XP_010109474.1| RuBisCO large subunit-binding protein subunit alpha [Morus notabilis]
 gb|EXC22885.1| RuBisCO large subunit-binding protein subunit alpha [Morus notabilis]
Length=585

 Score =   394 bits (1012),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKVTITKDSTTIIADAASKDE+Q+R+AQLK
Sbjct  334  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVTITKDSTTIIADAASKDELQARVAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE+ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATESELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTVVPAIKDRLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WE GYNAMTD YENLVEAGVIDPAKVTRC LQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  514  IKTSEWEFGYNAMTDKYENLVEAGVIDPAKVTRCGLQNAASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQGLTV  122
             P  A PQGLTV
Sbjct  574  APVAAGPQGLTV  585



>ref|XP_002277357.2| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Vitis vinifera]
Length=586

 Score =   394 bits (1011),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LG+ARKVTITKDSTTIIADAASKDEIQ+RIAQ+K
Sbjct  335  DIAIMTGAEFQANDLGLLIENTSVEQLGLARKVTITKDSTTIIADAASKDEIQARIAQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  455  IVPGGGAAFVHLSTYVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +W VGYNAMTD YENLVEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  515  IKACEWAVGYNAMTDKYENLVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKAKPK  574

Query  157  tpapaaPQGLTV  122
             P  A PQGLT+
Sbjct  575  APVAAPPQGLTI  586



>gb|AFK40829.1| unknown [Medicago truncatula]
 gb|KEH30010.1| ruBisCO large subunit-binding protein [Medicago truncatula]
Length=587

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVE+T +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  336  DIAILTGAEFQASDLGLLVESTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  456  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R  +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  516  IRSGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  575

Query  157  tpapaaPQGLTV  122
              A AAPQGLTV
Sbjct  576  AAAAAAPQGLTV  587



>ref|XP_004506047.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Cicer arietinum]
Length=588

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVE+T +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  337  DIAILTGAEYQASDLGLLVESTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+TLEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  457  IVPGGGTALVHLSAYVPAIKETLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD+YENLVE+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  517  IKNGEWEVGYNAMTDTYENLVESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  576

Query  157  tpapaaPQGLTV  122
             P   +PQGLTV
Sbjct  577  APIAGSPQGLTV  588



>ref|XP_010253951.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X1 [Nelumbo nucifera]
Length=586

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTG EYQASDLGLLVENT VE LG+ARKVTITKDSTTIIADAASKDEIQ+R+AQLK
Sbjct  335  DIAIVTGGEYQASDLGLLVENTSVEQLGVARKVTITKDSTTIIADAASKDEIQARVAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VPAIK  +EDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  455  IVPGGGAALVHLSTHVPAIKGKIEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD Y+NL+EAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  515  IKEAEWEVGYNAMTDKYDNLMEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQGLTV  122
             P  A PQGLTV
Sbjct  575  APVAAPPQGLTV  586



>ref|XP_010253953.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X2 [Nelumbo nucifera]
Length=583

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTG EYQASDLGLLVENT VE LG+ARKVTITKDSTTIIADAASKDEIQ+R+AQLK
Sbjct  332  DIAIVTGGEYQASDLGLLVENTSVEQLGVARKVTITKDSTTIIADAASKDEIQARVAQLK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  392  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VPAIK  +EDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  452  IVPGGGAALVHLSTHVPAIKGKIEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD Y+NL+EAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  512  IKEAEWEVGYNAMTDKYDNLMEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  571

Query  157  tpapaaPQGLTV  122
             P  A PQGLTV
Sbjct  572  APVAAPPQGLTV  583



>dbj|BAE71227.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
Length=578

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  327  DIAILTGAEYQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  387  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  447  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R+ +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  507  IRNGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  566

Query  157  tpapaaPQGLTV  122
             P P APQGLTV
Sbjct  567  APVPGAPQGLTV  578



>dbj|BAE71231.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
 dbj|BAE71235.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
 dbj|BAE71296.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
Length=588

 Score =   392 bits (1006),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  337  DIAILTGAEYQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  457  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R+ +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  517  IRNGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  576

Query  157  tpapaaPQGLTV  122
             P P APQGLTV
Sbjct  577  APVPGAPQGLTV  588



>dbj|BAE71311.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
Length=588

 Score =   391 bits (1005),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  337  DIAILTGAEYQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  457  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R+ +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  517  IRNGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPR  576

Query  157  tpapaaPQGLTV  122
             P P APQGLTV
Sbjct  577  APVPGAPQGLTV  588



>emb|CDY68896.1| BnaAnng28680D, partial [Brassica napus]
Length=337

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  86   DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  145

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  146  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  205

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  206  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  265

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  266  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  325

Query  157  tpapaaPQGLTV  122
             PA A PQGL V
Sbjct  326  APAAAPPQGLMV  337



>ref|XP_010241852.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X2 [Nelumbo nucifera]
Length=557

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QASDLGLL+ENT VE LG+ARKVTI+KDSTTIIADAA+KDEIQ+RIAQ+K
Sbjct  306  DIAIVTGAEFQASDLGLLIENTSVEQLGLARKVTISKDSTTIIADAATKDEIQARIAQIK  365

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKN+TFAAIEEG
Sbjct  366  KELAETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNSTFAAIEEG  425

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTY+P IKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  426  IVPGGGAALVHLSTYIPTIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  485

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKP+PK
Sbjct  486  IKDSEWEMGYNAMTDKYENLMEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPRPK  545

Query  157  tpapaaPQGLTV  122
             P  A PQGL V
Sbjct  546  APVAAPPQGLAV  557



>dbj|BAE71302.1| putative rubisco subunit binding-protein alpha subunit [Trifolium 
pratense]
Length=588

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  337  DIAILTGAEYQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  457  IVPGGGTALVHLSAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R+ +WEVGYNAMTD+YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQA VVEKPKP+
Sbjct  517  IRNGEWEVGYNAMTDTYENLIESGVIDPAKVTRCALQNAASVAGMVLTTQATVVEKPKPR  576

Query  157  tpapaaPQGLTV  122
             P P APQGLTV
Sbjct  577  APVPGAPQGLTV  588



>gb|KCW85780.1| hypothetical protein EUGRSUZ_B02532 [Eucalyptus grandis]
Length=657

 Score =   392 bits (1006),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 228/253 (90%), Positives = 240/253 (95%), Gaps = 1/253 (0%)
 Frame = -2

Query  877  DIAIVTG-AEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQL  701
            DIAI+TG AEYQASDLGLLVENT VE LGIARKVTI+KDSTTIIADAASKDE+Q+RIAQL
Sbjct  405  DIAILTGRAEYQASDLGLLVENTSVEQLGIARKVTISKDSTTIIADAASKDELQARIAQL  464

Query  700  KKELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEE  521
            KKEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEE
Sbjct  465  KKELSETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEE  524

Query  520  GIVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            GIVPGGGAAFVHLS  VPAIKD LEDADEKLGADI+QKALVAPASLIAQNAG+EGEVVVE
Sbjct  525  GIVPGGGAAFVHLSACVPAIKDKLEDADEKLGADIIQKALVAPASLIAQNAGIEGEVVVE  584

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkp  161
            KV+ R+WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEK KP
Sbjct  585  KVKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKAKP  644

Query  160  ktpapaaPQGLTV  122
            K PA A+PQGLTV
Sbjct  645  KAPAAASPQGLTV  657



>ref|XP_002313525.1| RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT [Populus trichocarpa]
 gb|EEE87480.1| RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT [Populus trichocarpa]
Length=586

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 242/252 (96%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +ENT +E LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLSIENTSIEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VPAIK+ ++DADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSTHVPAIKEKIKDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKP+
Sbjct  515  LKESEWEMGYNAMTDKYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPR  574

Query  157  tpapaaPQGLTV  122
            TPA A+PQGLTV
Sbjct  575  TPAAASPQGLTV  586



>ref|XP_010241851.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Nelumbo nucifera]
Length=583

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QASDLGLL+ENT VE LG+ARKVTI+KDSTTIIADAA+KDEIQ+RIAQ+K
Sbjct  332  DIAIVTGAEFQASDLGLLIENTSVEQLGLARKVTISKDSTTIIADAATKDEIQARIAQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKN+TFAAIEEG
Sbjct  392  KELAETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNSTFAAIEEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTY+P IKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  452  IVPGGGAALVHLSTYIPTIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKP+PK
Sbjct  512  IKDSEWEMGYNAMTDKYENLMEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPRPK  571

Query  157  tpapaaPQGLTV  122
             P  A PQGL V
Sbjct  572  APVAAPPQGLAV  583



>sp|P08926.2|RUBA_PEA RecName: Full=RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
alpha; AltName: Full=CPN-60 alpha; Flags: Precursor [Pisum 
sativum]
 gb|AAA87731.1| alphacpn60 precursor [Pisum sativum]
Length=587

 Score =   389 bits (998),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  336  DIAILTGAEFQASDLGLLVENTTIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  KELSETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS YVPAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  456  IVPGGGTALVHLSGYVPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD+YENLVE+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  516  IKNGEWEVGYNAMTDTYENLVESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  575

Query  157  tpapaaPQGLTV  122
                AAPQGLT+
Sbjct  576  AAVAAAPQGLTI  587



>gb|KDO60186.1| hypothetical protein CISIN_1g007985mg [Citrus sinensis]
Length=477

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+ENT VE LG ARKVTI KDSTTIIADAASKDEIQ+RIAQLK
Sbjct  226  DIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLK  285

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  286  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  345

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS +VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  346  IVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  405

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+D +W  GYNAMTD YEN+++AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  406  VKDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  465

Query  157  tpapaaPQGLTV  122
            TP  A PQGL V
Sbjct  466  TPVAAPPQGLMV  477



>ref|XP_011000529.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Populus euphratica]
Length=586

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +ENT +E LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLSIENTSIEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VPAIK+ +EDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSTHVPAIKEKIEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  515  LKDSEWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQGLTV  122
            TPA A PQGL V
Sbjct  575  TPAAAPPQGLAV  586



>gb|KDO60187.1| hypothetical protein CISIN_1g007985mg [Citrus sinensis]
Length=475

 Score =   384 bits (985),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+ENT VE LG ARKVTI KDSTTIIADAASKDEIQ+RIAQLK
Sbjct  224  DIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLK  283

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  284  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  343

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS +VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  344  IVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  403

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+D +W  GYNAMTD YEN+++AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  404  VKDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  463

Query  157  tpapaaPQGLTV  122
            TP  A PQGL V
Sbjct  464  TPVAAPPQGLMV  475



>ref|XP_012064751.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Jatropha curcas]
 gb|KDP44002.1| hypothetical protein JCGZ_05469 [Jatropha curcas]
Length=586

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLL+ENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLLIENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPAIKD + DADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAAFVHLSTSVPAIKDKISDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WE+GYNAM D YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  515  LKASEWEIGYNAMADKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA A P GLTV
Sbjct  575  APAAAPPAGLTV  586



>ref|XP_008226152.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Prunus mume]
Length=585

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQASDLGLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTYVPA+K  L DADE+LGADIVQKALV+PA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTYVPALKQKLVDADEQLGADIVQKALVSPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WEVGYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  514  IKDSEWEVGYNAMTDKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQGLTV  122
            +PA AA QGLTV
Sbjct  574  SPAAAAAQGLTV  585



>ref|XP_004291571.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Fragaria vesca subsp. vesca]
Length=585

 Score =   386 bits (991),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLG+L+ENT VE LG+ARKVTI+KDSTTIIAD ASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQANDLGMLIENTTVEQLGLARKVTISKDSTTIIADQASKDELQTRIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LEDADEKLGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTCVPAIKDKLEDADEKLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD+YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  514  LKESEWEVGYNAMTDTYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  573

Query  157  tpapaaPQGLTV  122
            +PA AA QGL+V
Sbjct  574  SPAAAAAQGLSV  585



>ref|XP_010521741.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   386 bits (991),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASD+GLLVENT +E LGIARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEYQASDMGLLVENTTIEQLGIARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIK+ LED DE+LGADIVQKALVAPA LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTAVPAIKEKLEDPDERLGADIVQKALVAPAGLIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  514  IMAGEWEIGYNAMTDKYENLLEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQGLTV  122
              A A PQGL V
Sbjct  574  AAAAAPPQGLMV  585



>ref|XP_006424517.1| hypothetical protein CICLE_v10028085mg [Citrus clementina]
 gb|ESR37757.1| hypothetical protein CICLE_v10028085mg [Citrus clementina]
Length=526

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+ENT VE LG ARKVTI KDSTTIIADAASKDEIQ+RIAQLK
Sbjct  275  DIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLK  334

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  335  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  394

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS +VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  395  IVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  454

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+D +W  GYNAMTD YEN+++AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  455  VKDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  514

Query  157  tpapaaPQGLTV  122
            TP  A PQGL V
Sbjct  515  TPVAAPPQGLMV  526



>ref|XP_007204982.1| hypothetical protein PRUPE_ppa003328mg [Prunus persica]
 gb|EMJ06181.1| hypothetical protein PRUPE_ppa003328mg [Prunus persica]
Length=585

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQANDLGLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTYVPA+K  L DADE+LGADIVQKALV+PA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTYVPALKQKLVDADEQLGADIVQKALVSPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WEVGYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  514  IKDSEWEVGYNAMTDKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQGLTV  122
            +PA AA QGLTV
Sbjct  574  SPAAAAAQGLTV  585



>ref|XP_006488046.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Citrus sinensis]
Length=582

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+ENT VE LG ARKVTI KDSTTIIADAASKDEIQ+RIAQLK
Sbjct  331  DIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS +VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  451  IVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+  +W  GYNAMTD YEN+++AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  511  VKASEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  570

Query  157  tpapaaPQGLTV  122
            TP  A PQGL V
Sbjct  571  TPVAAPPQGLMV  582



>ref|XP_006424516.1| hypothetical protein CICLE_v10028085mg [Citrus clementina]
 gb|ESR37756.1| hypothetical protein CICLE_v10028085mg [Citrus clementina]
 gb|KDO60185.1| hypothetical protein CISIN_1g007985mg [Citrus sinensis]
Length=582

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+ENT VE LG ARKVTI KDSTTIIADAASKDEIQ+RIAQLK
Sbjct  331  DIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS +VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  451  IVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V+D +W  GYNAMTD YEN+++AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  511  VKDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  570

Query  157  tpapaaPQGLTV  122
            TP  A PQGL V
Sbjct  571  TPVAAPPQGLMV  582



>gb|KFK32357.1| hypothetical protein AALP_AA6G231100 [Arabis alpina]
Length=575

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  324  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  383

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  384  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  443

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+TLED DE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  444  IVPGGGATLVHLSTAIPAIKETLEDPDERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  503

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  504  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  563

Query  157  tpapaaPQGLTV  122
             PA AAPQGL V
Sbjct  564  APAAAAPQGLMV  575



>ref|XP_008465363.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Cucumis melo]
Length=583

 Score =   384 bits (985),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLLVENT +E LG+ARKVTI+KD+TTIIADAASKDE+Q+RIAQLK
Sbjct  333  DIAILTGAEFQANDLGLLVENTTIEQLGLARKVTISKDTTTIIADAASKDELQARIAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LEDA+EKLGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGAALVHLSTLVPAIKDKLEDAEEKLGADIVQKALVAPASLIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  DWE+GYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE     
Sbjct  513  IKSSDWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE-KPKP  571

Query  157  tpapaaPQGLTV  122
                AAPQGLT+
Sbjct  572  KAPVAAPQGLTI  583



>ref|XP_011089934.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Sesamum indicum]
Length=588

 Score =   384 bits (985),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 223/235 (95%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA+DLGLLVENT ++ LGIARKVTITKDSTTIIADAASKDE+Q+RIAQLK
Sbjct  336  DIAILTGAEYQATDLGLLVENTDLDQLGIARKVTITKDSTTIIADAASKDELQTRIAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL E DS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  KELAEADSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTYVPAIKD LEDADE++GADI+QKAL+APASLIAQNAGVEGEVVVEK
Sbjct  456  IVPGGGAALVHLSTYVPAIKDKLEDADERIGADIIQKALIAPASLIAQNAGVEGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  +WE GYNAM+D +ENLVE GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  516  VKASEWEFGYNAMSDKFENLVETGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  570



>ref|XP_009376066.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Pyrus x bretschneideri]
Length=585

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DL LLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQANDLSLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELNETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIK+ L DADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSAYVPAIKEKLVDADERLGADIVQKALVAPAALIAQNAGMEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  514  IRDSEWEVGYNAMTDKYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  573

Query  157  tpapaaPQGLTV  122
            + A AAPQG+TV
Sbjct  574  STAAAAPQGMTV  585



>ref|XP_010689095.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Beta vulgaris subsp. vulgaris]
Length=586

 Score =   384 bits (985),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 226/235 (96%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLLVE+T VE LG+ARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQANDLGLLVESTSVEQLGLARKVTISKDSTTLIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VP+IK+ LEDADE+LGADIVQKALV+PASLIA NAGVEGEVVVEK
Sbjct  454  IVPGGGAALVHLSTFVPSIKEKLEDADERLGADIVQKALVSPASLIAYNAGVEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V  R+WE+GYNAMTD YENLVE+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  514  VMAREWEIGYNAMTDKYENLVESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  568



>ref|XP_009356893.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Pyrus x bretschneideri]
Length=585

 Score =   383 bits (983),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDL LLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQASDLSLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIK+ L DADE+LGADIVQKALVAPA+LIAQNAGVEGEVVVEK
Sbjct  454  IVPGGGAALVHLSAYVPAIKEKLLDADEQLGADIVQKALVAPAALIAQNAGVEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  514  IRDSEWEVGYNAMTDKYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  573

Query  157  tpapaaPQGLTV  122
            + A AAPQG+TV
Sbjct  574  SAAAAAPQGMTV  585



>ref|XP_008385355.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Malus domestica]
Length=585

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDL LLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQASDLSLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIK+ L DADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSAYVPAIKEKLIDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  514  IRDSEWEVGYNAMTDKYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  573

Query  157  tpapaaPQGLTV  122
            + A AAPQG+TV
Sbjct  574  SAAAAAPQGMTV  585



>ref|XP_006384931.1| RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT [Populus trichocarpa]
 gb|ERP62728.1| RUBISCO SUBUNIT BINDING-protein ALPHA SUBUNIT [Populus trichocarpa]
Length=587

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 218/249 (88%), Positives = 236/249 (95%), Gaps = 0/249 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +ENT +E LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLSIENTSIEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD +EDADE+LGADIVQKALV+PASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSTCVPAIKDKIEDADERLGADIVQKALVSPASLIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  515  LKASEWEIGYNAMTDKYENLMEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQG  131
            TPA AA QG
Sbjct  575  TPAAAATQG  583



>ref|XP_009367033.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Pyrus x bretschneideri]
Length=585

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDL L+VENT VE LG+ARKVTI++DSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQASDLSLVVENTSVEQLGLARKVTISRDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELNETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIK+ L DADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSAYVPAIKEKLVDADERLGADIVQKALVAPAALIAQNAGMEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  514  IRDSEWEVGYNAMTDKYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  573

Query  157  tpapaaPQGLTV  122
            + A AAPQG+TV
Sbjct  574  STAAAAPQGMTV  585



>ref|XP_011089255.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Sesamum indicum]
 ref|XP_011089256.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X2 [Sesamum indicum]
Length=597

 Score =   383 bits (983),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 224/235 (95%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DLGLLVENT ++ LG ARK+TI K+STTIIADAASKDE+Q+RIAQLK
Sbjct  338  DIAIVTGAEYQATDLGLLVENTDIDQLGSARKITINKESTTIIADAASKDELQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST+VPAIKD LEDADE+LGADI+QKAL+APASLIAQNAGVEGEVVV+K
Sbjct  458  IVPGGGAALVHLSTHVPAIKDKLEDADERLGADIIQKALIAPASLIAQNAGVEGEVVVDK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  +WE GYNAMTD+YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  518  VKAGEWEFGYNAMTDAYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  572



>ref|XP_004145754.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Cucumis sativus]
 gb|KGN46860.1| hypothetical protein Csa_6G147530 [Cucumis sativus]
Length=583

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLLVENT +E LG+ARKVTI+KD+TTIIADAASKDE+Q+RI QLK
Sbjct  333  DIAILTGAEFQANDLGLLVENTTIEQLGLARKVTISKDTTTIIADAASKDELQARIGQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LEDA+EKLGADI+QKALVAPASLIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGAALVHLSTLVPAIKDKLEDAEEKLGADIIQKALVAPASLIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  DWE+GYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE     
Sbjct  513  IKSSDWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE-KPKP  571

Query  157  tpapaaPQGLTV  122
                AAPQGLTV
Sbjct  572  KAPVAAPQGLTV  583



>ref|XP_007016822.1| RuBisCO large subunit-binding protein subunit alpha isoform 2 
[Theobroma cacao]
 gb|EOY34441.1| RuBisCO large subunit-binding protein subunit alpha isoform 2 
[Theobroma cacao]
Length=586

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKV I+KDST +IA+AASKDEIQ+R+AQLK
Sbjct  335  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVIISKDSTQLIAEAASKDEIQARVAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHL+T VPAIKD LE+ADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAAFVHLTTCVPAIKDKLEEADERLGADIVQKALVAPASLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN++SVAGMVLTTQAIVVEKPKPK
Sbjct  515  VKNSEWEIGYNAMTDKYENLLEAGVIDPAKVTRCALQNASSVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AA QGLT+
Sbjct  575  APAAAAAQGLTI  586



>emb|CDX83280.1| BnaA03g22260D [Brassica napus]
Length=582

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  331  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  451  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  511  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  570

Query  157  tpapaaPQGLTV  122
             PA A PQGL V
Sbjct  571  APAAAPPQGLMV  582



>ref|XP_009103638.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Brassica rapa]
Length=585

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  334  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGATLVHLSTVIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  514  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  573

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  574  DPAAAAPEGLMV  585



>gb|AFK45390.1| unknown [Lotus japonicus]
Length=587

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QAS+LGLLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+R+AQLK
Sbjct  336  DIAILTGAEFQASNLGLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARVAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELF TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  KELFATDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLS +VPAIK+ LED +E+LGADIVQKALVAPASLIAQNAGVEGEVVVEK
Sbjct  456  IVPGGGTALVHLSAFVPAIKEKLEDPEERLGADIVQKALVAPASLIAQNAGVEGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAMTD YEN+VEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  516  IKNGEWEVGYNAMTDKYENIVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKAKPK  575

Query  157  tpapaaPQGLTV  122
             P  AAPQGLT+
Sbjct  576  APVAAAPQGLTI  587



>dbj|BAD95121.1| putative rubisco subunit binding-protein alpha subunit [Arabidopsis 
thaliana]
Length=333

 Score =   372 bits (956),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY A D+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  82   DIAILTGAEYLAMDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  141

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  142  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  201

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST +PAIK+T EDADE+LGADIVQKAL++PA+LIAQNAGVEGEVVVEK
Sbjct  202  IVPGGGAALVHLSTVIPAIKETFEDADERLGADIVQKALLSPAALIAQNAGVEGEVVVEK  261

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVV  176
            +   DWE GYNAMTD+YENL EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV
Sbjct  262  IMFSDWENGYNAMTDTYENLFEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVV  315



>ref|XP_010542582.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Tarenaya hassleriana]
Length=585

 Score =   381 bits (978),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASD+GLLVENT V+ LGIARK+TI+KDSTTIIAD ASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQASDMGLLVENTTVDQLGIARKITISKDSTTIIADEASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIK+ LED DE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTVVPAIKEKLEDPDERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            + + +WE+GYNAMTD YENL+E GVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  514  IMESEWEIGYNAMTDKYENLLETGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQGLTV  122
             PA AAPQGLTV
Sbjct  574  APAAAAPQGLTV  585



>gb|ACJ85785.1| unknown [Medicago truncatula]
Length=587

 Score =   381 bits (978),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVE+T +E LG+ARKVTI+KDSTTIIADAASKDE+QSR+AQLK
Sbjct  336  DIAILTGAEFQASDLGLLVESTPIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG A VHL  YVPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  456  IAPGGGTALVHLFAYVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGIEGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R  +WEVGYNAMTD+YENL+E GVIDPAKVTR ALQN+ASVAGMVLTTQAIVVEKPKP+
Sbjct  516  IRSGEWEVGYNAMTDTYENLIEFGVIDPAKVTRRALQNAASVAGMVLTTQAIVVEKPKPR  575

Query  157  tpapaaPQGLTV  122
              A AAPQGLTV
Sbjct  576  AAAAAAPQGLTV  587



>emb|CDY31190.1| BnaC03g47010D [Brassica napus]
Length=586

 Score =   381 bits (978),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DI+I+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  335  DISILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA A PQGL V
Sbjct  575  APAAAPPQGLMV  586



>emb|CDY04527.1| BnaA07g13530D [Brassica napus]
Length=596

 Score =   381 bits (978),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 238/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  345  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  404

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  405  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  464

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  465  IVPGGGATLVHLSTVIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  524

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  525  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  584

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  585  APAAAAPEGLMV  596



>ref|XP_008359517.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Malus domestica]
Length=585

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 235/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA DL LLVENT VE LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  334  DIAILTGAEFQAXDLSLLVENTSVEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELXETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIK+ L DADE+LGADIVQKALVAPA+LIAQNAG+EGEVVV+K
Sbjct  454  IVPGGGAALVHLSAYVPAIKEKLVDADERLGADIVQKALVAPAALIAQNAGIEGEVVVDK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KP 
Sbjct  514  IRDSEWEVGYNAMTDKYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPX  573

Query  157  tpapaaPQGLTV  122
              A AAPQG+TV
Sbjct  574  XAAAAAPQGMTV  585



>ref|XP_007132293.1| hypothetical protein PHAVU_011G082600g [Phaseolus vulgaris]
 gb|ESW04287.1| hypothetical protein PHAVU_011G082600g [Phaseolus vulgaris]
Length=584

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLL+E+T VE LG+ARKVTI+KDSTT+IADAA+KDE+Q+RI QLK
Sbjct  333  DIAILTGAEFQASDLGLLIESTSVEQLGLARKVTISKDSTTLIADAATKDELQARIGQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLSTYVPAIK+ LE+ADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGTALVHLSTYVPAIKERLEEADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +++ +WEVGYNAM D YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  513  IKNGEWEVGYNAMADRYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKQKPK  572

Query  157  tpapaaPQGLTV  122
             P   APQGLTV
Sbjct  573  APVAGAPQGLTV  584



>ref|XP_009140840.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Brassica rapa]
Length=585

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT +E LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  334  DIAILTGAEYQALDMGLLVENTTIEQLGIARKVTISKDSTTLIADAASKDELQARISQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  514  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  573

Query  157  tpapaaPQGLTV  122
             PA AAPQGL V
Sbjct  574  APAAAAPQGLMV  585



>emb|CDX77147.1| BnaC04g39420D [Brassica napus]
Length=622

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 219/279 (78%), Positives = 243/279 (87%), Gaps = 14/279 (5%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  334  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKL+GGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLAGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  514  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  573

Query  157  tpapaaPQGLTV*SIDSEHVV*TFG----VVKLHHCREM  53
             P  A PQGL V          T+G    V   HH  EM
Sbjct  574  APTAAPPQGLMV----------TYGTSSVVTTQHHQGEM  602



>ref|XP_010940621.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Elaeis guineensis]
Length=579

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +EN  VE LG ARKVTI+++STTIIADAA+KDEIQ+RIAQLK
Sbjct  328  DIAILTGAEFQASDLGLSIENASVEQLGTARKVTISQNSTTIIADAATKDEIQARIAQLK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  388  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPAIKD LED+DE+LGADIVQKALVAPA+LIA+NAGVEGEVVVEK
Sbjct  448  IVPGGGAAFVHLSTSVPAIKDKLEDSDERLGADIVQKALVAPAALIARNAGVEGEVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D  WEVGYNAMTD YENLVEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  508  IKDSKWEVGYNAMTDKYENLVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKPKPK  567

Query  157  tpapaaPQGLTV  122
                A PQGL V
Sbjct  568  ARPAAQPQGLAV  579



>ref|XP_010940622.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X2 [Elaeis guineensis]
Length=578

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 233/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +EN  VE LG ARKVTI+++STTIIADAA+KDEIQ+RIAQLK
Sbjct  327  DIAILTGAEFQASDLGLSIENASVEQLGTARKVTISQNSTTIIADAATKDEIQARIAQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  387  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPAIKD LED+DE+LGADIVQKALVAPA+LIA+NAGVEGEVVVEK
Sbjct  447  IVPGGGAAFVHLSTSVPAIKDKLEDSDERLGADIVQKALVAPAALIARNAGVEGEVVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D  WEVGYNAMTD YENLVEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  507  IKDSKWEVGYNAMTDKYENLVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKPKPK  566

Query  157  tpapaaPQGLTV  122
                A PQGL V
Sbjct  567  ARPAAQPQGLAV  578



>gb|KJB83861.1| hypothetical protein B456_013G268400 [Gossypium raimondii]
Length=578

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LGIARKV ITKDST IIADAASKDEIQ+R+ QLK
Sbjct  327  DIAILTGAEFQANDLGLLIENTSVEQLGIARKVIITKDSTQIIADAASKDEIQARVQQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  387  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LED++E++GADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  447  IVPGGGAALVHLSTCVPAIKDKLEDSEERIGADIVQKALVAPASLIAQNAGMEGEVVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WE+GYNAMTD+YEN++EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  507  VKNSEWEIGYNAMTDTYENMLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  566

Query  157  tpapaaPQGLTV  122
             PA AAP+GLT+
Sbjct  567  APAAAAPEGLTI  578



>gb|EPS67631.1| hypothetical protein M569_07141, partial [Genlisea aurea]
Length=583

 Score =   379 bits (972),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 223/235 (95%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA+DLGLL+ENT V+ LG ARK+TI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  338  DIAILTGAEYQAADLGLLIENTDVDQLGTARKITISKDSTTIIADAASKDELQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VP IKD L+ ADEKLGADI+QKAL++PA+LIAQNAGVEGEVVV+K
Sbjct  458  IVPGGGAAFVHLSTLVPTIKDKLDGADEKLGADIIQKALISPAALIAQNAGVEGEVVVDK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  +WE GYNAMTD YENLVE+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  518  VKASEWEYGYNAMTDKYENLVESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  572



>ref|XP_006827424.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Amborella trichopoda]
 gb|ERM94840.1| hypothetical protein AMTR_s00009p00080200 [Amborella trichopoda]
Length=581

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 235/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVE+  VE LG ARKVTITKDSTTIIADAA+KDEIQ+RIAQ+K
Sbjct  330  DIAILTGAEYQASDLGLLVESATVEQLGTARKVTITKDSTTIIADAATKDEIQARIAQIK  389

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  390  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  449

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLS +VPAIK+ LEDADE+LGA+IV KALVAPA+LIAQNAGVEGEV+VEK
Sbjct  450  IVPGGGTAYVHLSAHVPAIKEKLEDADERLGAEIVMKALVAPAALIAQNAGVEGEVIVEK  509

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WEVGYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKP+PK
Sbjct  510  IKTGEWEVGYNAMTDRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPQPK  569

Query  157  tpapaaPQGLTV  122
             P  A PQGL++
Sbjct  570  APVAAPPQGLSI  581



>gb|KJB83859.1| hypothetical protein B456_013G268400 [Gossypium raimondii]
Length=586

 Score =   378 bits (971),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LGIARKV ITKDST IIADAASKDEIQ+R+ QLK
Sbjct  335  DIAILTGAEFQANDLGLLIENTSVEQLGIARKVIITKDSTQIIADAASKDEIQARVQQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LED++E++GADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSTCVPAIKDKLEDSEERIGADIVQKALVAPASLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WE+GYNAMTD+YEN++EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  515  VKNSEWEIGYNAMTDTYENMLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GLT+
Sbjct  575  APAAAAPEGLTI  586



>sp|P21239.2|RUB1_BRANA RecName: Full=RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
alpha; AltName: Full=CPN-60 alpha; Flags: Precursor, partial 
[Brassica napus]
 gb|AAA32979.1| 60-kDa chaperonin-60 alpha-polypeptide precursor, partial [Brassica 
napus]
Length=546

 Score =   377 bits (967),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 235/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  295  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLK  354

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKL+GGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  355  KELSETDSVYDSEKLAERIAKLAGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  414

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  415  IVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  474

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  475  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  534

Query  157  tpapaaPQGLTV  122
             P  A PQGL V
Sbjct  535  APTAAPPQGLMV  546



>ref|XP_007016821.1| RuBisCO large subunit-binding protein subunit alpha isoform 1 
[Theobroma cacao]
 gb|EOY34440.1| RuBisCO large subunit-binding protein subunit alpha isoform 1 
[Theobroma cacao]
Length=602

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 225/235 (96%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKV I+KDST +IA+AASKDEIQ+R+AQLK
Sbjct  335  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVIISKDSTQLIAEAASKDEIQARVAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHL+T VPAIKD LE+ADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAAFVHLTTCVPAIKDKLEEADERLGADIVQKALVAPASLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN++SVAGMVLTTQAIVVE
Sbjct  515  VKNSEWEIGYNAMTDKYENLLEAGVIDPAKVTRCALQNASSVAGMVLTTQAIVVE  569



>ref|XP_009588017.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Nicotiana tomentosiformis]
Length=589

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA++LG+LVENT VEALG ARKVTI+KDSTTI+AD ASKDEIQ+RI+QLK
Sbjct  338  DIAIVTGAEYQATELGMLVENTPVEALGFARKVTISKDSTTILADDASKDEIQTRISQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL  TDSI DSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAK+ATFAAIEEG
Sbjct  398  KELDMTDSISDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKHATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTYVPAIKD LED DEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK
Sbjct  458  IVPGGGAALVHLSTYVPAIKDNLEDPDEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++   W++GYNAMTD YENLVEAGVIDPA VTRCALQN+ASVAG+VLTTQAIVV+K  PK
Sbjct  518  IKASKWKMGYNAMTDKYENLVEAGVIDPAMVTRCALQNAASVAGVVLTTQAIVVDKYTPK  577

Query  157  tpapaaPQGLTV  122
             PA A PQGL +
Sbjct  578  APAFAPPQGLPM  589



>emb|CDY30514.1| BnaA04g16190D [Brassica napus]
Length=585

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT +E LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  334  DIAILTGAEYQALDMGLLVENTTIEQLGIARKVTISKDSTTLIADAASKDELQARISQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+ LEDADE+L ADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGATLVHLSTVIPAIKEKLEDADERLAADIVQKALVAPAALIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  514  IMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  573

Query  157  tpapaaPQGLTV  122
             PA AAPQGL V
Sbjct  574  APAAAAPQGLMV  585



>ref|XP_010510705.1| PREDICTED: chaperonin 60 subunit alpha 1, chloroplastic-like 
[Camelina sativa]
Length=586

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY ASD+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLASDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGATLVHLSTAIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  575  APAAAAPEGLMV  586



>ref|XP_010470145.1| PREDICTED: chaperonin 60 subunit alpha 1, chloroplastic [Camelina 
sativa]
Length=586

 Score =   376 bits (965),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY ASD+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLASDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGATLVHLSTAIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  575  APAAAAPEGLMV  586



>gb|KHG19067.1| RuBisCO large subunit-binding subunit alpha, chloroplastic [Gossypium 
arboreum]
 gb|KHG22569.1| RuBisCO large subunit-binding subunit alpha, chloroplastic [Gossypium 
arboreum]
Length=586

 Score =   375 bits (964),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 235/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LGIARKV ITKDST IIADAASKDEIQ+R+ QLK
Sbjct  335  DIAILTGAEFQANDLGLLIENTSVEQLGIARKVIITKDSTQIIADAASKDEIQARVQQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LED +E++GADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSTCVPAIKDKLEDPEERIGADIVQKALVAPASLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WE+GYNAMTD+YENL+ AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  515  VKNSEWEIGYNAMTDTYENLLAAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKAKPK  574

Query  157  tpapaaPQGLTV  122
             PA A P+GLT+
Sbjct  575  APAAAPPEGLTI  586



>ref|XP_011040914.1| PREDICTED: LOW QUALITY PROTEIN: ruBisCO large subunit-binding 
protein subunit alpha-like [Populus euphratica]
Length=586

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 233/249 (94%), Gaps = 1/249 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGL +ENT +E LG+ARKVTI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLSIENTSIEQLGLARKVTISKDSTTIIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVG  TE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELSETDSVYDSEKLAERIAKLSGGVAVIKVG-XTETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD +EDADE+LGADIVQKALV+PASLIAQNAG+EGEVVVEK
Sbjct  454  IVPGGGAALVHLSTCVPAIKDKIEDADERLGADIVQKALVSPASLIAQNAGIEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK
Sbjct  514  LKASEWEIGYNAMTDKYENLMEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEKPKPK  573

Query  157  tpapaaPQG  131
            TPA  A QG
Sbjct  574  TPAADATQG  582



>ref|XP_006293462.1| hypothetical protein CARUB_v10022881mg [Capsella rubella]
 gb|EOA26360.1| hypothetical protein CARUB_v10022881mg [Capsella rubella]
Length=586

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 235/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY A D+ LLVEN  +E LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLALDMSLLVENATIEQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGATLVHLSTAIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  575  APAAAAPEGLMV  586



>ref|XP_010414593.1| PREDICTED: chaperonin 60 subunit alpha 1, chloroplastic-like 
[Camelina sativa]
Length=587

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY ASD+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLASDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVAPA+LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGATLVHLSTAIPAIKETFEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+
Sbjct  515  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVD  569



>gb|AAM63618.1| putative rubisco subunit binding-protein alpha subunit [Arabidopsis 
thaliana]
Length=586

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY A D+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLAMDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST +PAIK+T EDADE+LGADIVQKAL++PA+LIAQNAGVEGEVVVEK
Sbjct  455  IVPGGGAALVHLSTVIPAIKETFEDADERLGADIVQKALLSPAALIAQNAGVEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   DWE GYNAMTD+YENL EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSDWENGYNAMTDTYENLFEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  575  APAAAAPEGLMV  586



>gb|KJB56194.1| hypothetical protein B456_009G109900 [Gossypium raimondii]
Length=586

 Score =   373 bits (958),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT  E LGIARKV ITKDST +IA+AASKDEIQ+R+AQLK
Sbjct  335  DIAILTGAEFQASDLGLLVENTSGEQLGIARKVIITKDSTQLIAEAASKDEIQTRVAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAQTDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS+ VPAIK+ LEDADE+LGADIVQKALVAPASLIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSSCVPAIKEKLEDADERLGADIVQKALVAPASLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  +WEVGYNAMTD +ENL+EAGVIDPAKVTRCALQN++SVAGMVLTTQAIVVE
Sbjct  515  VKSSEWEVGYNAMTDKFENLLEAGVIDPAKVTRCALQNASSVAGMVLTTQAIVVE  569



>ref|NP_180367.1| chaperonin-60 alpha [Arabidopsis thaliana]
 sp|P21238.2|CPNA1_ARATH RecName: Full=Chaperonin 60 subunit alpha 1, chloroplastic; Short=CPN-60 
alpha 1; AltName: Full=Protein SCHLEPPERLESS; AltName: 
Full=RuBisCO large subunit-binding protein subunit alpha 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA92061.1| chaperonin-60 alpha subunit [Arabidopsis thaliana]
 gb|AAD21502.1| putative rubisco subunit binding-protein alpha subunit [Arabidopsis 
thaliana]
 gb|AAO00801.1| putative rubisco subunit binding-protein alpha subunit [Arabidopsis 
thaliana]
 gb|AAP68223.1| At2g28000 [Arabidopsis thaliana]
 gb|AEC08068.1| chaperonin-60 alpha [Arabidopsis thaliana]
Length=586

 Score =   373 bits (958),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY A D+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLAMDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST +PAIK+T EDADE+LGADIVQKAL++PA+LIAQNAGVEGEVVVEK
Sbjct  455  IVPGGGAALVHLSTVIPAIKETFEDADERLGADIVQKALLSPAALIAQNAGVEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   DWE GYNAMTD+YENL EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  515  IMFSDWENGYNAMTDTYENLFEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  574

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  575  APAAAAPEGLMV  586



>gb|KHG04080.1| RuBisCO large subunit-binding subunit alpha, chloroplastic [Gossypium 
arboreum]
Length=586

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 221/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKV ITKDST +IA+AASKDEIQ+R+AQLK
Sbjct  335  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVIITKDSTQLIAEAASKDEIQTRVAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAQTDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS+ VPAIK+ LEDADE+LGADIVQKALVAPA LIAQNAG+EGEVVVEK
Sbjct  455  IVPGGGAALVHLSSCVPAIKEKLEDADERLGADIVQKALVAPALLIAQNAGMEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  +WEVGYNAMTD +ENL+E GVIDPAKVTRCALQN++SVAGMVLTTQAIVVE
Sbjct  515  VKSSEWEVGYNAMTDKFENLLEVGVIDPAKVTRCALQNASSVAGMVLTTQAIVVE  569



>ref|XP_009384573.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Musa acuminata subsp. malaccensis]
Length=586

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLL+EN  VE LG ARK+TI + STTIIADAASKDEIQ+RIAQLK
Sbjct  334  DIAIVTGAEFQAKDLGLLIENVSVEQLGTARKITIAQTSTTIIADAASKDEIQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD +EDADE++GADIVQKALVAPA+LIA NAGVEGEVVVEK
Sbjct  454  IVPGGGAALVHLSTTVPAIKDKIEDADERIGADIVQKALVAPAALIADNAGVEGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE+GYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+
Sbjct  514  IKDSEWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVD  568



>ref|XP_010935727.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Elaeis guineensis]
Length=578

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA DLG+L+ENT VE LG ARKV I+++STTIIAD A+KDEI +RIAQLK
Sbjct  327  DIAILTGAEFQAKDLGMLIENTSVEQLGTARKVIISQNSTTIIADTATKDEIHARIAQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  387  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD LED DE+LGADIVQKALVAP++LIA NAGVEGEVVVEK
Sbjct  447  IVPGGGAALVHLSTSVPAIKDKLEDPDERLGADIVQKALVAPSALIAHNAGVEGEVVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +RD +WEVGYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  507  IRDSEWEVGYNAMTDKFENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  566

Query  157  tpapaaPQGLTV  122
             PA A PQGL +
Sbjct  567  APAAAPPQGLAI  578



>ref|XP_003558045.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Brachypodium distachyon]
Length=587

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVE T VE LGIARKVTI++ STTIIAD A+KDEIQ+RIAQLK
Sbjct  337  DIAIVTGAEFQAKDLGLLVEKTTVEQLGIARKVTISQSSTTIIADVATKDEIQARIAQLK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  RELSQTDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+ L+D +E+LGADI+QKALVAPA+LIAQNAGVEGEV+VEK
Sbjct  457  IVPGGGAAYVHLSTFVPAIKEKLDDPEERLGADIIQKALVAPAALIAQNAGVEGEVIVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE GYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+
Sbjct  517  IKDSEWEFGYNAMTDKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVD  571



>ref|XP_008800531.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Phoenix dactylifera]
Length=579

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 232/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE QA DLGLL+ENT VE LG ARK+TI+++STTIIADAA+KDEIQ+RIAQLK
Sbjct  328  DIAILTGAELQAKDLGLLIENTSVEQLGTARKITISQNSTTIIADAATKDEIQARIAQLK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLR+EDAKNATFAAIEEG
Sbjct  388  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRVEDAKNATFAAIEEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VH+S  VPA+KD LED  E+LGADIVQKALVAPA+LIA NAGVEGEVVVEK
Sbjct  448  IVPGGGAALVHMSASVPAMKDKLEDPVERLGADIVQKALVAPAALIAHNAGVEGEVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D  WEVGYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  508  IKDSQWEVGYNAMTDKFENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  567

Query  157  tpapaaPQGLTV  122
             PA A PQGLT+
Sbjct  568  APAAAPPQGLTI  579



>ref|XP_009757979.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Nicotiana sylvestris]
Length=589

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA++LG+LVENT VEALG ARKVTI+KDST I+AD ASKDEIQ+RI+QLK
Sbjct  338  DIAIVTGAEYQATELGMLVENTPVEALGFARKVTISKDSTIILADDASKDEIQARISQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL  TDSI DSEKLAERIAKL GGVAVIKVGAATEAELEDRKLRIEDAK+ATFAAIEEG
Sbjct  398  KELDMTDSISDSEKLAERIAKLCGGVAVIKVGAATEAELEDRKLRIEDAKHATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLSTYV AIKD LED DEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK
Sbjct  458  IVPGGGAALVHLSTYVHAIKDNLEDPDEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++   W++GYNAMTD YENLVEAG+IDPA VTRCALQN+ASVAG+VLTTQAIVV+K  PK
Sbjct  518  IKASKWKMGYNAMTDKYENLVEAGIIDPAMVTRCALQNAASVAGVVLTTQAIVVDKHTPK  577

Query  157  tpapaaPQGLTV  122
             PA A PQGL +
Sbjct  578  APAFAPPQGLPM  589



>ref|XP_003581066.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Brachypodium distachyon]
Length=578

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLGLLVEN  V+ LG ARK+TI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  326  DIAIVTGAEFLAKDLGLLVENATVDQLGTARKITIHQTTTTLIADAASKDEIQARVAQLK  385

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  386  KELSETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  445

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+T+ED DE+LGADI+QKAL+APASLIA NAGVEGEVVVEK
Sbjct  446  IVPGGGAAYVHLSTFVPAIKETIEDHDERLGADIIQKALIAPASLIANNAGVEGEVVVEK  505

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  506  IKDSEWEMGYNAMTDTYENLIEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  560



>ref|XP_002880957.1| CPN60A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57216.1| CPN60A [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY A D+ LLVEN  ++ LGIARKVTI+KDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEYLAMDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST +PAIK+T EDADE+LGADIVQKAL++PA+LIAQNAGVEGEVVVEK
Sbjct  455  IVPGGGAALVHLSTVIPAIKETFEDADERLGADIVQKALLSPAALIAQNAGVEGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +WE GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+
Sbjct  515  IMFSEWEQGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVD  569



>ref|XP_009386348.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=577

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA DLGLL+E+  VE LG ARKVTI+++STTII+DAA+KDEIQSRIAQLK
Sbjct  326  DIAIMTGAEFQAKDLGLLIESVSVEQLGTARKVTISQNSTTIISDAATKDEIQSRIAQLK  385

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  386  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  445

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLS  VPAIK  LED DE LGADIVQKALVAPA+LIAQNAGVEGEVVVEK
Sbjct  446  IVPGGGAAYVHLSASVPAIKKKLEDHDELLGADIVQKALVAPAALIAQNAGVEGEVVVEK  505

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN+AS+AGM+LTTQAIVVEKPK K
Sbjct  506  IKDGEWEIGYNAMTDKYENLLEAGVIDPAKVTRCALQNAASIAGMLLTTQAIVVEKPKKK  565

Query  157  tpapaaPQGLTV  122
            +P+    +GL V
Sbjct  566  SPSNPPAKGLAV  577



>gb|EMT15819.1| putative RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Aegilops tauschii]
Length=514

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLG L+E T VE LGIARKVTI+  STTIIAD A+KDEIQ+RIAQLK
Sbjct  263  DIAIVTGAEFQAKDLGQLIEQTTVEQLGIARKVTISGSSTTIIADVATKDEIQARIAQLK  322

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  323  RELSQTDSTYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  382

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+ L+D +E+LGADI+QKALVAPASLIA NAGVEGEV+VEK
Sbjct  383  IVPGGGAAYVHLSTFVPAIKEKLDDPEERLGADIIQKALVAPASLIAHNAGVEGEVIVEK  442

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE GYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  443  IKDSEWEFGYNAMTDKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  497



>gb|EMS63359.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Triticum urartu]
Length=525

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLG L+E T VE LGIARKVTI+  STTIIAD A+KDEIQ+RIAQLK
Sbjct  274  DIAIVTGAEFQAKDLGQLIEQTTVEQLGIARKVTISGSSTTIIADVATKDEIQARIAQLK  333

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  334  RELSQTDSTYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  393

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+ L+D +E+LGADI+QKALVAPASLIA NAGVEGEV+VEK
Sbjct  394  IVPGGGAAYVHLSTFVPAIKEKLDDPEERLGADIIQKALVAPASLIAHNAGVEGEVIVEK  453

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE GYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  454  IKDSEWEFGYNAMTDKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  508



>gb|ABG00012.1| RuBisCO subunit binding-protein alpha subunit, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=479

 Score =   363 bits (931),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVE+T VE LGIARKVTI++ STTIIAD A+KDEIQ+RIAQLK
Sbjct  226  DIAIVTGAEFQAKDLGLLVESTTVEQLGIARKVTISQSSTTIIADVATKDEIQARIAQLK  285

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  286  RELSQTDSAYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  345

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLS +VPAIK+ L+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+VEK
Sbjct  346  IVPGGGAAYVHLSKFVPAIKEKLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVEK  405

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +++ +WEVGYNAM D +ENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  406  IKESEWEVGYNAMADRHENLVQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  460



>ref|NP_001276148.1| ruBisCO large subunit-binding protein subunit alpha, chloroplastic-like 
[Glycine max]
 gb|AEO21430.1| putative rubisco subunit binding-protein alpha subunit [Glycine 
max]
Length=584

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LG+ARK+TI+KDSTTIIADAA+KDE+Q+R+AQLK
Sbjct  333  DIAILTGAEFQASDLGLLVENTSVEQLGLARKITISKDSTTIIADAATKDELQARVAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSQTDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLST+VPAIKD LEDADE+LGADIVQKAL+APA+LIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGTALVHLSTHVPAIKDKLEDADERLGADIVQKALIAPAALIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WEVGYNAM D YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  513  IKSGEWEVGYNAMADRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  572

Query  157  tpapaaPQGLTV  122
             P   APQGLTV
Sbjct  573  APVAGAPQGLTV  584



>sp|P08823.1|RUBA_WHEAT RecName: Full=RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
alpha; AltName: Full=CPN-60 alpha; Flags: Precursor, partial 
[Triticum aestivum]
 emb|CAA30699.1| unnamed protein product [Triticum aestivum]
Length=543

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEY A DLGLLVEN  V+ LG ARK+TI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  291  DIAIVTGAEYLAKDLGLLVENATVDQLGTARKITIHQTTTTLIADAASKDEIQARVAQLK  350

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGA TE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  351  KELSETDSIYDSEKLAERIAKLSGGVAVIKVGATTETELEDRQLRIEDAKNATFAAIEEG  410

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLSTYVPAIK+T+ED DE+LGADI+QKAL APASLIA NAGVEGEVV+EK
Sbjct  411  IVPGGGAAYVHLSTYVPAIKETIEDHDERLGADIIQKALQAPASLIANNAGVEGEVVIEK  470

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +++ +WE+GYNAMTD YENL+E+GVIDPAKVTRCALQN+ASV+GMVLTTQAIVVE
Sbjct  471  IKESEWEMGYNAMTDKYENLIESGVIDPAKVTRCALQNAASVSGMVLTTQAIVVE  525



>ref|XP_006652052.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Oryza brachyantha]
Length=582

 Score =   365 bits (937),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 221/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVENT VE LGIARKV I++ +TTIIAD A+KDEIQ+RIAQLK
Sbjct  332  DIAIVTGAEFQAKDLGLLVENTTVEQLGIARKVKISQSATTIIADVATKDEIQARIAQLK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  392  RELSQTDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+ L+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+VEK
Sbjct  452  IVPGGGAAYVHLSTFVPAIKEKLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WEVGYNAM D +ENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  512  IKDSEWEVGYNAMADKHENLVQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  566



>ref|XP_006347191.1| PREDICTED: chaperonin 60 subunit alpha 1, chloroplastic-like 
[Solanum tuberosum]
Length=589

 Score =   365 bits (937),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 226/252 (90%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DL + VENT VEALG ARKVTITKDSTTI+AD  SKDEIQ+RI+Q+K
Sbjct  337  DIAIVTGAEYQAADLCMPVENTPVEALGFARKVTITKDSTTILADDVSKDEIQARISQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +++S+ DSEKL+ERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  KELDKSESVSDSEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  VPAIKD LED DEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK
Sbjct  457  IVPGGGAALVHLSNNVPAIKDNLEDPDEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++   W +GYNAMTD YE+LVEAGVIDPA VTRCALQN+ASVAGMVLTTQAIVV+K  P 
Sbjct  517  IKASKWRMGYNAMTDKYEDLVEAGVIDPAMVTRCALQNAASVAGMVLTTQAIVVDKKMPN  576

Query  157  tpapaaPQGLTV  122
             PA A PQGL +
Sbjct  577  APAFAPPQGLPM  588



>gb|EMT15798.1| putative RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Aegilops tauschii]
Length=570

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEY A DLGLLVEN  V+ LG ARK+TI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  318  DIAIVTGAEYLAKDLGLLVENATVDQLGTARKITIHQTTTTLIADAASKDEIQARVAQLK  377

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGA TE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  378  KELSETDSIYDSEKLAERIAKLSGGVAVIKVGATTETELEDRQLRIEDAKNATFAAIEEG  437

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLSTYVPAIK+T+ED DE+LGADI+QKAL APASLIA NAGVEGEVV+EK
Sbjct  438  IVPGGGAAYVHLSTYVPAIKETIEDHDERLGADIIQKALQAPASLIANNAGVEGEVVIEK  497

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R+ +WE+GYNAMTD YENL+E+GVIDPAKVTRCALQN+ASV+GMVLTTQAIVVE
Sbjct  498  IRESEWEMGYNAMTDKYENLIESGVIDPAKVTRCALQNAASVSGMVLTTQAIVVE  552



>gb|KHM98926.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Glycine soja]
Length=584

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LG+ARK+TI+KDSTT+IADAA+KDE+Q+R+AQLK
Sbjct  333  DIAILTGAEFQASDLGLLVENTSVEQLGLARKITISKDSTTVIADAATKDELQARVAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSQTDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLST+VPAIKD LEDADE+LGADIVQKAL+APA+LIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGTALVHLSTHVPAIKDKLEDADERLGADIVQKALIAPAALIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WEVGYNAM D YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  513  IKSGEWEVGYNAMADRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  572

Query  157  tpapaaPQGLTV  122
             P   APQGLTV
Sbjct  573  APVAGAPQGLTV  584



>gb|KHN38733.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Glycine soja]
Length=584

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LG+ARK+TI+KDSTTIIADAA+KDE+Q+R+AQLK
Sbjct  333  DIAILTGAEFQASDLGLLVENTSVEQLGLARKITISKDSTTIIADAATKDELQARVAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSQTDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLST+VPA+KD LEDADE+LGADIVQKAL+APA+LIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGTALVHLSTHVPALKDKLEDADERLGADIVQKALIAPAALIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WEVGYNAM D YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  513  IKSGEWEVGYNAMVDRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  572

Query  157  tpapaaPQGLTV  122
             P   APQGLTV
Sbjct  573  APVAGAPQGLTV  584



>dbj|BAJ93636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=587

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLG L+E T VE LGIARKVTI+  STTIIAD A+KDEIQ+R+AQLK
Sbjct  336  DIAIVTGAEFQAKDLGQLIEQTTVEQLGIARKVTISGSSTTIIADVATKDEIQARVAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  RELSQTDSTYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+ L+D +E+LGADI+QKALVAPASLIA NAGVEGEV+VEK
Sbjct  456  IVPGGGAAYVHLSTFVPAIKEKLDDPEERLGADIIQKALVAPASLIAHNAGVEGEVIVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WE GYNAMTD +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  516  IKDSEWEFGYNAMTDKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  570



>ref|XP_004241283.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Solanum lycopersicum]
Length=621

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 227/252 (90%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQA+DL + VE+T VEALG ARKVTITKDSTTI+AD  SKDEIQ+RI+Q+K
Sbjct  369  DIAIVTGAEYQAADLCMPVESTPVEALGFARKVTITKDSTTILADDVSKDEIQARISQIK  428

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL  ++S+ DSEKL+ERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  429  KELDMSESVSDSEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  488

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS YVPAIKD LED DEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK
Sbjct  489  IVPGGGAALVHLSNYVPAIKDNLEDPDEKLGADIVQKALVAPASLIAQNAGVEGEVVVEK  548

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++   W++GYNAMTD YE+LVEAGVIDPA VTRCALQN+ASVAGMVLTTQAIVV+K  P 
Sbjct  549  IKGSKWKMGYNAMTDKYEDLVEAGVIDPAMVTRCALQNAASVAGMVLTTQAIVVDKKMPS  608

Query  157  tpapaaPQGLTV  122
             PA A PQGL +
Sbjct  609  APAFAPPQGLPM  620



>ref|XP_006591127.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like isoform X1 [Glycine max]
Length=584

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 237/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LG+ARK+TI+KDSTTIIADAA+KDE+Q+R+AQLK
Sbjct  333  DIAILTGAEFQASDLGLLVENTSVEQLGLARKITISKDSTTIIADAATKDELQARVAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSQTDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A VHLST+VPA+KD L+DADE+LGADIVQKAL+APA+LIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGTALVHLSTHVPALKDKLDDADERLGADIVQKALIAPAALIAQNAGIEGEVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +WEVGYNAM D YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  513  IKSGEWEVGYNAMVDRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  572

Query  157  tpapaaPQGLTV  122
             P   APQGLTV
Sbjct  573  APVAGAPQGLTV  584



>gb|EAY92674.1| hypothetical protein OsI_14427 [Oryza sativa Indica Group]
Length=584

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVE+T VE LGIARKVTI++ STTIIAD A+KDEIQ+RIAQLK
Sbjct  331  DIAIVTGAEFQAKDLGLLVESTTVEQLGIARKVTISQSSTTIIADVATKDEIQARIAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  RELSQTDSAYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLS +VPAIK+ L+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+VEK
Sbjct  451  IVPGGGAAYVHLSKFVPAIKEKLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +++ +WEVGYNAM D +ENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  511  IKESEWEVGYNAMADRHENLVQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  565



>gb|EYU18802.1| hypothetical protein MIMGU_mgv1a003263mg [Erythranthe guttata]
Length=595

 Score =   363 bits (931),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 208/235 (89%), Positives = 224/235 (95%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT V+ LGIARK+TI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  338  DIAILTGAEYQASDLGLLVENTDVDQLGIARKITISKDSTTIIADAASKDELQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKDT+ED +EKLGADI+QKAL+APA+LIAQNAGVEGEVVVEK
Sbjct  458  IVPGGGAALVHLSTCVPAIKDTIEDPEEKLGADIIQKALIAPAALIAQNAGVEGEVVVEK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  +WE GYNAMTD YENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  518  IRASEWEFGYNAMTDVYENLVDAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  572



>gb|AAP44754.1| putative rubisco subunit binding-protein alpha subunit precursor 
(60 kDa chaperonin alpha subunit) [Oryza sativa Japonica 
Group]
 gb|ABG00011.1| RuBisCO subunit binding-protein alpha subunit, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ29379.1| hypothetical protein OsJ_13451 [Oryza sativa Japonica Group]
 gb|ADR66965.1| 60 kDa chaperonin alpha subunit [Oryza sativa Japonica Group]
Length=584

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVE+T VE LGIARKVTI++ STTIIAD A+KDEIQ+RIAQLK
Sbjct  331  DIAIVTGAEFQAKDLGLLVESTTVEQLGIARKVTISQSSTTIIADVATKDEIQARIAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  RELSQTDSAYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLS +VPAIK+ L+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+VEK
Sbjct  451  IVPGGGAAYVHLSKFVPAIKEKLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +++ +WEVGYNAM D +ENLV+AGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  511  IKESEWEVGYNAMADRHENLVQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  565



>ref|NP_001066567.1| Os12g0277500 [Oryza sativa Japonica Group]
 gb|ABA97087.1| RuBisCO subunit binding-protein alpha subunit, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29586.1| Os12g0277500 [Oryza sativa Japonica Group]
 gb|EAY82761.1| hypothetical protein OsI_37967 [Oryza sativa Indica Group]
 gb|ADR66968.1| 60 kDa chaperonin alpha subunit [Oryza sativa Japonica Group]
Length=578

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLGLLVEN   E LG ARKVTI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  326  DIAIVTGAEFLAKDLGLLVENATEEQLGTARKVTIHQTTTTLIADAASKDEIQARVAQLK  385

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYD+EKLAERIAKLSGGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  386  KELSETDSIYDTEKLAERIAKLSGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  445

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLST VPAIK+T+ED DE+LGADI+QKALVAPASLIA NAGVEGEVVVEK
Sbjct  446  IVPGGGTAYVHLSTTVPAIKETIEDHDERLGADIIQKALVAPASLIAHNAGVEGEVVVEK  505

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WEVGYNAM D YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  506  IKDGEWEVGYNAMNDKYENLIEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  560



>ref|XP_006653189.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Oryza brachyantha]
Length=579

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 217/235 (92%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A D+GLLVEN   E LG ARKVTI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  327  DIAIVTGAEFLAKDMGLLVENATEEQLGTARKVTIHQTTTTLIADAASKDEIQARVAQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYD+EKLAERIAKLSGGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  387  KELSETDSIYDTEKLAERIAKLSGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLST VPAIK+T+ED DE+LGADI+QKALVAPASLIA NAGVEGEVVVEK
Sbjct  447  IVPGGGTAYVHLSTSVPAIKETIEDHDERLGADIIQKALVAPASLIAHNAGVEGEVVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WEVGYNAM D YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  507  IKDGEWEVGYNAMNDKYENLIEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  561



>ref|XP_004962429.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Setaria italica]
Length=577

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLGLLVEN   E LG ARKVTI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  325  DIAIVTGAEFLAKDLGLLVENATEEQLGTARKVTIHQTTTTLIADAASKDEIQARVAQLK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKL+GGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  385  KELAETDSVYDTEKLAERIAKLAGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLST VP+IK+T+ED DE+LGADI+QKALVAPASLIA NAGVEGEVVVEK
Sbjct  445  IVPGGGTAYVHLSTIVPSIKETIEDPDERLGADIIQKALVAPASLIAHNAGVEGEVVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ +WEVGYNAMTD YENL+E+GVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  505  VKESEWEVGYNAMTDKYENLMESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  559



>gb|ABR18037.1| unknown [Picea sitchensis]
Length=598

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 228/252 (90%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ A DLG+ VENT+VE LG ARK+TI K STTII+DAASKDEIQ+RIAQ+K
Sbjct  347  DIAILTGADFIAGDLGMKVENTEVEQLGTARKITIAKGSTTIISDAASKDEIQARIAQIK  406

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGA TEAELED++LRIEDAKNATFAAI+EG
Sbjct  407  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGATTEAELEDKQLRIEDAKNATFAAIQEG  466

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLS+YVPAIK T+ED DE++GADIVQKALV+PA+LIA NAGVEG+VVVEK
Sbjct  467  IVPGGGAAFVHLSSYVPAIKQTIEDPDERIGADIVQKALVSPAALIANNAGVEGDVVVEK  526

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   DWE+GYNAMTD+YENL+ +GVIDP+KV RCALQN+ASVAGMVLTTQAIVVEKPK  
Sbjct  527  ILTSDWEMGYNAMTDTYENLLNSGVIDPSKVARCALQNAASVAGMVLTTQAIVVEKPKKS  586

Query  157  tpapaaPQGLTV  122
              A A  QG+T+
Sbjct  587  ISAAAPAQGMTI  598



>emb|CAN69818.1| hypothetical protein VITISV_037064 [Vitis vinifera]
Length=576

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 222/252 (88%), Gaps = 10/252 (4%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LG+ARKVTITKDSTTIIADAASKDEIQ+RIAQ+K
Sbjct  335  DIAIMTGAEFQANDLGLLIENTSVEQLGLARKVTITKDSTTIIADAASKDEIQARIAQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKL             E ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLF----------RWETELEDRKLRIEDAKNATFAAIEEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPAIKD LEDADE+LGADIVQKALVAPASLIA NAGVEGEVVVEK
Sbjct  445  IVPGGGAAFVHLSTXVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAGVEGEVVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++  +W VGYNAMTD YENLVEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  505  IKACEWAVGYNAMTDKYENLVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKAKPK  564

Query  157  tpapaaPQGLTV  122
             P  A PQGLT+
Sbjct  565  APVAAPPQGLTI  576



>gb|AAC68501.1| chaperonin 60 alpha subunit [Canavalia lineata]
Length=581

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 232/252 (92%), Gaps = 2/252 (1%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT +E LG+ARKVTI+KDSTTIIADAASKDE+Q+R+AQLK
Sbjct  332  DIAILTGAEFQASDLGLLVENTSIEQLGLARKVTISKDSTTIIADAASKDELQARVAQLK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETD++YDS KLAERI KLSGGVAVIKVGAATE ELEDRKLRIEDAKNATF AIE G
Sbjct  392  KELAETDAVYDSVKLAERITKLSGGVAVIKVGAATETELEDRKLRIEDAKNATF-AIEVG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IV     A +HLST+VPAIKD LEDADE+LGADIVQKAL+APASLIAQNAG+EGEVVVEK
Sbjct  451  IVL-VDTALLHLSTHVPAIKDKLEDADERLGADIVQKALIAPASLIAQNAGIEGEVVVEK  509

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            V++ +WEVGYNAMTD YENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  510  VKNGEWEVGYNAMTDRYENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKPK  569

Query  157  tpapaaPQGLTV  122
             P  AAPQGLT+
Sbjct  570  APTAAAPQGLTI  581



>ref|XP_002440887.1| hypothetical protein SORBIDRAFT_09g014430 [Sorghum bicolor]
 gb|EES19317.1| hypothetical protein SORBIDRAFT_09g014430 [Sorghum bicolor]
Length=577

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 216/235 (92%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLGLLVEN     LG ARKVTI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  325  DIAIVTGAEFLAKDLGLLVENATEAQLGTARKVTIHQTTTTLIADAASKDEIQARVAQLK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKL+GGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  385  KELAETDSVYDTEKLAERIAKLAGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLST VP+IK+ +ED DE+LGADI+QKALVAPASLIA NAGVEGEVVVEK
Sbjct  445  IVPGGGTAYVHLSTVVPSIKEKIEDPDERLGADIIQKALVAPASLIAHNAGVEGEVVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D  WEVGYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  505  IKDSVWEVGYNAMTDTYENLIEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  559



>gb|ACL53491.1| unknown [Zea mays]
Length=474

 Score =   352 bits (903),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQ+ DLGLLVE+T VE LGIARKVTI+  STTIIADAASKD+IQ+RIAQLK
Sbjct  226  DIAIVTGAEYQSKDLGLLVEDTTVEQLGIARKVTISSSSTTIIADAASKDDIQARIAQLK  285

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAV+KVGA+TEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  286  RELSQTDSTYDSEKLAERIAKLSGGVAVVKVGASTEAELEDRKLRIEDAKNATFAAIEEG  345

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+TL+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+V+K
Sbjct  346  IVPGGGAAYVHLSTFVPAIKETLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVDK  405

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R+ +WE GYNAM D +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  406  IRESEWEFGYNAMADKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  460



>ref|XP_002463468.1| hypothetical protein SORBIDRAFT_01g000380 [Sorghum bicolor]
 gb|EER90466.1| hypothetical protein SORBIDRAFT_01g000380 [Sorghum bicolor]
Length=580

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQ+ DLGLLVENT VE LGIARKVTI+  STTIIADAASKD+IQ+RIAQLK
Sbjct  334  DIAIVTGAEYQSKDLGLLVENTTVEQLGIARKVTISSSSTTIIADAASKDDIQARIAQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGA+TEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  RELSQTDSAYDSEKLAERIAKLSGGVAVIKVGASTEAELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+TL+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+V+K
Sbjct  454  IVPGGGAAYVHLSTFVPAIKETLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVDK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R+ +WE GYNAM D +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  514  IRESEWEFGYNAMADKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  568



>emb|CDP07072.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 213/235 (91%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE  A+DLG  VE   VE LG ARKVT+T+ ST IIADAASKDEIQ+R+AQ+K
Sbjct  337  DIAIVTGAELLAADLGQYVEKATVEQLGTARKVTVTQQSTIIIADAASKDEIQARLAQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDSIYDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  397  RELAETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAIKD L DADE+LGADIVQKALVAP SLIA NAG+EGEVVVEK
Sbjct  457  IVPGGGAALVHLSTSVPAIKDKLVDADERLGADIVQKALVAPTSLIATNAGIEGEVVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  DWE+GYNAMTD YENLV+AG+IDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  517  VKSCDWELGYNAMTDKYENLVDAGIIDPAKVTRCALQNAASVAGMVLTTQAIVVE  571



>ref|XP_008789558.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Phoenix dactylifera]
Length=579

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA DLGLL+EN  VE LG ARKVTI+++STTIIADAA+KDEIQ+RIAQLK
Sbjct  328  DIAILTGAEFQAQDLGLLIENASVEQLGTARKVTISQNSTTIIADAATKDEIQARIAQLK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  388  KELAQTDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLS  VPAIK+ LED DE+LGADIVQKAL+APA+LIA NAGVEGEVVVEK
Sbjct  448  IVPGGGAAFVHLSASVPAIKNKLEDPDERLGADIVQKALLAPAALIAHNAGVEGEVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            ++D  WEVGYNAMTD +ENLVEAGVIDPAKV RCALQN+ASVAGMVLTTQAIVVEKPKPK
Sbjct  508  IKDSKWEVGYNAMTDEFENLVEAGVIDPAKVARCALQNAASVAGMVLTTQAIVVEKPKPK  567

Query  157  tpapaaPQGLTV  122
                A PQGLT+
Sbjct  568  ARPAAQPQGLTI  579



>ref|XP_010918680.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X2 [Elaeis guineensis]
Length=583

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVEN  VE LG ARKVTI+++STTIIADAA+KDEIQ+RIAQ+K
Sbjct  331  DIAIVTGAEFQAKDLGLLVENASVEQLGTARKVTISQNSTTIIADAATKDEIQARIAQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLR+EDAKNATFAAIEEG
Sbjct  391  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRVEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPA+KD LEDADE LGADIVQKAL+APA+LIA NAGVEGEVVVEK
Sbjct  451  IVPGGGAAFVHLSTRVPAMKDKLEDADECLGADIVQKALLAPAALIAHNAGVEGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WEVGYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  511  IKDSEWEVGYNAMTDKYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  565



>ref|XP_010918679.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X1 [Elaeis guineensis]
Length=584

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+QA DLGLLVEN  VE LG ARKVTI+++STTIIADAA+KDEIQ+RIAQ+K
Sbjct  332  DIAIVTGAEFQAKDLGLLVENASVEQLGTARKVTISQNSTTIIADAATKDEIQARIAQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLR+EDAKNATFAAIEEG
Sbjct  392  KELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRVEDAKNATFAAIEEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLST VPA+KD LEDADE LGADIVQKAL+APA+LIA NAGVEGEVVVEK
Sbjct  452  IVPGGGAAFVHLSTRVPAMKDKLEDADECLGADIVQKALLAPAALIAHNAGVEGEVVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++D +WEVGYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  512  IKDSEWEVGYNAMTDKYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  566



>ref|XP_004980958.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic-like [Setaria italica]
Length=586

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 221/234 (94%), Gaps = 0/234 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQ+ DLGLLVENT VE LGIARKVTI+  STTIIADAASKD+IQ+RIAQLK
Sbjct  333  DIAIVTGAEYQSKDLGLLVENTTVEQLGIARKVTISSSSTTIIADAASKDDIQARIAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAVIKVGA+TEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  RELSQTDSTYDSEKLAERIAKLSGGVAVIKVGASTEAELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+TL+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+V+K
Sbjct  453  IVPGGGAAYVHLSTFVPAIKETLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVDK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVV  176
            +++ +WE GYNAM D +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV
Sbjct  513  IKESEWEYGYNAMADKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVV  566



>ref|NP_001148093.1| LOC100281701 [Zea mays]
 gb|ACG29701.1| ruBisCO large subunit-binding protein subunit alpha [Zea mays]
 tpg|DAA52602.1| TPA: ruBisCO large subunit-binding protein subunit alpha [Zea 
mays]
Length=584

 Score =   353 bits (905),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEYQ+ DLGLLVE+T VE LGIARKVTI+  STTIIADAASKD+IQ+RIAQLK
Sbjct  336  DIAIVTGAEYQSKDLGLLVEDTTVEQLGIARKVTISSSSTTIIADAASKDDIQARIAQLK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL +TDS YDSEKLAERIAKLSGGVAV+KVGA+TEAELEDRKLRIEDAKNATFAAIEEG
Sbjct  396  RELSQTDSTYDSEKLAERIAKLSGGVAVVKVGASTEAELEDRKLRIEDAKNATFAAIEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST+VPAIK+TL+D +E+LGADI+QKALVAPA+LIA NAGVEGEV+V+K
Sbjct  456  IVPGGGAAYVHLSTFVPAIKETLDDPEERLGADIIQKALVAPAALIAHNAGVEGEVIVDK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R+ +WE GYNAM D +ENLVEAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  516  IRESEWEFGYNAMADKHENLVEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  570



>emb|CAB51619.1| unnamed protein product [Ricinus communis]
Length=496

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKVTITKDSTT+IADAASKDE+Q+RIAQLK
Sbjct  278  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVTITKDSTTLIADAASKDELQARIAQLK  337

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  338  RELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  397

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAI    +DADE+LGADI+QKALVAPASLIAQNAG+EGEVVVEK
Sbjct  398  IVPGGGAALVHLSTVVPAINGEDKDADERLGADILQKALVAPASLIAQNAGIEGEVVVEK  457

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNS  221
            V+ R+WE+GYNAMTD YENLVEAGVIDPAKVTRCALQNS
Sbjct  458  VKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQNS  496



>ref|XP_001755211.1| predicted protein [Physcomitrella patens]
 gb|EDQ80155.1| predicted protein [Physcomitrella patens]
Length=550

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 214/235 (91%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+ A+DLG+ VENT+V+ LG ARK+T+   STT+IAD+ASKDEIQ+RIAQ+K
Sbjct  298  DIAIMTGAEFIATDLGMKVENTEVDQLGSARKITVRNTSTTMIADSASKDEIQARIAQIK  357

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  358  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  417

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  VP+IKDTLED +EK+GADIVQ+AL APA+LIA NAGVEG VVVEK
Sbjct  418  IVPGGGAALVHLSAMVPSIKDTLEDPEEKIGADIVQRALSAPANLIAHNAGVEGAVVVEK  477

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + D +W +GYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIV +
Sbjct  478  IFDSEWAMGYNAMTDKYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVCD  532



>sp|P08824.1|RUBA_RICCO RecName: Full=RuBisCO large subunit-binding protein subunit alpha; 
AltName: Full=60 kDa chaperonin subunit alpha; AltName: 
Full=CPN-60 alpha, partial [Ricinus communis]
Length=495

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKVTITKDSTT+IADAASKDE+Q+RIAQLK
Sbjct  278  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVTITKDSTTLIADAASKDELQARIAQLK  337

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  338  RELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  397

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLST VPAI    +DADE+LGADI+QKALVAPASLIAQNAG+EGEVVVEK
Sbjct  398  IVPGGGAALVHLSTVVPAINGEDKDADERLGADILQKALVAPASLIAQNAGIEGEVVVEK  457

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQN  224
            V+ R+WE+GYNAMTD YENLVEAGVIDPAKVTRCALQN
Sbjct  458  VKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQN  495



>ref|XP_002973702.1| hypothetical protein SELMODRAFT_99807, partial [Selaginella moellendorffii]
 ref|XP_002975753.1| hypothetical protein SELMODRAFT_104038, partial [Selaginella 
moellendorffii]
 gb|EFJ23382.1| hypothetical protein SELMODRAFT_104038, partial [Selaginella 
moellendorffii]
 gb|EFJ25362.1| hypothetical protein SELMODRAFT_99807, partial [Selaginella moellendorffii]
Length=546

 Score =   346 bits (887),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 0/252 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEY ASDLGL  E    E LG ARKV IT +STTIIAD ASKDEIQ+RIAQLK
Sbjct  295  DIAIITGAEYIASDLGLKPETATFEQLGTARKVKITNNSTTIIADVASKDEIQARIAQLK  354

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  355  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATEVELEDRKLRIEDAKNATFAAIEEG  414

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  V  IK +L+D +EK+GADIV+KAL++PA+LIA NAGVEG VVVEK
Sbjct  415  IVPGGGAAMVHLSASVSKIKQSLQDPEEKIGADIVEKALLSPAALIAHNAGVEGAVVVEK  474

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQA+VVEKPKPK
Sbjct  475  ILASEWEIGYNAMTDVYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAVVVEKPKPK  534

Query  157  tpapaaPQGLTV  122
            TPAPAAPQG+T+
Sbjct  535  TPAPAAPQGMTI  546



>ref|XP_001769377.1| predicted protein [Physcomitrella patens]
 gb|EDQ65746.1| predicted protein [Physcomitrella patens]
Length=595

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 214/235 (91%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TG+E+ A+DLG+ VE T+ + LG ARK+T+   STTIIAD+ASKDEIQ+RIAQ+K
Sbjct  343  DIAILTGSEFIATDLGMKVETTEFDQLGTARKITVRNGSTTIIADSASKDEIQARIAQIK  402

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  403  KELSETDSVYDTEKLSERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  462

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  VPAIK+T++D++EK+GADIVQ+AL APA+LIAQNAGVEG VVVEK
Sbjct  463  IVPGGGAALVHLSALVPAIKETIDDSEEKIGADIVQRALSAPANLIAQNAGVEGAVVVEK  522

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + D +W +GYNAMTD+YENL+EAGVIDPAKVTRC LQN+ASVAGMVLTTQAIV E
Sbjct  523  IFDSEWAMGYNAMTDTYENLLEAGVIDPAKVTRCGLQNAASVAGMVLTTQAIVCE  577



>ref|XP_008649582.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Zea mays]
Length=572

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 193/235 (82%), Positives = 213/235 (91%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLGLLVEN   E LG ARKVTI + +TT+IADAASKDEIQ+RIAQLK
Sbjct  320  DIAIVTGAEFLAKDLGLLVENATEEQLGTARKVTIHQTTTTLIADAASKDEIQARIAQLK  379

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKL+GGVAVIKVGAATE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  380  KELAETDSVYDTEKLAERIAKLAGGVAVIKVGAATETELEDRQLRIEDAKNATFAAIEEG  439

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLST VP IK+ +ED DE+L   + +KALVAPASLIA NAGVEGEVVVEK
Sbjct  440  IVPGGGAAYVHLSTVVPKIKEAIEDPDERLALILFKKALVAPASLIAHNAGVEGEVVVEK  499

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +++ DWEVGYNAMTD YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVVE
Sbjct  500  IKESDWEVGYNAMTDKYENLMEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVE  554



>gb|EMS55766.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Triticum urartu]
Length=613

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 196/270 (73%), Positives = 219/270 (81%), Gaps = 35/270 (13%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEY A DLGLLVEN  V+ LG ARK+TI + +TT+IADAASKDEIQ+R+AQLK
Sbjct  326  DIAIVTGAEYLAKDLGLLVENATVDQLGTARKITIHQTTTTLIADAASKDEIQARVAQLK  385

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDSIYDSEKLAERIAKLSGGVAVIKVGA TE ELEDR+LRIEDAKNATFAAIEEG
Sbjct  386  KELSETDSIYDSEKLAERIAKLSGGVAVIKVGATTETELEDRQLRIEDAKNATFAAIEEG  445

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQK-----------------------  407
            IVPGGGAA+VHLSTYVPAIK+T+ED DE+LGADI+QK                       
Sbjct  446  IVPGGGAAYVHLSTYVPAIKETIEDHDERLGADIIQKPKDVRGNTSTCQDYISLKCGITY  505

Query  406  ------------ALVAPASLIAQNAgvegevvvekvrdrdweVGYNAMTDSYENLVEAGV  263
                        AL APASLIA NAGVEGEVV+EK+++ +WE+GYNAMTD YENL+E+GV
Sbjct  506  LYYIDLFHGNQMALQAPASLIANNAGVEGEVVIEKIKESEWEMGYNAMTDKYENLIESGV  565

Query  262  IDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            IDPAKVTRCALQN+ASV+GMVLTTQAIVVE
Sbjct  566  IDPAKVTRCALQNAASVSGMVLTTQAIVVE  595



>sp|P34794.1|RUB2_BRANA RecName: Full=RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
alpha; AltName: Full=CPN-60 alpha; Flags: Precursor [Brassica 
napus]
 emb|CAA81736.1| chaperonin-60 alpha subunit [Brassica napus]
Length=583

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 228/252 (90%), Gaps = 2/252 (1%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T     A D+GLLVENT ++ LGIARKVTI+KDSTT+IADAASK E+Q+RI+QLK
Sbjct  334  DIAILT-EPSTALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKAELQARISQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KE FETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KESFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA  VHLST +PAIK+T EDAD +LGADIVQKALVA  SLIAQNAG+EGEVVVEK
Sbjct  453  IVPGGGATLVHLSTVIPAIKETFEDADVRLGADIVQKALVA-QSLIAQNAGIEGEVVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +   +WE+GYNAMTD+YENL+EAGVIDPAKVTRCALQN+ASVAGMVLTTQAIVV+KPKPK
Sbjct  512  IMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPKPK  571

Query  157  tpapaaPQGLTV  122
             PA AAP+GL V
Sbjct  572  APAAAAPEGLMV  583



>emb|CBI17177.3| unnamed protein product [Vitis vinifera]
Length=553

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 192/252 (76%), Positives = 205/252 (81%), Gaps = 33/252 (13%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LG+ARKVTITKDSTTIIADAASKDEIQ+RIAQ+K
Sbjct  335  DIAIMTGAEFQANDLGLLIENTSVEQLGLARKVTITKDSTTIIADAASKDEIQARIAQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAFVHLSTYVPAIKD LEDADE+LGADIVQKALVAPASLIA NAG         
Sbjct  455  IVPGGGAAFVHLSTYVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAG---------  505

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
                                VE  V+    V RCALQN+ASVAGMVLTTQAIVVEK KPK
Sbjct  506  --------------------VEGEVV----VARCALQNAASVAGMVLTTQAIVVEKAKPK  541

Query  157  tpapaaPQGLTV  122
             P  A PQGLT+
Sbjct  542  APVAAPPQGLTI  553



>gb|AFW77798.1| chloroplast protein synthesis2 [Zea mays]
Length=593

 Score =   328 bits (840),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 192/256 (75%), Positives = 213/256 (83%), Gaps = 21/256 (8%)
 Frame = -2

Query  877  DIAIVT------------GAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAAS  734
            DIAIVT            GAE+ A DLGLLVEN   E LG ARKVTI + +TT+IADAAS
Sbjct  320  DIAIVTVSFCLYRVSSLSGAEFLAKDLGLLVENATEEQLGTARKVTIHQTTTTLIADAAS  379

Query  733  KDEIQSRIAQLKKELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIED  554
            KDEIQ+RIAQLKKEL ETDS+YD+EKLAERIAKL+GGVAVIKVGAATE ELEDR+LRIED
Sbjct  380  KDEIQARIAQLKKELAETDSVYDTEKLAERIAKLAGGVAVIKVGAATETELEDRQLRIED  439

Query  553  AKNATFAAIEEGIVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQ---------KAL  401
            AKNATFAAIEEGIVPGGGAA+VHLST VP IK+ +ED DE+L   + +         +AL
Sbjct  440  AKNATFAAIEEGIVPGGGAAYVHLSTVVPKIKEAIEDPDERLALILFKIRWYELYLPEAL  499

Query  400  VAPASLIAQNAgvegevvvekvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNS  221
            VAPASLIA NAGVEGEVVVEK+++ DWEVGYNAMTD YENL+EAGVIDPAKVTRCALQN+
Sbjct  500  VAPASLIAHNAGVEGEVVVEKIKESDWEVGYNAMTDKYENLMEAGVIDPAKVTRCALQNA  559

Query  220  ASVAGMVLTTQAIVVE  173
            ASVAGMVLTTQAIVVE
Sbjct  560  ASVAGMVLTTQAIVVE  575



>ref|XP_001703692.1| chaperonin 60A [Chlamydomonas reinhardtii]
 gb|EDO96383.1| chaperonin 60A [Chlamydomonas reinhardtii]
Length=580

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLG+ VE   VE LG+ARKVT+  ++TT+IADAASKDEI+ RIAQLK
Sbjct  324  DIAIVTGAEFIAKDLGMKVEQAVVEQLGVARKVTVANNTTTLIADAASKDEIEMRIAQLK  383

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAA+EEG
Sbjct  384  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAVEEG  443

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA +HLS  VPA K+TL DA+EKLGADIV K+L AP  LIA NAGVEGEV+V++
Sbjct  444  IVPGGGAALLHLSELVPAFKETLTDAEEKLGADIVMKSLRAPCRLIADNAGVEGEVIVQR  503

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +  + +EVGYNAM D  ENL++AGVIDPAKVTR  L NS S+AG++LTTQA++VE
Sbjct  504  LLGKPFEVGYNAMIDKVENLLDAGVIDPAKVTRNGLLNSVSIAGIMLTTQAVMVE  558



>sp|Q42694.1|RUBA_CHLRE RecName: Full=RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic; AltName: Full=60 kDa chaperonin subunit 
alpha; AltName: Full=CPN-60 alpha; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA98642.1| chaperonin alpha-like subunit [Chlamydomonas reinhardtii]
Length=580

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLG+ VE   VE LG+ARKVT+  ++TT+IADAASKDEI+ RIAQLK
Sbjct  324  DIAIVTGAEFIAKDLGMKVEQAVVEQLGVARKVTVANNTTTLIADAASKDEIEMRIAQLK  383

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAA+EEG
Sbjct  384  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAVEEG  443

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA +HLS  VPA K+TL DA+EKLGADIV K+L AP  LIA NAGVEGEV+V++
Sbjct  444  IVPGGGAALLHLSELVPAFKETLTDAEEKLGADIVMKSLRAPCRLIADNAGVEGEVIVQR  503

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +  + +EVGYNAM D  ENL++AGVIDPAKVTR  L NS S+AG++LTTQA++VE
Sbjct  504  LLGKPFEVGYNAMIDKVENLLDAGVIDPAKVTRNGLLNSVSIAGIMLTTQAVMVE  558



>ref|XP_002951916.1| hypothetical protein VOLCADRAFT_105311 [Volvox carteri f. nagariensis]
 gb|EFJ47021.1| hypothetical protein VOLCADRAFT_105311 [Volvox carteri f. nagariensis]
Length=536

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLG+ VE   VE LG+ARK+TI+ +STT+IADAAS++EI+ RIAQLK
Sbjct  280  DIAIVTGAEFIAKDLGMKVEQAVVEQLGVARKITISNNSTTMIADAASREEIEMRIAQLK  339

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAA+EEG
Sbjct  340  KELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAVEEG  399

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA +HLS  VPA K+TL D +E+LGADIV K+L AP  LIA NAGVEGEV+V++
Sbjct  400  IVPGGGAALLHLSELVPAFKETLTDPEERLGADIVMKSLRAPCRLIADNAGVEGEVIVQR  459

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +  + +EVGYNAM D  ENL++AGVIDPAKVTR  L NS S+AG++LTTQA++VE
Sbjct  460  LLGKPFEVGYNAMIDKIENLLDAGVIDPAKVTRNGLLNSVSIAGIMLTTQAVMVE  514



>gb|ABR25547.1| rubisco large subunit-binding protein subunit alpha [Oryza sativa 
Indica Group]
Length=206

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  736  SKDEIQSRIAQLKKELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIE  557
            SKDEIQ+R+AQLKKEL ETDSIYD+EKLAERIAKLSGGVAVIKVGAATE ELEDR+LRIE
Sbjct  1    SKDEIQARVAQLKKELSETDSIYDTEKLAERIAKLSGGVAVIKVGAATETELEDRQLRIE  60

Query  556  DAKNATFAAIEEGIVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIA  377
            DAKNATFAAIEEGIVPGGG A+VHLST VPAIK+T+ED DE+LGADI+QKALVAPASLIA
Sbjct  61   DAKNATFAAIEEGIVPGGGTAYVHLSTTVPAIKETIEDHDERLGADIIQKALVAPASLIA  120

Query  376  QNAgvegevvvekvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVL  197
             NAGVEGEVVVEK++D +WEVGYNAM D YENL+EAGVIDPAKVTRCALQN+ASVAGMVL
Sbjct  121  HNAGVEGEVVVEKIKDGEWEVGYNAMNDKYENLIEAGVIDPAKVTRCALQNAASVAGMVL  180

Query  196  TTQAIVVE  173
            TTQAIVVE
Sbjct  181  TTQAIVVE  188



>ref|XP_001774009.1| predicted protein [Physcomitrella patens]
 gb|EDQ61199.1| predicted protein [Physcomitrella patens]
Length=583

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 203/235 (86%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG+ VE+  V  LG+ARKVTI+   T II+D A+K+EIQ+R+AQLK
Sbjct  330  DIAILTGADFLASDLGMSVEDASVYQLGVARKVTISDKKTIIISDNATKEEIQARVAQLK  389

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KE+ ET S  +++ L++RIAKLSGGVAVIKVG ATE EL DRKLRIEDAKNATFAAI EG
Sbjct  390  KEMAETSSSREAQLLSQRIAKLSGGVAVIKVGGATEIELVDRKLRIEDAKNATFAAIAEG  449

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS++VP+IK + +D +E LGADIVQKAL+APASLIA NAGVEG+VVVEK
Sbjct  450  IVPGGGAALVHLSSFVPSIKISFQDPEEMLGADIVQKALLAPASLIASNAGVEGDVVVEK  509

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + D +W  GYNAM+D YENL+E+GVIDPAKVTRCALQN+ASVAGMVL+TQA+V +
Sbjct  510  ILDLEWAFGYNAMSDKYENLLESGVIDPAKVTRCALQNAASVAGMVLSTQAVVFD  564



>ref|XP_005644409.1| chaperonin 60A [Coccomyxa subellipsoidea C-169]
 gb|EIE19865.1| chaperonin 60A [Coccomyxa subellipsoidea C-169]
Length=592

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAEY A DLG+ VE T +E+LG ARK+TI  +  TI+ADAA+++EI  RIAQ+K
Sbjct  328  DIAIVTGAEYVAKDLGMKVETTGIESLGTARKITIGNNWCTIVADAANREEIALRIAQIK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKL+GGVAVIKVGAATE ELEDR+LRIEDAKNATFAA+EEG
Sbjct  388  KELSETDSVYDTEKLSERIAKLAGGVAVIKVGAATEVELEDRQLRIEDAKNATFAAVEEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA +HLS ++P  +DTL D +EKLG DIV KAL AP  LIA NAGVEG+V++EK
Sbjct  448  IVPGGGAALLHLSEFLPKFRDTLTDGEEKLGCDIVGKALRAPVRLIASNAGVEGDVIIEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +  + +E+GYNAM D  E+L+ AGV+DPAKVTR  LQN+  +AG++LTTQAI+VE
Sbjct  508  LLGQPFEIGYNAMEDRIEDLMVAGVLDPAKVTRSGLQNACGIAGIMLTTQAIMVE  562



>ref|XP_005843628.1| hypothetical protein CHLNCDRAFT_59237 [Chlorella variabilis]
 gb|EFN51526.1| hypothetical protein CHLNCDRAFT_59237 [Chlorella variabilis]
Length=539

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 201/236 (85%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLG+ VE+T +E LG+ARK+TI   STT+IAD A+KDEI++RIAQ+K
Sbjct  282  DIAIVTGAEFVAKDLGMKVESTTLEQLGVARKLTIANSSTTLIADQANKDEIKARIAQIK  341

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKL+ERIAKL+GGVAVIKVGAATEAELEDRKLRIEDAKNATFAA+EEG
Sbjct  342  KELAETDSVYDTEKLSERIAKLAGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAVEEG  401

Query  517  IVPGGGAAFVHLSTYVPAIK-DTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGAA +HLS  VPA K + L D +E +GADIV KAL AP   IA+NAGVEGEV+V+
Sbjct  402  IVPGGGAALLHLSELVPAFKEEQLSDPEEAIGADIVMKALRAPCRAIAENAGVEGEVIVQ  461

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++  + +E+GYNAM D  ENL++AGV+DPAKVTR  L N+ S+AG++LTTQA++ E
Sbjct  462  RLLGQPFEIGYNAMYDRIENLIDAGVLDPAKVTRSGLINACSIAGIMLTTQAVMTE  517



>ref|XP_007510926.1| chaperonin GroEL [Bathycoccus prasinos]
 emb|CCO66486.1| chaperonin GroEL [Bathycoccus prasinos]
Length=583

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTG++Y A DLGL V    +++LG ARKVT    +TT IAD+AS+D+I  R+AQLK
Sbjct  323  DIAIVTGSQYLAKDLGLSVATATIDSLGFARKVTQAATTTTFIADSASRDDIDLRVAQLK  382

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YD++KL+ERIAKL+GGVAVIKVGAATEAELED+KLRIEDAKNATFAA+EEG
Sbjct  383  QELSETDSVYDTQKLSERIAKLAGGVAVIKVGAATEAELEDKKLRIEDAKNATFAAVEEG  442

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  +   K+TL D +EKLG +IVQKALVAP   I  NAGVEG+V+V +
Sbjct  443  IVPGGGAALVHLSVMIEEFKETLTDPEEKLGCEIVQKALVAPCRWIGNNAGVEGDVIVSR  502

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V    WE+GYNAM+  Y NL+E GVIDP KVTR  +QNS S+AGMVLTTQA++ E
Sbjct  503  VAQEPWEIGYNAMSGEYANLIETGVIDPKKVTRSGIQNSCSIAGMVLTTQAVITE  557



>ref|XP_009593108.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=583

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E    + LGIARK+TIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  332  DIALLTGADFLSGDLGLNLEGATSDQLGIARKITITSNSTTIVADPSTKAEIQARIMQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y SEKL++RIAKLSGGVA++KVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  392  KDLAETDSKYLSEKLSQRIAKLSGGVAILKVGAHTETELEDRKLRIEDAKSATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA F+HLS +VP IK++ +D DE++GADI+  AL+APA LIA NAGV+G++VVE+
Sbjct  452  IVPGGGATFIHLSEHVPFIKESFQDPDEQIGADIIGMALLAPAKLIAANAGVDGDIVVEE  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  DW++GYNAMT  YE+L+ +GVIDP +V+RCALQN+ SVAG+VLTTQAI+VE
Sbjct  512  VRGCDWQMGYNAMTGRYEDLLASGVIDPCRVSRCALQNAVSVAGIVLTTQAIMVE  566



>ref|XP_002534347.1| rubisco subunit binding-protein alpha subunit, ruba, putative 
[Ricinus communis]
 gb|EEF28034.1| rubisco subunit binding-protein alpha subunit, ruba, putative, 
partial [Ricinus communis]
Length=501

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLGLLVENT VE LGIARKVTITKDSTT+IADAASKDE+Q+RIAQLK
Sbjct  335  DIAILTGAEFQASDLGLLVENTSVEQLGIARKVTITKDSTTLIADAASKDELQARIAQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  RELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIA  377
            IVPGGGAA VHLST VPAIK+ ++DADE+LGADIVQKALVAPASLIA
Sbjct  455  IVPGGGAALVHLSTVVPAIKEKIKDADERLGADIVQKALVAPASLIA  501



>ref|XP_009773217.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Nicotiana 
sylvestris]
Length=583

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLGL +E    + LG+ARK+TIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  332  DIALLTGADFLAGDLGLNLEGATSDQLGVARKITITSNSTTIVADPSTKAEIQARIMQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y SEKL++RIAKLSGGVA++KVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  392  KDLAETDSKYLSEKLSQRIAKLSGGVAILKVGAHTETELEDRKLRIEDAKSATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA F+HLS +VP IK+  +D DE++GADI+  AL+APA LIA NAGV+G++VVE+
Sbjct  452  IVPGGGATFIHLSEHVPFIKELFQDPDEQIGADIIGMALLAPAKLIAANAGVDGDIVVEE  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  DW++GYNAMT  YE+L+ +GVIDP +V+RCALQN+ SVAG+VLTTQAI+VE
Sbjct  512  VRGCDWQIGYNAMTGRYEDLLASGVIDPCRVSRCALQNAVSVAGIVLTTQAIMVE  566



>ref|XP_002499889.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61147.1| predicted protein [Micromonas sp. RCC299]
Length=588

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 196/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTG+ + A DLG+   +  +E LG ARKVTI+  +TT+IAD+AS++EI  R+AQLK
Sbjct  327  DIAIVTGSTFLAKDLGMGAASATMETLGYARKVTISNGTTTLIADSASREEIDIRVAQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL E+DSIYD++KL+ERIAKL+GGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  387  KELAESDSIYDTQKLSERIAKLAGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS      K+TL D +EKLGA+IVQKALVAP  LIA NAG+EG+V+VEK
Sbjct  447  IVPGGGAALVHLSLMCDEFKETLTDPEEKLGAEIVQKALVAPCRLIANNAGIEGDVIVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V + +WE+GYNAMT  + +++EAGVIDP KVTR  L NS S+AGMVLTTQA++ +
Sbjct  507  VLNSEWEMGYNAMTGEFVDMMEAGVIDPKKVTRSGLMNSCSIAGMVLTTQAVITD  561



>ref|XP_007214015.1| hypothetical protein PRUPE_ppa005218mg [Prunus persica]
 gb|EMJ15214.1| hypothetical protein PRUPE_ppa005218mg [Prunus persica]
Length=472

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 205/251 (82%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LG+AR+VTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  220  DIALMTGADFLSGDFGLTLESATSDQLGVARRVTITSNSTTIVADPSTKAEIQARILQIK  279

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++ Y S KL+ERIAKL GGVA+IKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  280  KDLAETENAYLSRKLSERIAKLCGGVAIIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  339

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P IK+++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  340  VVPGGGATYVHLSEFIPVIKNSMEDTDEQIGADLVAKALLAPAKSIATNAGDDGEVVVEK  399

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAM  SYE+L +AGVIDP +V+RCALQ + S+AG+VLTTQA++VEK + K
Sbjct  400  TKSCDWRVGYNAMNGSYEDLPDAGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTRKK  459

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  460  KPAVPFVPGIT  470



>ref|XP_010260611.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X2 [Nelumbo nucifera]
Length=582

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLGL +E    + LGIA KVTIT +STTI+AD  +K EIQ+RIAQ+K
Sbjct  331  DIALLTGADFLAGDLGLTLEGATSDQLGIALKVTITSNSTTIVADPTTKAEIQARIAQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLS GVAVIKVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  391  KDLAETDSTYQSRKLSERIAKLSSGVAVIKVGAHTETELEDRKLRIEDAKHATFAAMDEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA +VHLS  +P IKD +ED +E++GADI+ KAL+ PA  IA NAGVEG VV+EK
Sbjct  451  IAPGGGATYVHLSKQIPIIKDLMEDPEEQIGADIIGKALLVPAFAIANNAGVEGSVVIEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++   W +GYNAMTD YE+L++AGV+DP +V RCALQN+ASVAG+VL TQA++VE
Sbjct  511  LQSCGWRIGYNAMTDKYEDLIDAGVVDPCRVHRCALQNAASVAGVVLLTQAVLVE  565



>ref|XP_010260610.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
isoform X1 [Nelumbo nucifera]
Length=583

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLGL +E    + LGIA KVTIT +STTI+AD  +K EIQ+RIAQ+K
Sbjct  332  DIALLTGADFLAGDLGLTLEGATSDQLGIALKVTITSNSTTIVADPTTKAEIQARIAQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLS GVAVIKVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  392  KDLAETDSTYQSRKLSERIAKLSSGVAVIKVGAHTETELEDRKLRIEDAKHATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA +VHLS  +P IKD +ED +E++GADI+ KAL+ PA  IA NAGVEG VV+EK
Sbjct  452  IAPGGGATYVHLSKQIPIIKDLMEDPEEQIGADIIGKALLVPAFAIANNAGVEGSVVIEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++   W +GYNAMTD YE+L++AGV+DP +V RCALQN+ASVAG+VL TQA++VE
Sbjct  512  LQSCGWRIGYNAMTDKYEDLIDAGVVDPCRVHRCALQNAASVAGVVLLTQAVLVE  566



>ref|XP_011096811.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Sesamum 
indicum]
Length=587

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E    + LGIAR VTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  335  DIALMTGADFLSGDLGLTLETATSDQLGIARHVTITSNSTTIVADPSTKAEIQARIMQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y +EKL+ERIAKL GGVAVIKVGA TE ELEDRKLR+ED+KNATFAA+ EG
Sbjct  395  KDLAETDSKYLAEKLSERIAKLCGGVAVIKVGAHTEIELEDRKLRLEDSKNATFAAMAEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA ++HLS  +PA+K+  +D DE++GADIV  AL+APA LIA NAG++G VVVEK
Sbjct  455  VVPGGGATYIHLSKQIPALKNVFQDPDERIGADIVGMALLAPAKLIAANAGIDGAVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++  D  VGYNAM   YE+L+ AGVIDP +VTRCALQN+ SVAGM+LTTQAI+ E
Sbjct  515  IKACDSRVGYNAMNGRYEDLMAAGVIDPCRVTRCALQNAVSVAGMILTTQAILAE  569



>ref|XP_008225833.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Prunus mume]
Length=586

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 205/251 (82%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LG+AR+VTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  334  DIALMTGADFLSGDFGLTLESATSDQLGVARRVTITSNSTTIVADPSTKAEIQARILQIK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++ Y S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  394  KDLAETENAYLSRKLSERIAKLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P IK+++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  454  VVPGGGATYVHLSEFIPVIKNSMEDTDERIGADLVAKALLAPAKSIATNAGDDGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAM  SYE+L +AGVIDP +V+RCALQ + S+AG+VLTTQA++VEK + K
Sbjct  514  TKSCDWRVGYNAMNGSYEDLPDAGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTRKK  573

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  574  KPAVPFVPGIT  584



>ref|XP_008225834.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X2 [Prunus mume]
Length=584

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 205/251 (82%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LG+AR+VTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  332  DIALMTGADFLSGDFGLTLESATSDQLGVARRVTITSNSTTIVADPSTKAEIQARILQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++ Y S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  392  KDLAETENAYLSRKLSERIAKLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P IK+++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  452  VVPGGGATYVHLSEFIPVIKNSMEDTDERIGADLVAKALLAPAKSIATNAGDDGEVVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAM  SYE+L +AGVIDP +V+RCALQ + S+AG+VLTTQA++VEK + K
Sbjct  512  TKSCDWRVGYNAMNGSYEDLPDAGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTRKK  571

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  572  KPAVPFVPGIT  582



>ref|XP_006365041.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=583

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E    + LGIARK+TIT +STTI+A  ++K EIQ+RI Q+K
Sbjct  332  DIAMLTGADFLSGDLGLTLEGATSDQLGIARKITITSNSTTIVAHPSTKAEIQARIMQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   SEKL++RIAKLSGGVA++KVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  392  KDLAETDNKSISEKLSQRIAKLSGGVAILKVGAHTETELEDRKLRIEDAKNATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA F+HLS  VP IK++ +D DE++GADI+  AL+APA LIA NAGV+G+ VVEK
Sbjct  452  IVPGGGATFIHLSEQVPLIKESFQDPDEQIGADIIGTALLAPAKLIAANAGVDGDTVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  DW++GYNAMT  YE+L+ +G+IDP +V+RCALQN+ SVAG+VLTTQAI+VE
Sbjct  512  VRGCDWKMGYNAMTGKYEDLLASGIIDPCRVSRCALQNAVSVAGIVLTTQAIMVE  566



>ref|XP_001420863.1| chaperonin 60 alpha chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO99156.1| chaperonin 60 alpha chain, chloroplast [Ostreococcus lucimarinus 
CCE9901]
Length=551

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGA+Y A DLGL V    ++ LG ARKV+I + +TT+IAD ASK++I  R+AQLK
Sbjct  295  DIAIVTGAQYIAKDLGLSVARANMDCLGYARKVSIAQTTTTMIADGASKEDIDLRVAQLK  354

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YD++KL+ERIAKL+GGVAVIKVGAATE ELE+RKLRIEDAKNATFAA+EEG
Sbjct  355  QELAETDSVYDTQKLSERIAKLAGGVAVIKVGAATETELEERKLRIEDAKNATFAAVEEG  414

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  +   K TL +A+E+LGA+IVQKAL+AP  LI  NAG EG+V+V+ 
Sbjct  415  IVPGGGAALVHLSKMIDEFKPTLTNAEERLGAEIVQKALLAPCRLIGNNAGAEGDVIVQH  474

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V D ++  GY+AMT  Y +L++ GV+DP KVTR  +QNS S+AGMVLTTQA++ E
Sbjct  475  VMDGEFNFGYDAMTGEYGDLIDKGVLDPKKVTRSGVQNSCSIAGMVLTTQAVITE  529



>ref|XP_006409816.1| hypothetical protein EUTSA_v10016532mg [Eutrema salsugineum]
 gb|ESQ51269.1| hypothetical protein EUTSA_v10016532mg [Eutrema salsugineum]
Length=511

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT +E LGIARKVTI+KDSTT+IADAASKDE+Q+RI+QLK
Sbjct  334  DIAILTGAEYQALDMGLLVENTTIEQLGIARKVTISKDSTTLIADAASKDELQARISQLK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  394  KELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASL  383
            IVPGGGA  VHLST +PAIK+  EDADE+LGADIVQKALVAPA+L
Sbjct  454  IVPGGGATLVHLSTVIPAIKEKFEDADERLGADIVQKALVAPAAL  498



>ref|XP_007041088.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
 gb|EOX96919.1| TCP-1/cpn60 chaperonin family protein isoform 2 [Theobroma cacao]
Length=458

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 198/233 (85%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +     + LG+ARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  207  DIALMTGADFLSGDLGLTLAGATSDQLGVARKVTITSNSTTIVADPSTKAEIQARIMQIK  266

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  267  KDLAETDSAYMSRKLSERIAKLSGGVAIIKVGAHTEMELEDRKLRIEDAKNATFAAMDEG  326

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAG++G+VVVEK
Sbjct  327  IVPGGGATYIHLSEQIHMIKNSMEDSDERIGADIVAKALLAPSKVIATNAGIDGDVVVEK  386

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R RDW++GYNAM+  YE+L+ AGV+DP +V+R ALQN+ SVAG+VLTTQAI+
Sbjct  387  TRTRDWQIGYNAMSGRYEDLITAGVVDPCRVSRFALQNAVSVAGIVLTTQAIM  439



>ref|XP_004145436.2| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Cucumis 
sativus]
 gb|KGN66865.1| hypothetical protein Csa_1G701900 [Cucumis sativus]
Length=606

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E    + LGIARKV IT +STTI+AD ++KDEIQ+RI+Q+K
Sbjct  355  DIALMTGADFLSGDLGLGLEGATSDQLGIARKVVITSNSTTIVADPSTKDEIQARISQIK  414

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNA FAA+ EG
Sbjct  415  KDLVETDNPNLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNAVFAAMNEG  474

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P IK ++ED DE +GADIV KAL+APA LIA NAG +G VVVEK
Sbjct  475  IVPGGGATYVHLYELLPTIKQSMEDQDELIGADIVGKALLAPAKLIASNAGDDGVVVVEK  534

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMTD YE+L  AGV+DP  V+RCALQ +ASV G+VLTTQA++VE
Sbjct  535  TRACDWRHGYNAMTDKYEDLFNAGVVDPCLVSRCALQIAASVTGIVLTTQAVMVE  589



>ref|XP_006374694.1| hypothetical protein POPTR_0015s15270g [Populus trichocarpa]
 gb|ERP52491.1| hypothetical protein POPTR_0015s15270g [Populus trichocarpa]
Length=477

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 196/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL + +   + LGIARKVTIT +STTI+AD+A+K EIQ+RI Q+K
Sbjct  226  DIALMTGADFLSGDFGLTLGSVTSDQLGIARKVTITSNSTTIVADSATKAEIQARILQIK  285

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  286  KDLAETDNAALSRKLSERIAKLSGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  345

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHLS  + +IK++++D +EK+GADIV KAL+APA  IA NAGV+G VVV+ 
Sbjct  346  IVPGGGATYVHLSEQISSIKNSMKDENEKIGADIVAKALLAPAKTIATNAGVDGAVVVDN  405

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW  GYNAMT  YE+L+ AGV+DP +V+RCALQ++ S+AG+VLTTQA++VE
Sbjct  406  IRSCDWRTGYNAMTGRYEDLLNAGVVDPCRVSRCALQSAVSIAGIVLTTQAVLVE  460



>ref|XP_010109832.1| Chaperonin 60 subunit alpha 2 [Morus notabilis]
 gb|EXC24775.1| Chaperonin 60 subunit alpha 2 [Morus notabilis]
Length=582

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 196/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E    + LGIARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  331  DIALMTGADFLSGDFGLTLEGATSDQLGIARKVTITGNSTTIVADPSTKAEIQARILQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S KL+ERIAKL GGVAVIKVGA TE ELEDRKL+IEDAKNATFAA++EG
Sbjct  391  KDLAETDNAYLSRKLSERIAKLCGGVAVIKVGAHTETELEDRKLKIEDAKNATFAAMDEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS  VP+IK + +D DE++GADIV KAL+APA  IA NAGV+GEVVVEK
Sbjct  451  VVPGGGATYVHLSELVPSIKTSFDDLDEQIGADIVAKALLAPAKSIATNAGVDGEVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW +GYNAMT  YE+L  AGV+DP +V+RCAL+N+ S+AG+VLTTQA++VE
Sbjct  511  IRTSDWRMGYNAMTGRYEDLPNAGVLDPCRVSRCALENAVSIAGLVLTTQAVLVE  565



>ref|XP_006374686.1| hypothetical protein POPTR_0015s151902g, partial [Populus trichocarpa]
 gb|ERP52483.1| hypothetical protein POPTR_0015s151902g, partial [Populus trichocarpa]
Length=262

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 191/230 (83%), Gaps = 0/230 (0%)
 Frame = -2

Query  862  TGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLKKELFE  683
            +GA++ + D GL + +   + LGIARKVTIT +STTI+AD+A+K EIQ+RI Q+KK+L E
Sbjct  16   SGADFLSGDFGLTLGSVTSDQLGIARKVTITSNSTTIVADSATKAEIQARILQIKKDLAE  75

Query  682  TDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEGIVPGG  503
            TD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EGIVPGG
Sbjct  76   TDNAALSRKLSERIAKLSGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEGIVPGG  135

Query  502  GAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvekvrdrd  323
            GA +VHLS  + +IK++++D +EK+GADIV KAL+APA  IA NAGV+G VVVE +R  D
Sbjct  136  GATYVHLSEQISSIKNSMKDENEKIGADIVAKALLAPAKTIATNAGVDGAVVVENIRSCD  195

Query  322  weVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            W  GYNAMT  YE+L+ AGV+DP +V+RCALQ++ S+AG+VLTTQA++VE
Sbjct  196  WRTGYNAMTGRYEDLLNAGVVDPCRVSRCALQSAVSIAGIVLTTQAVLVE  245



>ref|XP_002991301.1| hypothetical protein SELMODRAFT_133357 [Selaginella moellendorffii]
 gb|EFJ07599.1| hypothetical protein SELMODRAFT_133357 [Selaginella moellendorffii]
Length=594

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI TGAE+ A +LGL +E+  ++ LG+A+KVTI + ST I+AD A+K EI++R+A++K
Sbjct  341  DIAIFTGAEFLAGELGLQLEDLTIDQLGVAKKVTIKEKSTVILADDATKGEIKARVAEIK  400

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  +DS Y SEKLAERIAKLSGGVAVIKVGAATEAE EDRKLR+EDAKN+TFAA++EG
Sbjct  401  KDLELSDSAYHSEKLAERIAKLSGGVAVIKVGAATEAEAEDRKLRLEDAKNSTFAAVKEG  460

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  VP IK++L D  EKLGADIVQKAL+APA+LIA NAGVEG++VV K
Sbjct  461  IVPGGGAAMVHLSAAVPGIKESLSDPQEKLGADIVQKALLAPAALIASNAGVEGQMVVSK  520

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +WE GYNAMTD +ENLV  GV+DPAKVTRCALQN+ASVAGMVLTT+AI V+
Sbjct  521  ILESEWEFGYNAMTDKFENLVLGGVVDPAKVTRCALQNAASVAGMVLTTEAIAVD  575



>ref|XP_010317036.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=545

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 199/235 (85%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E+   + LGIARK+TIT +STTI+A  ++K EIQ+RI Q+K
Sbjct  294  DIAMLTGADFLSGDLGLTLESATSDQLGIARKITITSNSTTIVAHPSTKAEIQARIMQIK  353

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   SEKL++RIAKLSGGVA++KVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  354  KDLAETDNKSISEKLSQRIAKLSGGVAILKVGAHTETELEDRKLRIEDAKSATFAAMDEG  413

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA F+HLS  +P IK++ +D DE++GADI+  AL+APA LIA NAGV+G+ VVEK
Sbjct  414  IVPGGGATFIHLSEQIPLIKESFQDPDEQIGADIIGTALLAPAKLIAANAGVDGDTVVEK  473

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  DW++GYNAMT  YE+L+ +G+IDP +V+RCALQN+ SVAG+VLTTQAI+VE
Sbjct  474  VRGCDWKMGYNAMTGRYEDLLASGIIDPCRVSRCALQNAVSVAGIVLTTQAIMVE  528



>emb|CEF99984.1| Chaperonin Cpn60 [Ostreococcus tauri]
Length=582

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGA+Y A DLGL V+   +++LG ARKV+I + +TT+IAD ASK++I  R+AQLK
Sbjct  324  DIAIVTGAQYIAKDLGLSVQRATMDSLGYARKVSIAQTTTTLIADGASKEDIDMRVAQLK  383

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YD+EKL+ERIAKL+GGVAVIKVGAATE E+E+RKLRIEDAKNATFAA+EEG
Sbjct  384  QELAETDSVYDTEKLSERIAKLAGGVAVIKVGAATETEMEERKLRIEDAKNATFAAVEEG  443

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  +     TL  A+E+LGA+IVQKAL+AP  LI  NAGVEG+V+V+ 
Sbjct  444  IVPGGGAALVHLSKMIDEFIPTLTSAEERLGAEIVQKALLAPCRLIGNNAGVEGDVIVQH  503

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V + D+  GY+AM   Y +L+E GVIDP KVTR  +QNS S+AGMVLTTQA++ E
Sbjct  504  VMEGDFNYGYDAMVGEYGDLIEKGVIDPKKVTRSGVQNSCSIAGMVLTTQAVITE  558



>ref|XP_003082449.1| RuBisCO subunit binding-protein alpha subunit, chloroplast [Prec 
(IC) [Ostreococcus tauri]
Length=575

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGA+Y A DLGL V+   +++LG ARKV+I + +TT+IAD ASK++I  R+AQLK
Sbjct  317  DIAIVTGAQYIAKDLGLSVQRATMDSLGYARKVSIAQTTTTLIADGASKEDIDMRVAQLK  376

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS+YD+EKL+ERIAKL+GGVAVIKVGAATE E+E+RKLRIEDAKNATFAA+EEG
Sbjct  377  QELAETDSVYDTEKLSERIAKLAGGVAVIKVGAATETEMEERKLRIEDAKNATFAAVEEG  436

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  +     TL  A+E+LGA+IVQKAL+AP  LI  NAGVEG+V+V+ 
Sbjct  437  IVPGGGAALVHLSKMIDEFIPTLTSAEERLGAEIVQKALLAPCRLIGNNAGVEGDVIVQH  496

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V + D+  GY+AM   Y +L+E GVIDP KVTR  +QNS S+AGMVLTTQA++ E
Sbjct  497  VMEGDFNYGYDAMVGEYGDLIEKGVIDPKKVTRSGVQNSCSIAGMVLTTQAVITE  551



>ref|XP_004233243.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=583

 Score =   288 bits (736),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 199/235 (85%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E+   + LGIARK+TIT +STTI+A  ++K EIQ+RI Q+K
Sbjct  332  DIAMLTGADFLSGDLGLTLESATSDQLGIARKITITSNSTTIVAHPSTKAEIQARIMQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   SEKL++RIAKLSGGVA++KVGA TE ELEDRKLRIEDAK+ATFAA++EG
Sbjct  392  KDLAETDNKSISEKLSQRIAKLSGGVAILKVGAHTETELEDRKLRIEDAKSATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA F+HLS  +P IK++ +D DE++GADI+  AL+APA LIA NAGV+G+ VVEK
Sbjct  452  IVPGGGATFIHLSEQIPLIKESFQDPDEQIGADIIGTALLAPAKLIAANAGVDGDTVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  DW++GYNAMT  YE+L+ +G+IDP +V+RCALQN+ SVAG+VLTTQAI+VE
Sbjct  512  VRGCDWKMGYNAMTGRYEDLLASGIIDPCRVSRCALQNAVSVAGIVLTTQAIMVE  566



>emb|CDP11251.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DI+++TGA++ + DLGL +E    + LGIARKV+IT +STTI+AD ++K EIQ+RI ++K
Sbjct  342  DISLMTGADFLSGDLGLTLEGATSDQLGIARKVSITSNSTTIVADPSTKAEIQARIMEIK  401

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K L ETDS Y S+KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  402  KNLAETDSKYLSQKLSERIAKLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMDEG  461

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAAF+HLS  VP IK+  ++ DE+LGA+I+Q AL+APA+ IA NAGV+G VVVEK
Sbjct  462  IVPGGGAAFIHLSKEVPIIKEQFQEPDEQLGAEIIQMALLAPANYIAANAGVDGAVVVEK  521

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW++GYNA+T  YE+L+ AGV+DP K++R ALQN+ SVAG+VL+TQAI+VE
Sbjct  522  IRACDWQIGYNALTGQYEDLLRAGVVDPCKISRYALQNAVSVAGLVLSTQAILVE  576



>ref|XP_002528171.1| rubisco subunit binding-protein alpha subunit, ruba, putative 
[Ricinus communis]
 gb|EEF34222.1| rubisco subunit binding-protein alpha subunit, ruba, putative 
[Ricinus communis]
Length=556

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 199/235 (85%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +     + LGIA+KVTIT +STTI+AD+++K EIQ+RI Q+K
Sbjct  305  DIALMTGADFLSGDFGLTLMGATSDQLGIAQKVTITSNSTTIVADSSTKAEIQARILQMK  364

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNAT+AA++EG
Sbjct  365  KDLAETDNKYLSRKLSERIAKLSGGVALIKVGAHTETELEDRKLRIEDAKNATYAAMDEG  424

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA+VHLS  +  I+D++ED +E++GADIV KAL+ PA  IA NAGV+G VVVEK
Sbjct  425  IVPGGGAAYVHLSEQISTIQDSMEDENEQIGADIVAKALLVPAKTIATNAGVDGAVVVEK  484

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW +G+NAMT  YE+L++AGV+DP +V+RCALQ++AS+AG+VLTTQAI+VE
Sbjct  485  IRSSDWRIGFNAMTGEYEDLLDAGVVDPCRVSRCALQSAASIAGLVLTTQAILVE  539



>gb|ERN19685.1| hypothetical protein AMTR_s00062p00185880 [Amborella trichopoda]
Length=573

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLG+ + +   + LGIA+K+TIT +STTIIAD   K EIQ+R+AQ+K
Sbjct  322  DIALMTGADFLAGDLGMALADATSDQLGIAQKITITNNSTTIIADPIMKAEIQARVAQIK  381

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVAVIKVGA TE+ELE++KLRIEDAKNATFAAI+EG
Sbjct  382  KDLAETDSAYLSRKLSERIAKLSGGVAVIKVGAHTESELEEKKLRIEDAKNATFAAIDEG  441

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA +VHLS ++  IKD ++D +EKLGADIVQKAL+ PA+LIA+NAG EG +V+E+
Sbjct  442  IAPGGGAVYVHLSKHISDIKDDIKDPEEKLGADIVQKALLVPAALIAENAGSEGSIVIER  501

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   DWE+GYNAMT  YENL   GVIDP +V+RC LQN+AS+AG+VL TQA + E
Sbjct  502  ILGSDWEMGYNAMTYKYENLFIEGVIDPCRVSRCGLQNAASIAGVVLLTQAALFE  556



>ref|XP_007041090.1| TCP-1/cpn60 chaperonin family protein isoform 4, partial [Theobroma 
cacao]
 gb|EOX96921.1| TCP-1/cpn60 chaperonin family protein isoform 4, partial [Theobroma 
cacao]
Length=557

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 198/233 (85%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +     + LG+ARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  306  DIALMTGADFLSGDLGLTLAGATSDQLGVARKVTITSNSTTIVADPSTKAEIQARIMQIK  365

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  366  KDLAETDSAYMSRKLSERIAKLSGGVAIIKVGAHTEMELEDRKLRIEDAKNATFAAMDEG  425

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAG++G+VVVEK
Sbjct  426  IVPGGGATYIHLSEQIHMIKNSMEDSDERIGADIVAKALLAPSKVIATNAGIDGDVVVEK  485

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R RDW++GYNAM+  YE+L+ AGV+DP +V+R ALQN+ SVAG+VLTTQAI+
Sbjct  486  TRTRDWQIGYNAMSGRYEDLITAGVVDPCRVSRFALQNAVSVAGIVLTTQAIM  538



>ref|XP_011000174.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Populus euphratica]
Length=585

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL + +   + LGIARKVTIT +STTI+AD+A+K EIQ+RI Q+K
Sbjct  334  DIALMTGADFLSGDFGLTLGSVTSDQLGIARKVTITSNSTTIVADSATKAEIQARILQIK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  394  KDLAETDNAALSRKLSERIAKLSGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHLS  + +IK++++D +EK+GADIV KAL+APA  IA NAG +G VVVE 
Sbjct  454  IVPGGGATYVHLSEQISSIKNSMKDENEKIGADIVAKALLAPAKTIATNAGADGAVVVEN  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW  GYNAMT  YE+L+ AGV+DP +V+RCALQ++ S+AG+VLTTQA++VE
Sbjct  514  IRSCDWRTGYNAMTGRYEDLLNAGVVDPCRVSRCALQSAVSIAGIVLTTQAVLVE  568



>ref|XP_007041089.1| TCP-1/cpn60 chaperonin family protein isoform 3 [Theobroma cacao]
 gb|EOX96920.1| TCP-1/cpn60 chaperonin family protein isoform 3 [Theobroma cacao]
Length=575

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 198/233 (85%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +     + LG+ARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  324  DIALMTGADFLSGDLGLTLAGATSDQLGVARKVTITSNSTTIVADPSTKAEIQARIMQIK  383

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  384  KDLAETDSAYMSRKLSERIAKLSGGVAIIKVGAHTEMELEDRKLRIEDAKNATFAAMDEG  443

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAG++G+VVVEK
Sbjct  444  IVPGGGATYIHLSEQIHMIKNSMEDSDERIGADIVAKALLAPSKVIATNAGIDGDVVVEK  503

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R RDW++GYNAM+  YE+L+ AGV+DP +V+R ALQN+ SVAG+VLTTQAI+
Sbjct  504  TRTRDWQIGYNAMSGRYEDLITAGVVDPCRVSRFALQNAVSVAGIVLTTQAIM  556



>ref|XP_011000175.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Populus euphratica]
Length=585

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL + +   + LGIARKVTIT +STTI+AD+A+K EIQ+RI Q+K
Sbjct  334  DIALMTGADFLSGDFGLTLGSVTSDQLGIARKVTITSNSTTIVADSATKAEIQARILQIK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  394  KDLAETDNAALSRKLSERIAKLSGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHLS  + +IK++++D +EK+GADIV KAL+APA  IA NAG +G VVVE 
Sbjct  454  IVPGGGATYVHLSEQISSIKNSMKDENEKIGADIVAKALLAPAKTIATNAGADGAVVVEN  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW  GYNAMT  YE+L+ AGV+DP +V+RCALQ++ S+AG+VLTTQA++VE
Sbjct  514  IRSCDWRTGYNAMTGRYEDLLNAGVVDPCRVSRCALQSAVSIAGIVLTTQAVLVE  568



>ref|XP_011628474.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Amborella trichopoda]
 ref|XP_011628475.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha 
[Amborella trichopoda]
Length=587

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLG+ + +   + LGIA+K+TIT +STTIIAD   K EIQ+R+AQ+K
Sbjct  336  DIALMTGADFLAGDLGMALADATSDQLGIAQKITITNNSTTIIADPIMKAEIQARVAQIK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVAVIKVGA TE+ELE++KLRIEDAKNATFAAI+EG
Sbjct  396  KDLAETDSAYLSRKLSERIAKLSGGVAVIKVGAHTESELEEKKLRIEDAKNATFAAIDEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA +VHLS ++  IKD ++D +EKLGADIVQKAL+ PA+LIA+NAG EG +V+E+
Sbjct  456  IAPGGGAVYVHLSKHISDIKDDIKDPEEKLGADIVQKALLVPAALIAENAGSEGSIVIER  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   DWE+GYNAMT  YENL   GVIDP +V+RC LQN+AS+AG+VL TQA + E
Sbjct  516  ILGSDWEMGYNAMTYKYENLFIEGVIDPCRVSRCGLQNAASIAGVVLLTQAALFE  570



>ref|XP_011460484.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X3 [Fragaria vesca subsp. vesca]
Length=468

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G  +++   + LGIARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  217  DIALMTGADFLSGDFGFTLDSATSDQLGIARKVTITSNSTTIVADPSTKAEIQARILQIK  276

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GG+AVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  277  KDLAETENANLSRKLSERIAKLCGGIAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  336

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS  +P IK+++ED+DE+ GADI+ KAL+APA  IA NAG +GEVVVEK
Sbjct  337  VVPGGGATYVHLSESIPVIKNSMEDSDEQFGADIIAKALLAPAKSIATNAGDDGEVVVEK  396

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +D DW +GYNAMT  YE+L +AGV+DP +V+RCALQ + S+AG+VLTTQA++VEK K K
Sbjct  397  TKDCDWRIGYNAMTGRYEDLPDAGVLDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTKTK  456

Query  157  tpapaaPQGLT  125
             PA  +  G+T
Sbjct  457  KPAIPSVPGIT  467



>ref|XP_007041087.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
 gb|EOX96918.1| TCP-1/cpn60 chaperonin family protein isoform 1 [Theobroma cacao]
Length=584

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 198/233 (85%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +     + LG+ARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  333  DIALMTGADFLSGDLGLTLAGATSDQLGVARKVTITSNSTTIVADPSTKAEIQARIMQIK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  393  KDLAETDSAYMSRKLSERIAKLSGGVAIIKVGAHTEMELEDRKLRIEDAKNATFAAMDEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAG++G+VVVEK
Sbjct  453  IVPGGGATYIHLSEQIHMIKNSMEDSDERIGADIVAKALLAPSKVIATNAGIDGDVVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R RDW++GYNAM+  YE+L+ AGV+DP +V+R ALQN+ SVAG+VLTTQAI+
Sbjct  513  TRTRDWQIGYNAMSGRYEDLITAGVVDPCRVSRFALQNAVSVAGIVLTTQAIM  565



>ref|XP_011401398.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM28383.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Auxenochlorella protothecoides]
Length=560

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTGAE+ A DLG+ VE+   E LG ARK+T+   STT+IADAA++DEI +R+AQ+K
Sbjct  301  DIAIVTGAEFVAKDLGMKVESVTAEQLGTARKLTVAATSTTLIADAANRDEIAARVAQVK  360

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS YDS+KLAERIAKL+GGVAVIKVGAATEAELEDRKLR+EDAKNATFAA+EEG
Sbjct  361  RELAETDSTYDSQKLAERIAKLAGGVAVIKVGAATEAELEDRKLRVEDAKNATFAAVEEG  420

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA +HLS  VP    TLE  +E+ GA I+ +AL AP  +IAQNAGVEGEV+V++
Sbjct  421  IVPGGGAALLHLSELVPDFVATLEHPEERQGAAILGQALRAPCRIIAQNAGVEGEVIVQR  480

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +  +D+ VGYNAM D  E+L++AG++DPAKVTR  L N+ S+AG++LTTQA++ E
Sbjct  481  LLGKDFGVGYNAMHDRVEDLLDAGILDPAKVTRSGLINACSIAGIMLTTQAVMTE  535



>gb|EYU43672.1| hypothetical protein MIMGU_mgv1a006437mg [Erythranthe guttata]
Length=444

 Score =   281 bits (718),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LGIARKVTIT   TTI+AD+++K EIQ+R+ Q+K
Sbjct  193  DIALMTGADFLSGDLGLTLDTATSDQLGIARKVTITSKFTTIVADSSTKAEIQARVMQIK  252

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K++ ETDS Y +EKL+ER+AKL GGV +IKVGA T+ ELEDRKLRIEDAK+ATFAAI EG
Sbjct  253  KDIAETDSKYLAEKLSERMAKLCGGVCIIKVGAHTDIELEDRKLRIEDAKSATFAAISEG  312

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA ++HLS  +P+IK   +D DE++GADIV  AL+APA LIA NAGV+G+VVVEK
Sbjct  313  VVPGGGATYIHLSKQIPSIKKAFQDPDEQIGADIVGMALLAPAKLIAANAGVDGDVVVEK  372

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            ++  D  +GYNAM   +E+L+ AGVIDP +V+RCAL+N+ SVAGM+LTTQAI+VE
Sbjct  373  IKACDSRIGYNAMNGRFEDLMNAGVIDPCRVSRCALENAISVAGMILTTQAILVE  427



>ref|XP_003055784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61036.1| predicted protein [Micromonas pusilla CCMP1545]
Length=590

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 199/235 (85%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAIVTG+ + A DLGL V++  ++ALG ARKVTIT ++TT+IADAAS+DEI  R+AQLK
Sbjct  331  DIAIVTGSTFLAKDLGLGVKSATIDALGYARKVTITNNTTTLIADAASRDEIDIRVAQLK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDSIYD++KL+ERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  391  QELAETDSIYDTQKLSERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA  HLS  V   KDTL D +E+LGA+IVQKALVAP  +IA NAGVEG+V+VEK
Sbjct  451  IVPGGGAALAHLSVMVNDFKDTLVDPEERLGAEIVQKALVAPCRIIANNAGVEGDVIVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V + DWE+GYNAM  ++ +++E GVIDP KVTR  L N+ S+AGMVLTTQA++ E
Sbjct  511  VLNSDWEMGYNAMDGTFIDMIEGGVIDPKKVTRSGLMNACSIAGMVLTTQAVITE  565



>ref|XP_002987904.1| hypothetical protein SELMODRAFT_183479 [Selaginella moellendorffii]
 gb|EFJ10978.1| hypothetical protein SELMODRAFT_183479 [Selaginella moellendorffii]
Length=594

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI TGAE+ A +LGL +E+  ++ LG+A+KVTI + ST I+AD A+K EI++R+A++K
Sbjct  341  DIAIFTGAEFLAGELGLQLEDLTIDQLGVAKKVTIKEKSTVILADDATKGEIKARVAEIK  400

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  +DS Y SEKLAERIAKLSGGVAVIKVGAATEAE EDRKLR+EDAKN+TFAA++EG
Sbjct  401  KDLELSDSAYHSEKLAERIAKLSGGVAVIKVGAATEAEAEDRKLRLEDAKNSTFAAVKEG  460

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA VHLS  V  IK++L D  EKLGADIVQKAL+APA+LIA NAGVEG++VV +
Sbjct  461  IVPGGGAAMVHLSAAVAGIKESLSDPQEKLGADIVQKALLAPAALIASNAGVEGQMVVSR  520

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +WE GYNAMTD +ENLV  GV+DPAKVTRCALQN+ASVAGMVLTT+AI V+
Sbjct  521  ILESEWEFGYNAMTDKFENLVLGGVVDPAKVTRCALQNAASVAGMVLTTEAIAVD  575



>gb|KJB47908.1| hypothetical protein B456_008G048200 [Gossypium raimondii]
Length=580

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G+ +     + LG+ARKVTIT +STTI++D ++K EIQ+RI Q+K
Sbjct  329  DIALMTGADFLSGDFGMTLAAATSDQLGVARKVTITSNSTTIVSDPSTKAEIQARIMQIK  388

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S +L+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNA FAA++EG
Sbjct  389  KDLAETDSAYLSRRLSERIAKLSGGVAVIKVGAHTEMELEDRKLRIEDAKNAAFAAMDEG  448

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAGV+GEVVVEK
Sbjct  449  IVPGGGATYIHLSEQIHTIKNSMEDSDEQIGADIVAKALLAPSKVIATNAGVDGEVVVEK  508

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW++GYNAM+  YE+L+ AGVIDP +V+RCALQ++ SVAG+VLTTQAI+V+
Sbjct  509  TRKLDWKIGYNAMSGRYEDLINAGVIDPCRVSRCALQSAVSVAGVVLTTQAIMVD  563



>emb|CDX71396.1| BnaC04g16310D [Brassica napus]
Length=529

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQA D+GLLVENT ++ LGIARKVTI+KDS T+IADAASKDE+Q+RI+QLK
Sbjct  345  DIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSATLIADAASKDELQARISQLK  404

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KELFETDS+Y SEKLAERIAKLSGGVAVIKVGAAT  ELEDRKLRIEDAKNATFAAIEEG
Sbjct  405  KELFETDSVYGSEKLAERIAKLSGGVAVIKVGAAT--ELEDRKLRIEDAKNATFAAIEEG  462

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNA  368
            IVPGGGA  VHLST +PAIK+T EDADE+LGADIVQKALVA A+LIAQNA
Sbjct  463  IVPGGGATLVHLSTVIPAIKETFEDADERLGADIVQKALVASAALIAQNA  512



>gb|KJB47909.1| hypothetical protein B456_008G048200 [Gossypium raimondii]
Length=579

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G+ +     + LG+ARKVTIT +STTI++D ++K EIQ+RI Q+K
Sbjct  328  DIALMTGADFLSGDFGMTLAAATSDQLGVARKVTITSNSTTIVSDPSTKAEIQARIMQIK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S +L+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNA FAA++EG
Sbjct  388  KDLAETDSAYLSRRLSERIAKLSGGVAVIKVGAHTEMELEDRKLRIEDAKNAAFAAMDEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAGV+GEVVVEK
Sbjct  448  IVPGGGATYIHLSEQIHTIKNSMEDSDEQIGADIVAKALLAPSKVIATNAGVDGEVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW++GYNAM+  YE+L+ AGVIDP +V+RCALQ++ SVAG+VLTTQAI+V+
Sbjct  508  TRKLDWKIGYNAMSGRYEDLINAGVIDPCRVSRCALQSAVSVAGVVLTTQAIMVD  562



>gb|KJB47910.1| hypothetical protein B456_008G048200 [Gossypium raimondii]
Length=586

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 198/235 (84%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G+ +     + LG+ARKVTIT +STTI++D ++K EIQ+RI Q+K
Sbjct  335  DIALMTGADFLSGDFGMTLAAATSDQLGVARKVTITSNSTTIVSDPSTKAEIQARIMQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S +L+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNA FAA++EG
Sbjct  395  KDLAETDSAYLSRRLSERIAKLSGGVAVIKVGAHTEMELEDRKLRIEDAKNAAFAAMDEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HLS  +  IK+++ED+DE++GADIV KAL+AP+ +IA NAGV+GEVVVEK
Sbjct  455  IVPGGGATYIHLSEQIHTIKNSMEDSDEQIGADIVAKALLAPSKVIATNAGVDGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW++GYNAM+  YE+L+ AGVIDP +V+RCALQ++ SVAG+VLTTQAI+V+
Sbjct  515  TRKLDWKIGYNAMSGRYEDLINAGVIDPCRVSRCALQSAVSVAGVVLTTQAIMVD  569



>ref|XP_004295490.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=585

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G  +++   + LGIARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  334  DIALMTGADFLSGDFGFTLDSATSDQLGIARKVTITSNSTTIVADPSTKAEIQARILQIK  393

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GG+AVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  394  KDLAETENANLSRKLSERIAKLCGGIAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  453

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS  +P IK+++ED+DE+ GADI+ KAL+APA  IA NAG +GEVVVEK
Sbjct  454  VVPGGGATYVHLSESIPVIKNSMEDSDEQFGADIIAKALLAPAKSIATNAGDDGEVVVEK  513

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +D DW +GYNAMT  YE+L +AGV+DP +V+RCALQ + S+AG+VLTTQA++VEK K K
Sbjct  514  TKDCDWRIGYNAMTGRYEDLPDAGVLDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTKTK  573

Query  157  tpapaaPQGLT  125
             PA  +  G+T
Sbjct  574  KPAIPSVPGIT  584



>ref|XP_010054187.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW75693.1| hypothetical protein EUGRSUZ_D00059 [Eucalyptus grandis]
Length=584

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + +LGL ++    + LGIARKV I+ +ST I+AD ++K EIQ+RI+Q+K
Sbjct  333  DIALLTGADFLSGELGLTLDGVTSDQLGIARKVNISSNSTIIVADPSTKAEIQARISQIK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KLAERIAKL+GGVA+IKVGA TE ELEDRKLRIEDAK ATFAA++EG
Sbjct  393  KDLAETDSAYHSRKLAERIAKLTGGVAIIKVGAHTEVELEDRKLRIEDAKQATFAAMDEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGAA++HLS Y+ AIK  +ED +E++G+D+V  AL+APA  IA NAG +G+ VVEK
Sbjct  453  IVPGGGAAYIHLSEYISAIKSKMEDQEEQIGSDVVATALLAPAKAIATNAGADGDTVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R   WE+GYNAMT  YE+L+  GVIDP KV+RCALQ++ S+AG VLTTQAI+VE
Sbjct  513  TRTCGWEIGYNAMTGKYEDLLSVGVIDPCKVSRCALQSAVSIAGTVLTTQAILVE  567



>ref|XP_011460483.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=586

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D G  +++   + LGIARKVTIT +STTI+AD ++K EIQ+RI Q+K
Sbjct  335  DIALMTGADFLSGDFGFTLDSATSDQLGIARKVTITSNSTTIVADPSTKAEIQARILQIK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GG+AVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  395  KDLAETENANLSRKLSERIAKLCGGIAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS  +P IK+++ED+DE+ GADI+ KAL+APA  IA NAG +GEVVVEK
Sbjct  455  VVPGGGATYVHLSESIPVIKNSMEDSDEQFGADIIAKALLAPAKSIATNAGDDGEVVVEK  514

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +D DW +GYNAMT  YE+L +AGV+DP +V+RCALQ + S+AG+VLTTQA++VEK K K
Sbjct  515  TKDCDWRIGYNAMTGRYEDLPDAGVLDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTKTK  574

Query  157  tpapaaPQGLT  125
             PA  +  G+T
Sbjct  575  KPAIPSVPGIT  585



>ref|XP_008459023.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Cucumis melo]
Length=587

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 189/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E    + LGIARKV IT +STTI+AD ++KDEIQ+RI+Q+K
Sbjct  336  DIALMTGADFLSGDLGLGLEGATSDQLGIARKVVITSNSTTIVADPSTKDEIQARISQIK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNA FAA+ EG
Sbjct  396  KDLLETDNSNLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNAVFAAMNEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IV GGGA +VHL   +P IK ++E+ DE++GADIV KAL+APA LIA NAG +G VVVEK
Sbjct  456  IVAGGGATYVHLYELLPTIKQSMENQDEQIGADIVGKALLAPAKLIASNAGDDGIVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             +  DW  GYNAM + YE+L  AGV+DP  V+RCALQ +ASV G+VLTTQAI+VE
Sbjct  516  TQACDWRHGYNAMANKYEDLFNAGVVDPCLVSRCALQIAASVTGIVLTTQAIMVE  570



>ref|XP_008798228.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Phoenix dactylifera]
Length=582

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TG ++ ASDLGL +     + LGIA+K+TIT +STTI+AD + + EIQ+RI+Q+K
Sbjct  331  DIALMTGGDFLASDLGLTLSGVTSDQLGIAQKITITSNSTTIVADPSMRAEIQARISQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ER+AKLS GVAVIKVGA TEAELEDRKLRIEDAKNA  AA++EG
Sbjct  391  KDLAETDSAYLSRKLSERVAKLSSGVAVIKVGAHTEAELEDRKLRIEDAKNAISAALDEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA FV LS ++ AI  T+ED +EK+GADI+ KAL+ PAS IA NAGV+G VVVEK
Sbjct  451  IAPGGGATFVQLSKHIAAIIQTIEDPEEKIGADIIGKALLVPASSIAHNAGVDGSVVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +    W +GYNAMT+ +E+L+++GV+DP KV+RCALQN+ASVAGMVL TQA++V+
Sbjct  511  LLATGWRIGYNAMTNEFEDLLKSGVVDPCKVSRCALQNAASVAGMVLMTQAVMVD  565



>gb|EYU42157.1| hypothetical protein MIMGU_mgv1a019252mg, partial [Erythranthe 
guttata]
Length=494

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAEYQASDLGLLVENT V+ LGIARK+TI+KDSTTIIADAASKDE+Q+RIAQLK
Sbjct  338  DIAILTGAEYQASDLGLLVENTDVDQLGIARKITISKDSTTIIADAASKDELQARIAQLK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YDSEKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  398  KELSETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQK  407
            IVPGGGAA VHLST VPAIKDT+ED +EKLGADI+QK
Sbjct  458  IVPGGGAALVHLSTCVPAIKDTIEDPEEKLGADIIQK  494



>ref|XP_003607893.1| RuBisCO large subunit-binding protein subunit alpha [Medicago 
truncatula]
 gb|AES90090.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=467

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++   DLGL +E T  + LG A KV IT ++TTI AD  +K EIQ+RI Q+K
Sbjct  216  DIALMTGADFLCGDLGLTLEGTTSDQLGSALKVKITSNATTIFADPNTKAEIQARILQIK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKL+GG+AVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  276  KDLIETDNANHSRKLSERIAKLTGGIAVIKVGAHTELELEDRKLRIEDAKNATFAAINEG  335

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHL   +PAIK+++ED DE++GADIV KALV PA  IA NAGV+G+VVVEK
Sbjct  336  LVPGGGATYVHLLDLIPAIKNSMEDLDEQIGADIVAKALVEPAKSIAANAGVDGDVVVEK  395

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW +GYNAMT +YE+L+ AGV DP++V RCALQ++ S+AG+VLTTQAI+V+
Sbjct  396  TRTFDWRIGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSIAGVVLTTQAILVD  450



>ref|XP_004505302.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit alpha 2, 
chloroplastic-like [Cicer arietinum]
Length=636

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 193/234 (82%), Gaps = 0/234 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +E T  + LG A KVTI+ ++TTI A+ ++K EIQ+RI Q+K
Sbjct  321  DIALMTGADFLSGDLGLTLEGTTSDQLGTAMKVTISSNTTTIFANRSTKAEIQARILQIK  380

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGG+AVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  381  KDLIETDNANHSRKLSERIAKLSGGIAVIKVGAHTELELEDRKLRIEDAKNATFAAINEG  440

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHL   +PAIK+++ED DE++GADIV KAL+ PA  IA NAGV+G++VVEK
Sbjct  441  LVPGGGATYVHLLDLIPAIKNSMEDLDEQIGADIVAKALLEPAKSIAANAGVDGDIVVEK  500

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVV  176
             R  DW  GYNAMTD+YE+L+ AGV DP++V RCALQ++ SVAG+VLTTQAI++
Sbjct  501  TRASDWRTGYNAMTDTYEDLLNAGVADPSRVARCALQSAVSVAGVVLTTQAILL  554



>ref|XP_009381752.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=584

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ ASDLGL++ +   + LGIARKVTIT +STTI+AD + K EIQ+RI+Q+K
Sbjct  333  DIALMTGADFLASDLGLMLRDVTSDQLGIARKVTITSNSTTIVADPSMKAEIQARISQIK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L E DS Y  +KL+ERIAKLS G AVIKVG  TEAELEDRKLR+EDAKNATFAA++EG
Sbjct  393  KDLTEVDSSYLRKKLSERIAKLSSGFAVIKVGGLTEAELEDRKLRMEDAKNATFAAMDEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA +V LS ++  I D  ED +EK+GA+IV KAL+ PA LIAQNAGV+G +VVEK
Sbjct  453  IAPGGGATYVQLSKHISTISDLFEDPEEKIGAEIVGKALLVPAYLIAQNAGVDGSIVVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + D DW  GYNAMT+ +E+L+++GV+DP +V+RCALQN+ASVAG+VL +QA +V+
Sbjct  513  LLDSDWRNGYNAMTNEFEDLLKSGVVDPCRVSRCALQNAASVAGVVLLSQAAMVD  567



>ref|XP_010927077.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Elaeis guineensis]
Length=584

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 152/251 (61%), Positives = 200/251 (80%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ +SDLGL++     + LG+A+K+TIT +STTI+AD + + EIQ+RI Q+K
Sbjct  333  DIALMTGADFVSSDLGLMLRGVTSDQLGVAQKITITSNSTTIVADPSMRAEIQARILQIK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y + KL+ERIAKLS GVAVIKVGA TEAELEDRKLRIEDAKNAT AAI+EG
Sbjct  393  KDLTETDSSYLARKLSERIAKLSSGVAVIKVGAPTEAELEDRKLRIEDAKNATSAAIDEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA  V LS ++P I   ++D +EK+GADIV KAL+ PAS IA NAGV+G V+VEK
Sbjct  453  IAPGGGATLVQLSKHIPTIVHLIDDPEEKIGADIVGKALLVPASSIASNAGVDGSVIVEK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +    W++GYNAMT+ +E+L+++GV+DP KV+RCALQN+AS+AG+VL TQA++V+K K  
Sbjct  513  LLSCAWQIGYNAMTNEFEDLLKSGVVDPCKVSRCALQNAASIAGIVLMTQAVMVDKIKKP  572

Query  157  tpapaaPQGLT  125
             P      G+T
Sbjct  573  KPVVPLVPGIT  583



>ref|XP_010927078.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X2 [Elaeis guineensis]
Length=582

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/251 (61%), Positives = 200/251 (80%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ +SDLGL++     + LG+A+K+TIT +STTI+AD + + EIQ+RI Q+K
Sbjct  331  DIALMTGADFVSSDLGLMLRGVTSDQLGVAQKITITSNSTTIVADPSMRAEIQARILQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y + KL+ERIAKLS GVAVIKVGA TEAELEDRKLRIEDAKNAT AAI+EG
Sbjct  391  KDLTETDSSYLARKLSERIAKLSSGVAVIKVGAPTEAELEDRKLRIEDAKNATSAAIDEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGGA  V LS ++P I   ++D +EK+GADIV KAL+ PAS IA NAGV+G V+VEK
Sbjct  451  IAPGGGATLVQLSKHIPTIVHLIDDPEEKIGADIVGKALLVPASSIASNAGVDGSVIVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +    W++GYNAMT+ +E+L+++GV+DP KV+RCALQN+AS+AG+VL TQA++V+K K  
Sbjct  511  LLSCAWQIGYNAMTNEFEDLLKSGVVDPCKVSRCALQNAASIAGIVLMTQAVMVDKIKKP  570

Query  157  tpapaaPQGLT  125
             P      G+T
Sbjct  571  KPVVPLVPGIT  581



>ref|XP_003607892.1| RuBisCO large subunit-binding protein subunit alpha [Medicago 
truncatula]
 gb|AES90089.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=579

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++   DLGL +E T  + LG A KV IT ++TTI AD  +K EIQ+RI Q+K
Sbjct  328  DIALMTGADFLCGDLGLTLEGTTSDQLGSALKVKITSNATTIFADPNTKAEIQARILQIK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKL+GG+AVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  388  KDLIETDNANHSRKLSERIAKLTGGIAVIKVGAHTELELEDRKLRIEDAKNATFAAINEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHL   +PAIK+++ED DE++GADIV KALV PA  IA NAGV+G+VVVEK
Sbjct  448  LVPGGGATYVHLLDLIPAIKNSMEDLDEQIGADIVAKALVEPAKSIAANAGVDGDVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW +GYNAMT +YE+L+ AGV DP++V RCALQ++ S+AG+VLTTQAI+V+
Sbjct  508  TRTFDWRIGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSIAGVVLTTQAILVD  562



>gb|ABC75363.2| GroEL-like chaperone, ATPase [Medicago truncatula]
Length=595

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++   DLGL +E T  + LG A KV IT ++TTI AD  +K EIQ+RI Q+K
Sbjct  328  DIALMTGADFLCGDLGLTLEGTTSDQLGSALKVKITSNATTIFADPNTKAEIQARILQIK  387

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKL+GG+AVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  388  KDLIETDNANHSRKLSERIAKLTGGIAVIKVGAHTELELEDRKLRIEDAKNATFAAINEG  447

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHL   +PAIK+++ED DE++GADIV KALV PA  IA NAGV+G+VVVEK
Sbjct  448  LVPGGGATYVHLLDLIPAIKNSMEDLDEQIGADIVAKALVEPAKSIAANAGVDGDVVVEK  507

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW +GYNAMT +YE+L+ AGV DP++V RCALQ++ S+AG+VLTTQAI+V+
Sbjct  508  TRTFDWRIGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSIAGVVLTTQAILVD  562



>ref|XP_012074228.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Jatropha 
curcas]
Length=587

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +     + LGIARKVTIT +STTI+AD ++K EI++RI Q+K
Sbjct  336  DIALMTGADFLSGDFGLTLLGATSDQLGIARKVTITSNSTTIVADPSTKAEIEARIMQMK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S KL+ERIAKLSGGVAVIKVG  TE ELED KLRIEDAKNAT+AA++EG
Sbjct  396  KDLAETDNSYLSRKLSERIAKLSGGVAVIKVGEHTETELEDGKLRIEDAKNATYAAMDEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG A+VHLS ++  I++++ED DE++GADIV KAL+APA  IA NAG +GE+VVEK
Sbjct  456  IVPGGGVAYVHLSKHISTIQESMEDQDEQIGADIVAKALLAPAKTIATNAGFDGELVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW + +NAMT  YE+L++AGV+DP +V+RCALQ++ S+AG+VLTTQAI+VE
Sbjct  516  IRCSDWRIVFNAMTGEYEDLLDAGVVDPCRVSRCALQSATSIAGLVLTTQAILVE  570



>ref|XP_007157774.1| hypothetical protein PHAVU_002G097700g [Phaseolus vulgaris]
 gb|ESW29768.1| hypothetical protein PHAVU_002G097700g [Phaseolus vulgaris]
Length=485

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KVTIT ++TTIIAD ++K EIQ+RI+Q+K
Sbjct  234  DIALMTGADFLSGDLGLTLDGVTSDQLGTALKVTITSNATTIIADPSTKAEIQARISQIK  293

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  294  KDLSETNNANLSRKLSERIAKLLGGVAVIKVGAHTELELEDRKLRIEDAKNATFAAISEG  353

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I++++ED DE++GADIV KAL+ PA  IA NAG++G++VV+K
Sbjct  354  IVPGGGATYVHLLDLIPTIRNSMEDLDEQIGADIVAKALIEPAKSIATNAGIDGDIVVQK  413

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMT  YE+L+ AGV DP++V RCALQ++ SVAG+VLTTQAI+V+
Sbjct  414  TRTHDWRTGYNAMTGIYEDLLNAGVADPSRVARCALQSAVSVAGVVLTTQAILVD  468



>ref|XP_009126286.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Brassica 
rapa]
Length=578

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y A DLG+ +     + LG+ARKVT+T +STTI+AD ++K EIQ+RIAQ+K
Sbjct  325  DIALMTGADYLAGDLGMSLMGATSDQLGVARKVTVTANSTTIVADPSTKPEIQARIAQMK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y + K+AERIAKLSGGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  385  KDLAETDNSYMTGKIAERIAKLSGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P IK TL ED  E++GADIV  AL APA +IA NAGV+G VVVE
Sbjct  445  IVPGGGATYIHLLDEIPRIKKTLMEDLYEQIGADIVATALTAPAMVIATNAGVDGSVVVE  504

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ AG+ DP KV+R ALQN+ SVAG+VLTTQA++VE
Sbjct  505  KTRELEWRSGYNAMSGRYEDLINAGIADPCKVSRFALQNAVSVAGIVLTTQAVLVE  560



>ref|XP_008339359.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin 60 subunit alpha 2, 
chloroplastic-like [Malus domestica]
Length=529

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LGIARKV IT +STTI+AD ++K EIQ+RI Q+K
Sbjct  277  DIALMTGADFLSGDFGLTLESATSDQLGIARKVKITSNSTTIVADPSTKAEIQARILQIK  336

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  337  KDLAETENANLSRKLSERIAKLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  396

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P+IKD++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  397  VVPGGGATYVHLSEFIPSIKDSMEDLDEQIGADLVAKALLAPAKAIATNAGDDGEVVVEK  456

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAMT +YE+L + GVIDP +V+RCALQ + S+AG+VLTTQA++VEK K K
Sbjct  457  TKSSDWRVGYNAMTGNYEDLPDGGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTKTK  516

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  517  KPAVPFVPGIT  527



>ref|XP_006661543.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Oryza brachyantha]
Length=587

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  ++    + LG+A+K+TIT DSTTIIA  + + EI++RI QLK
Sbjct  329  DIAIMTGADFFASDLGWCLQGATSDQLGMAQKITITSDSTTIIAHPSMRPEIEARIQQLK  388

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GVAVIKVGAATEAELEDRKLR EDAKNATFAAI EG
Sbjct  389  KDLEETTSAYLKERFSARIAKLSRGVAVIKVGAATEAELEDRKLRAEDAKNATFAAISEG  448

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  ++ LS Y+P+I D + D++EK+G DIV KAL+ PA  IA+NAG +G  VVEK
Sbjct  449  ITPGGGLTYIQLSKYIPSIMDLVVDSEEKIGVDIVGKALLVPAMTIARNAGADGPAVVEK  508

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMTD +E+LVEAGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  509  LLASEWRVGYNAMTDKFEDLVEAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  563



>emb|CDY47184.1| BnaAnng08540D [Brassica napus]
Length=578

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y A DLG+ +     + LG+ARKVTIT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  325  DIALMTGADYLAGDLGMSLMGATSDQLGVARKVTITANSTTIVADPSTKPEIQARIAQMK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y + K+AERIAKLSGGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  385  KDLAETDNSYMTGKIAERIAKLSGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P IK  L ED  E++GADIV  AL APA +IA NAGV+G VVVE
Sbjct  445  IVPGGGATYIHLLDEIPRIKKNLMEDLYEQIGADIVATALTAPAMVIATNAGVDGSVVVE  504

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ AG+ DP KV+R ALQN+ SVAG+VLTTQA++VE
Sbjct  505  KTRELEWRSGYNAMSGRYEDLINAGIADPCKVSRFALQNAVSVAGIVLTTQAVLVE  560



>ref|XP_006468488.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Citrus sinensis]
Length=588

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + +LGL +     + LGIARKVT+  +STTI+AD  +K EIQ+RI Q+K
Sbjct  337  DIALMTGADFLSGELGLTLAGATSDQLGIARKVTVKSNSTTIVADPYTKAEIQARIMQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  TD+ Y S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  397  KDLAATDNAYLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMDEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL  ++P IK+++ED DE++GADIV KAL+ PA  IA NAGV+G +VVEK
Sbjct  457  IVPGGGATYVHLLEHIPIIKNSMEDPDEQIGADIVAKALIVPAISIATNAGVDGTIVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMT  YE+L+ AGV DP +V RCALQN+ S+A +VLTT+A++ +
Sbjct  517  TRTSDWRFGYNAMTGRYEDLLSAGVADPCRVARCALQNAVSIAAVVLTTEAVLAD  571



>ref|XP_006448698.1| hypothetical protein CICLE_v10014704mg [Citrus clementina]
 gb|ESR61938.1| hypothetical protein CICLE_v10014704mg [Citrus clementina]
Length=588

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + +LGL +     + LGIARKVT+  +STTI+AD  +K EIQ+RI Q+K
Sbjct  337  DIALMTGADFLSGELGLTLAGATSDQLGIARKVTVKSNSTTIVADPYTKAEIQARIMQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  TD+ Y S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  397  KDLAATDNAYLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMDEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL  ++P IK+++ED DE++GADIV KAL+ PA  IA NAGV+G +VVEK
Sbjct  457  IVPGGGATYVHLLEHIPIIKNSMEDPDEQIGADIVAKALIVPAISIATNAGVDGTIVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMT  YE+L+ AGV DP +V RCALQN+ S+A +VLTT+A++ +
Sbjct  517  TRTSDWRFGYNAMTGRYEDLLSAGVADPCRVARCALQNAVSIAAVVLTTEAVLAD  571



>gb|KDO77362.1| hypothetical protein CISIN_1g007834mg [Citrus sinensis]
Length=588

 Score =   275 bits (702),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + +LGL +     + LGIARKVT+  +STTI+AD  +K EIQ+RI Q+K
Sbjct  337  DIALMTGADFLSGELGLTLAGATSDQLGIARKVTVKSNSTTIVADPYTKAEIQARIMQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  TD+ Y S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  397  KDLAATDNAYLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMDEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL  ++P IK+++ED DE++GADIV KAL+ PA  IA NAGV+G +VVEK
Sbjct  457  IVPGGGATYVHLLEHIPIIKNSMEDPDEQIGADIVAKALIVPAISIATNAGVDGTIVVEK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMT  YE+L+ AGV DP +V RCALQN+ S+A +VLTT+A++ +
Sbjct  517  TRTSDWRFGYNAMTGRYEDLLSAGVADPCRVARCALQNAVSIAAVVLTTEAVLAD  571



>gb|EPS71604.1| hypothetical protein M569_03149, partial [Genlisea aurea]
Length=548

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 184/236 (78%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            D+A++TGA++ + DLGL ++    + LGIA KVTIT   TT++A  ++K E+Q+RI Q+K
Sbjct  296  DVALMTGADFISGDLGLTLDTVTSDQLGIAHKVTITSSFTTLVAHPSTKAEVQARIMQIK  355

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y +EKL++RIAKL GGV++IKVG  TE ELEDRKLRIEDAKNAT AAI EG
Sbjct  356  KDLGETDSKYLAEKLSQRIAKLCGGVSIIKVGGHTEVELEDRKLRIEDAKNATLAAIAEG  415

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgv-egevvve  341
            +VPGGGAA++HLS  VP IK   +  DE++GADIV+KAL+APA LIA N GV    VV  
Sbjct  416  VVPGGGAAYIHLSKEVPMIKRRFQHPDEQIGADIVEKALMAPAKLIAANGGVDGDVVVEN  475

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
                 ++ VGYNAM+  YE+L+ AGVIDP++V RCAL+N+ASVAGM+LTTQAI+VE
Sbjct  476  IKECEEFRVGYNAMSGGYEDLICAGVIDPSRVARCALENAASVAGMILTTQAIMVE  531



>ref|XP_006583922.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=485

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KVTIT ++TTIIAD + K EIQ+RI+Q+K
Sbjct  234  DIALMTGADFLSGDLGLTLDGATSDQLGTALKVTITSNATTIIADPSMKAEIQARISQIK  293

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGG+AVIKVGA TE ELEDRKLRI+DAKNATFAAI EG
Sbjct  294  KDLSETDNANLSRKLSERIAKLSGGIAVIKVGAHTEVELEDRKLRIDDAKNATFAAISEG  353

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I +++ED +E++GADIV KAL+ PA  IA NAGV+G++VV+K
Sbjct  354  IVPGGGATYVHLLDLIPTIMNSMEDLEEQIGADIVAKALLEPAKSIATNAGVDGDIVVQK  413

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW +GYNAMT +YE+L+ AGV DP++V RCALQ++ SVAG VLTTQAI+V+
Sbjct  414  IRTHDWRIGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSVAGAVLTTQAILVD  468



>emb|CDY02601.1| BnaC02g08340D [Brassica napus]
Length=578

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y A DLG+ +     + LG+ARKVT+T +STTI+AD ++K EI++RIAQ+K
Sbjct  325  DIALMTGADYLAGDLGMSLMGATSDQLGVARKVTVTANSTTIVADPSTKPEIRARIAQMK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y + K+AERIAKLSGGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  385  KDLAETDNSYMTGKIAERIAKLSGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P IK TL ED  E++GADIV  AL APA +IA NAGV+G VVVE
Sbjct  445  IVPGGGATYIHLLDEIPRIKKTLMEDLYEQIGADIVATALKAPAMVIATNAGVDGSVVVE  504

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ AG+ DP KV+R ALQN+ SVAG+VLTTQA++VE
Sbjct  505  KTRELEWRSGYNAMSGRYEDLINAGIADPCKVSRFALQNAVSVAGIVLTTQAVLVE  560



>ref|XP_010648810.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic [Vitis 
vinifera]
 emb|CBI27180.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 202/251 (80%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL +++   + LGIARKVTIT +STT +AD ++K EIQ+RI Q+K
Sbjct  332  DIALLTGADFLSGDLGLTLDSATSDQLGIARKVTITSNSTTFVADPSTKPEIQARILQIK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S KL+ERIAKLSGGVA+IKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  392  KDLAETDSSYLSRKLSERIAKLSGGVAIIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA ++HL   +P IK ++ED DE++GADIV KAL APA  IA NAGV+G VV+EK
Sbjct  452  IVPGGGATYIHLEEQIPIIKHSMEDPDEQIGADIVAKALAAPAKAIATNAGVDGAVVIEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
            +R  DW  GY+AMT  Y++L+ AGV+DP +V+RCALQN+ SVAG+VLTTQA++VEK KP 
Sbjct  512  IRTCDWRTGYDAMTGRYQDLLNAGVVDPCRVSRCALQNAVSVAGIVLTTQAVLVEKTKPP  571

Query  157  tpapaaPQGLT  125
              A     G+T
Sbjct  572  KSAVPRLPGIT  582



>ref|XP_007157775.1| hypothetical protein PHAVU_002G097700g [Phaseolus vulgaris]
 gb|ESW29769.1| hypothetical protein PHAVU_002G097700g [Phaseolus vulgaris]
Length=588

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KVTIT ++TTIIAD ++K EIQ+RI+Q+K
Sbjct  337  DIALMTGADFLSGDLGLTLDGVTSDQLGTALKVTITSNATTIIADPSTKAEIQARISQIK  396

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  397  KDLSETNNANLSRKLSERIAKLLGGVAVIKVGAHTELELEDRKLRIEDAKNATFAAISEG  456

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I++++ED DE++GADIV KAL+ PA  IA NAG++G++VV+K
Sbjct  457  IVPGGGATYVHLLDLIPTIRNSMEDLDEQIGADIVAKALIEPAKSIATNAGIDGDIVVQK  516

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  DW  GYNAMT  YE+L+ AGV DP++V RCALQ++ SVAG+VLTTQAI+V+
Sbjct  517  TRTHDWRTGYNAMTGIYEDLLNAGVADPSRVARCALQSAVSVAGVVLTTQAILVD  571



>ref|XP_006605502.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=485

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 187/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KV IT + TTIIAD + K EIQ+RI+Q+K
Sbjct  234  DIALMTGADFLSGDLGLTLDCATSDQLGTALKVRITCNETTIIADPSLKAEIQARISQIK  293

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  294  KDLSETDNANLSRKLSERIAKLSGGVAVIKVGAHTELELEDRKLRIEDAKNATFAAISEG  353

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I++++ED DE++GADIV KAL+ PA  IA NAGV+G++VV K
Sbjct  354  IVPGGGATYVHLLDLIPTIRNSMEDLDEQIGADIVAKALLEPAKSIATNAGVDGDIVVRK  413

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R  DW  GYNAMT +YE+L+ AGV DP++V RCALQ++ SVAG++LTTQAI+
Sbjct  414  TRTHDWRTGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSVAGVILTTQAIL  466



>ref|XP_008361665.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Malus domestica]
Length=645

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 204/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LGIARKV IT +STTI+AD ++K EIQ+RI Q+K
Sbjct  393  DIALMTGADFLSGDFGLTLESATSDQLGIARKVKITSNSTTIVADPSTKAEIQARILQIK  452

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA+EEG
Sbjct  453  KDLAETENANLSRKLSERIAKLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEG  512

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P+IKD++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  513  VVPGGGATYVHLSEFIPSIKDSMEDLDEQIGADLVAKALLAPAKAIATNAGDDGEVVVEK  572

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAMT +YE+L + GVIDP +V+RCALQ + S+AG+VLTTQA++VEK K K
Sbjct  573  TKSSDWRVGYNAMTGNYEDLPDGGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTKTK  632

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  633  KPAVPFVPGIT  643



>ref|XP_008670053.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X2 [Zea mays]
Length=520

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 184/235 (78%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  +     + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  260  DIAIMTGADFFASDLGWGLHGITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  319

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GV VIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  320  KDLEETTSSYLKERFSARIAKLSRGVGVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  379

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +VHLS ++P+I D ++D +EK+G +IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  380  ITPGGGVTYVHLSKHIPSIMDLVDDTEEKMGVNIVGKALLVPAMTIARNAGADGPAVVEK  439

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMTD +E+LV AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  440  LLASEWRVGYNAMTDEFEDLVAAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  494



>ref|XP_010540667.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=467

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLG+ +     + LGIAR+VTIT  STTI+AD ++K EIQ+RIAQ+K
Sbjct  216  DIALMTGADFIAGDLGMTLMEATSDQLGIARRVTITSKSTTIVADPSTKGEIQARIAQMK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S K+AERIA+L+GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  276  KDLAETDSSYLSRKIAERIARLTGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  335

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I+PGGGAA++HL   +P IK+ +ED+DE++G D+V KAL APA  IA NAGV+G VVVEK
Sbjct  336  ILPGGGAAYIHLLDEIPIIKNQMEDSDEQMGVDVVAKALTAPAMAIAANAGVDGSVVVEK  395

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  +W  GYNAM+  +ENL+E+GV DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  396  TRALEWRNGYNAMSGRFENLLESGVADPCRVSRFALQNAVSVAGVVLTTQAVLVE  450



>ref|XP_010420658.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=469

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  216  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  276  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  335

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HLS  +P I K+ LED  E++GADIV  AL APA  IA NAGV G VVVE
Sbjct  336  IVPGGGATYIHLSDEIPRIKKNLLEDLYEQIGADIVATALTAPAMAIATNAGVGGLVVVE  395

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  396  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  451



>gb|KJB83860.1| hypothetical protein B456_013G268400 [Gossypium raimondii]
Length=498

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QA+DLGLL+ENT VE LGIARKV ITKDST IIADAASKDEIQ+R+ QLK
Sbjct  335  DIAILTGAEFQANDLGLLIENTSVEQLGIARKVIITKDSTQIIADAASKDEIQARVQQLK  394

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL ETDS+YD+EKLAERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  395  KELAETDSVYDTEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEG  454

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQK  407
            IVPGGGAA VHLST VPAIKD LED++E++GADIVQK
Sbjct  455  IVPGGGAALVHLSTCVPAIKDKLEDSEERIGADIVQK  491



>ref|XP_010454134.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=469

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  216  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  276  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  335

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P I KD LED+ E++GADIV  AL APA  IA NAGV+G VVVE
Sbjct  336  IVPGGGATYIHLLDEIPIIKKDILEDSYEQIGADIVATALTAPAMAIATNAGVDGLVVVE  395

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  396  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  451



>ref|XP_010238509.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X2 [Brachypodium distachyon]
Length=478

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 187/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++  SDLG  ++    + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  220  DIAIMTGADFFVSDLGWGLQAITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  279

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GVAVIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  280  KDLEETTSAYLKERFSARIAKLSRGVAVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  339

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +V LS ++P+I D ++D +EK+G +IV KAL+ PA +IA+NAG +G  +VEK
Sbjct  340  IAPGGGVTYVQLSKHIPSIMDLVDDPEEKIGVNIVGKALLVPAMMIARNAGADGSAIVEK  399

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +W VGYNAMTD +E+LV+AGV+DP +V RC LQNSAS++G++L TQA++ +
Sbjct  400  LLESEWRVGYNAMTDKFEDLVDAGVVDPCRVARCVLQNSASISGLILMTQAMMFD  454



>ref|XP_008670052.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Zea mays]
 tpg|DAA39656.1| TPA: hypothetical protein ZEAMMB73_693223 [Zea mays]
Length=585

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 184/235 (78%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  +     + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  325  DIAIMTGADFFASDLGWGLHGITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GV VIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  385  KDLEETTSSYLKERFSARIAKLSRGVGVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +VHLS ++P+I D ++D +EK+G +IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  445  ITPGGGVTYVHLSKHIPSIMDLVDDTEEKMGVNIVGKALLVPAMTIARNAGADGPAVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMTD +E+LV AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  505  LLASEWRVGYNAMTDEFEDLVAAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  559



>ref|XP_008378826.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Malus domestica]
Length=588

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 203/251 (81%), Gaps = 0/251 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + D GL +E+   + LGIARKV IT +STTI+AD ++K EIQ+RI Q+K
Sbjct  336  DIALMTGADFLSGDFGLTLESATSDQLGIARKVKITSNSTTIVADPSTKAEIQARILQIK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET++   S KL+ERIAKL GGVAVIKVGA TE ELEDRKLRIEDAKN TFAA+EEG
Sbjct  396  KDLAETENAXLSRKLSERIAKLCGGVAVIKVGAHTEXELEDRKLRIEDAKNXTFAAMEEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            +VPGGGA +VHLS ++P IK+++ED DE++GAD+V KAL+APA  IA NAG +GEVVVEK
Sbjct  456  VVPGGGATYVHLSEFIPXIKNSMEDLDEQIGADLVAKALLAPAKAIATNAGDDGEVVVEK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVEkpkpk  158
             +  DW VGYNAMT +YE+L +AGVIDP +V+RCALQ +AS+AG+ LTTQA++VEK K K
Sbjct  516  TKSSDWRVGYNAMTGNYEDLPDAGVIDPCRVSRCALQIAASIAGVXLTTQAVLVEKTKKK  575

Query  157  tpapaaPQGLT  125
             PA     G+T
Sbjct  576  KPAVPFVPGIT  586



>ref|XP_003528549.2| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN42989.1| Chaperonin 60 subunit alpha 2, chloroplastic [Glycine soja]
Length=587

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KVTIT ++TTIIAD + K EIQ+RI+Q+K
Sbjct  336  DIALMTGADFLSGDLGLTLDGATSDQLGTALKVTITSNATTIIADPSMKAEIQARISQIK  395

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGG+AVIKVGA TE ELEDRKLRI+DAKNATFAAI EG
Sbjct  396  KDLSETDNANLSRKLSERIAKLSGGIAVIKVGAHTEVELEDRKLRIDDAKNATFAAISEG  455

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I +++ED +E++GADIV KAL+ PA  IA NAGV+G++VV+K
Sbjct  456  IVPGGGATYVHLLDLIPTIMNSMEDLEEQIGADIVAKALLEPAKSIATNAGVDGDIVVQK  515

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +R  DW +GYNAMT +YE+L+ AGV DP++V RCALQ++ SVAG VLTTQAI+V+
Sbjct  516  IRTHDWRIGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSVAGAVLTTQAILVD  570



>ref|NP_197383.1| protein CHAPERONIN-60ALPHA2 [Arabidopsis thaliana]
 sp|Q56XV8.1|CPNA2_ARATH RecName: Full=Chaperonin 60 subunit alpha 2, chloroplastic; Short=CPN-60 
alpha 2; AltName: Full=Protein EMBRYO DEFECTIVE 
3007; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD94998.1| chaperonin 60 alpha chain - like protein [Arabidopsis thaliana]
 gb|AED92616.1| TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana]
Length=575

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+ADA++K EIQ+RIAQ+K
Sbjct  322  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVVITANSTTIVADASTKPEIQARIAQMK  381

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  382  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  441

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P IK  L ED+ E++GADIV  AL APA  IA NAGV+G VVV+
Sbjct  442  IVPGGGATYIHLLDEIPRIKKNLMEDSYEQIGADIVAMALTAPAMAIATNAGVDGSVVVQ  501

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ AG+ DP +V+R ALQN+ SVAG++LTTQA++VE
Sbjct  502  KTRELEWRSGYNAMSGKYEDLLNAGIADPCRVSRFALQNAVSVAGIILTTQAVLVE  557



>ref|XP_004956159.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
[Setaria italica]
Length=587

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 184/235 (78%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  +     + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  327  DIAIMTGADFFASDLGWGLHGITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  386

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K++ ET S Y  E+ + RIAKLS GV VIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  387  KDVEETTSSYLRERFSARIAKLSRGVGVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  446

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +VHLS ++P+I D ++D +EK+G +IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  447  ITPGGGVTYVHLSKHIPSIMDLVDDPEEKMGVNIVGKALLVPAMTIARNAGADGSAVVEK  506

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMTD +E+LV AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  507  LLASEWRVGYNAMTDKFEDLVTAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  561



>ref|XP_002459819.1| hypothetical protein SORBIDRAFT_02g011260 [Sorghum bicolor]
 gb|EER96340.1| hypothetical protein SORBIDRAFT_02g011260 [Sorghum bicolor]
Length=585

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 184/235 (78%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  +     + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  325  DIAIMTGADFFASDLGWGLHGITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GV VIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  385  KDLEETTSSYLKERFSARIAKLSRGVGVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +VHLS ++P+I D ++DA+EK+G +IV KAL+ PA  IA+NAG EG  VVEK
Sbjct  445  ITPGGGVTYVHLSKHIPSIMDLVDDAEEKMGVNIVGKALLVPAMTIARNAGAEGPAVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMT  +E+LV AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  505  LLASEWRVGYNAMTGEFEDLVAAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  559



>ref|XP_003556668.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN08052.1| Chaperonin 60 subunit alpha 2, chloroplastic [Glycine soja]
Length=589

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 187/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ + DLGL ++    + LG A KV IT + TTIIAD + K EIQ+RI+Q+K
Sbjct  338  DIALMTGADFLSGDLGLTLDCATSDQLGTALKVRITCNETTIIADPSLKAEIQARISQIK  397

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+   S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAAI EG
Sbjct  398  KDLSETDNANLSRKLSERIAKLSGGVAVIKVGAHTELELEDRKLRIEDAKNATFAAISEG  457

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL   +P I++++ED DE++GADIV KAL+ PA  IA NAGV+G++VV K
Sbjct  458  IVPGGGATYVHLLDLIPTIRNSMEDLDEQIGADIVAKALLEPAKSIATNAGVDGDIVVRK  517

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R  DW  GYNAMT +YE+L+ AGV DP++V RCALQ++ SVAG++LTTQAI+
Sbjct  518  TRTHDWRTGYNAMTGTYEDLLNAGVADPSRVARCALQSAVSVAGVILTTQAIL  570



>ref|XP_010540666.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=576

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA++ A DLG+ +     + LGIAR+VTIT  STTI+AD ++K EIQ+RIAQ+K
Sbjct  325  DIALMTGADFIAGDLGMTLMEATSDQLGIARRVTITSKSTTIVADPSTKGEIQARIAQMK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS Y S K+AERIA+L+GGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  385  KDLAETDSSYLSRKIAERIARLTGGVAVIKVGAHTETELEDRKLRIEDAKNATFAAMDEG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I+PGGGAA++HL   +P IK+ +ED+DE++G D+V KAL APA  IA NAGV+G VVVEK
Sbjct  445  ILPGGGAAYIHLLDEIPIIKNQMEDSDEQMGVDVVAKALTAPAMAIAANAGVDGSVVVEK  504

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
             R  +W  GYNAM+  +ENL+E+GV DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  505  TRALEWRNGYNAMSGRFENLLESGVADPCRVSRFALQNAVSVAGVVLTTQAVLVE  559



>ref|XP_002871843.1| EMB3007 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48102.1| EMB3007 [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+ADA++K EIQ+RIAQ+K
Sbjct  322  DIALMTGADYLSGDLGMTLMGATSDQLGVSRRVLITANSTTIVADASTKPEIQARIAQMK  381

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  382  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  441

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P IK  L ED+ E++GADIV  AL AP   IA NAGV+G VVV+
Sbjct  442  IVPGGGATYIHLLDEIPRIKKNLMEDSYEQIGADIVAMALTAPTMAIATNAGVDGSVVVQ  501

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ AG+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  502  KTRELEWRSGYNAMSGKYEDLLNAGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  557



>gb|EMS58993.1| RuBisCO large subunit-binding protein subunit alpha, chloroplastic 
[Triticum urartu]
Length=546

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++  SDLG  ++    + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  288  DIAIMTGADFFVSDLGWGLQAITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  347

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GVAVIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  348  KDLEETTSAYLKERFSARIAKLSRGVAVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  407

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +V LS ++P+I D ++D +EK+G  IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  408  ITPGGGVTYVELSKHIPSIMDLVDDPEEKIGVTIVGKALLVPAMTIARNAGADGSAVVEK  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +W VGYNAMTD +E+LVEAGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  468  ILESEWRVGYNAMTDKFEDLVEAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  522



>ref|XP_010420657.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=576

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  323  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  382

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  383  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  442

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HLS  +P I K+ LED  E++GADIV  AL APA  IA NAGV G VVVE
Sbjct  443  IVPGGGATYIHLSDEIPRIKKNLLEDLYEQIGADIVATALTAPAMAIATNAGVGGLVVVE  502

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  503  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  558



>ref|WP_045871448.1| molecular chaperone GroEL [Tolypothrix sp. PCC 7601]
 gb|EKF00980.1| chaperonin GroL [Tolypothrix sp. PCC 7601]
Length=558

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 189/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +EALG ARK+TI K++TTI+A + +K EIQ RI Q++
Sbjct  289  DIAILTDGQMISEEIGLSLDTAAIEALGTARKITIDKENTTIVAGSTTKPEIQKRIGQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLEETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+T V AIK++LED +EK+GADI+ +AL AP   IA NAGVEG V+V +
Sbjct  409  IVPGGGTTLIHLATKVEAIKNSLEDNEEKIGADIIGRALEAPLRQIADNAGVEGSVIVSR  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ D  VGYNA T  +E+L+ AG+IDPAKV R ALQN+AS+AG+VLTT+A+VVE
Sbjct  469  VKETDINVGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEALVVE  523



>ref|XP_006287368.1| hypothetical protein CARUB_v10000568mg [Capsella rubella]
 gb|EOA20266.1| hypothetical protein CARUB_v10000568mg [Capsella rubella]
Length=576

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 189/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  323  DIALMTGADYLSGDLGMTLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  382

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVA+IKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  383  KDLAETDNSYLSKKIAERIAKLTGGVAIIKVGGHTETELEDRKLRIEDAKNATFAAMREG  442

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P I K+ L+D+ EK+GADIV  AL APA  IA NAGV+G VVVE
Sbjct  443  IVPGGGATYIHLLDEIPRIKKNLLKDSYEKIGADIVATALTAPAMAIATNAGVDGLVVVE  502

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+  W  GYNAMT  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  503  KTRELKWRSGYNAMTGKYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  558



>ref|XP_010454133.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=576

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  323  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  382

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  383  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  442

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P I KD LED+ E++GADIV  AL APA  IA NAGV+G VVVE
Sbjct  443  IVPGGGATYIHLLDEIPIIKKDILEDSYEQIGADIVATALTAPAMAIATNAGVDGLVVVE  502

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  503  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  558



>ref|XP_010238508.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha-like 
isoform X1 [Brachypodium distachyon]
Length=590

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 187/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++  SDLG  ++    + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  332  DIAIMTGADFFVSDLGWGLQAITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GVAVIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  392  KDLEETTSAYLKERFSARIAKLSRGVAVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +V LS ++P+I D ++D +EK+G +IV KAL+ PA +IA+NAG +G  +VEK
Sbjct  452  IAPGGGVTYVQLSKHIPSIMDLVDDPEEKIGVNIVGKALLVPAMMIARNAGADGSAIVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +W VGYNAMTD +E+LV+AGV+DP +V RC LQNSAS++G++L TQA++ +
Sbjct  512  LLESEWRVGYNAMTDKFEDLVDAGVVDPCRVARCVLQNSASISGLILMTQAMMFD  566



>ref|XP_010492919.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X2 [Camelina sativa]
Length=469

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  216  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  275

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  276  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  335

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P I K+ LED+ E++GADIV  AL APA  IA NAGV+G VVVE
Sbjct  336  IVPGGGATYIHLLDEIPRIKKNILEDSYEQIGADIVATALTAPAMAIATNAGVDGLVVVE  395

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++V+
Sbjct  396  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVD  451



>gb|EMT23232.1| putative RuBisCO large subunit-binding protein subunit alpha, 
chloroplastic [Aegilops tauschii]
Length=590

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 186/235 (79%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++  SDLG  ++    + LG+A+K+TIT +STTIIA  + + EI++RI QLK
Sbjct  332  DIAIMTGADFFVSDLGWGLQAITSDQLGMAQKITITSESTTIIAHPSMRPEIEARIMQLK  391

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS GVAVIKVGAATEAELEDRKLR+EDAKNATFAAI EG
Sbjct  392  KDLEETTSTYLKERFSARIAKLSRGVAVIKVGAATEAELEDRKLRVEDAKNATFAAISEG  451

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +V LS ++P+I D ++D +EK+G +IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  452  ITPGGGVTYVELSKHIPSIMDLVDDPEEKIGVNIVGKALLVPAMTIARNAGADGSAVVEK  511

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            + + +W VGYNAMTD +E+LV+AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  512  ILESEWRVGYNAMTDKFEDLVDAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  566



>gb|AGV54615.1| RuBisCO large subunit-binding protein subunit alpha [Phaseolus 
vulgaris]
Length=584

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 176/233 (76%), Gaps = 0/233 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGAE+QASDLG+LVE+T  + LG A ++TI +DS   I DAA+K E+ +RIAQLK
Sbjct  333  DIAILTGAEFQASDLGVLVESTPGQQLGFAMRITIQQDSILSIGDAATKGELPARIAQLK  392

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            KEL +TDS+YD EKLAERIAKL GGVAVIKVG ATE ELEDRKLRIEDAKNATFAAIEEG
Sbjct  393  KELSQTDSVYDFEKLAERIAKLFGGVAVIKVGGATETELEDRKLRIEDAKNATFAAIEEG  452

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IV GGG A VHLS  VPAIK+ LE A E+LG  IVQK L AP +L++Q  G+E EV + K
Sbjct  453  IVSGGGTALVHLSPLVPAIKEKLEGAGERLGGGIVQKGLGAPGALVSQKGGIEREVFLGK  512

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
            ++  +  VG+  + D + N V AGV  PA+V+R ALQ  ASV G  L   A++
Sbjct  513  IKKGERGVGFKCLGDRFGNFVGAGVFGPAQVSRGALQKGASVGGKGLAPPALL  565



>ref|XP_010492918.1| PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform 
X1 [Camelina sativa]
Length=576

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG++R+V IT +STTI+AD ++K EIQ+RIAQ+K
Sbjct  323  DIALMTGADYLSGDLGMSLMGATSDQLGVSRRVIITANSTTIVADDSTKPEIQARIAQMK  382

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S+K+AERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  383  KDLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  442

Query  517  IVPGGGAAFVHLSTYVPAI-KDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGA ++HL   +P I K+ LED+ E++GADIV  AL APA  IA NAGV+G VVVE
Sbjct  443  IVPGGGATYIHLLDEIPRIKKNILEDSYEQIGADIVATALTAPAMAIATNAGVDGLVVVE  502

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  YE+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++V+
Sbjct  503  KTRELEWRSGYNAMSGRYEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVD  558



>gb|KDO77361.1| hypothetical protein CISIN_1g007834mg [Citrus sinensis]
Length=582

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 183/233 (79%), Gaps = 6/233 (3%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TG      +LGL +     + LGIARKVT+  +STTI+AD  +K EIQ+RI Q+K
Sbjct  337  DIALMTG------ELGLTLAGATSDQLGIARKVTVKSNSTTIVADPYTKAEIQARIMQIK  390

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L  TD+ Y S KL+ERIAKLSGGVAVIKVGA TE ELEDRKLRIEDAKNATFAA++EG
Sbjct  391  KDLAATDNAYLSRKLSERIAKLSGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMDEG  450

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA +VHL  ++P IK+++ED DE++GADIV KAL+ PA  IA NAGV+G +VVEK
Sbjct  451  IVPGGGATYVHLLEHIPIIKNSMEDPDEQIGADIVAKALIVPAISIATNAGVDGTIVVEK  510

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIV  179
             R  DW  GYNAMT  YE+L+ AGV DP +V RCALQN+ S+A +VLTT+A++
Sbjct  511  TRTSDWRFGYNAMTGRYEDLLSAGVADPCRVARCALQNAVSIAAVVLTTEAVL  563



>ref|XP_006400437.1| hypothetical protein EUTSA_v10013085mg [Eutrema salsugineum]
 gb|ESQ41890.1| hypothetical protein EUTSA_v10013085mg [Eutrema salsugineum]
Length=578

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TGA+Y + DLG+ +     + LG+ARKV IT +STTI+ADA++K EIQ+RIAQ+K
Sbjct  325  DIALMTGADYLSGDLGMTLMGATSDQLGVARKVIITANSTTIVADASTKPEIQARIAQMK  384

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETD+ Y S K++ERIAKL+GGVAVIKVG  TE ELEDRKLRIEDAKNATFAA+ EG
Sbjct  385  KDLAETDNSYLSRKISERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREG  444

Query  517  IVPGGGAAFVHLSTYVPAIKDTL-EDADEKLGADIVQKALVAPASLIAQNAgvegevvve  341
            IVPGGGAA++HL   +  IK  L +D+ E++GADIV  AL APA  IA NAGV+G  VVE
Sbjct  445  IVPGGGAAYIHLVDEIARIKKNLMKDSYEQIGADIVATALTAPAMAIATNAGVDGSGVVE  504

Query  340  kvrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            K R+ +W  GYNAM+  +E+L+ +G+ DP +V+R ALQN+ SVAG+VLTTQA++VE
Sbjct  505  KTRELEWRSGYNAMSGRFEDLLNSGIADPCRVSRFALQNAVSVAGIVLTTQAVLVE  560



>ref|WP_015127399.1| molecular chaperone GroEL [Calothrix sp. PCC 7507]
 gb|AFY31577.1| 60 kDa chaperonin [Calothrix sp. PCC 7507]
Length=559

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +EALG A K+TI K+STTI+A   +K EIQ RIAQ++
Sbjct  289  DIAILTDGQLISEEIGLSLDTAALEALGTASKITIDKESTTIVAGTNTKPEIQKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GG+AVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLEETDSDYDQEKLQERIAKLAGGIAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+T + AIK++L+D++EK+GA+I+++AL AP   IA NAG EG V+V K
Sbjct  409  IVPGGGTTLIHLATKIQAIKNSLKDSEEKIGAEIIERALEAPLRQIADNAGAEGSVIVSK  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VRD D+ +GYNA T  +E+L+ AG+IDPAKV R ALQN+AS+AG+VLTT+A++VE
Sbjct  469  VRDTDFNIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEALIVE  523



>ref|WP_041643235.1| molecular chaperone GroEL [Trichormus azollae]
Length=568

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   VE LG ARKVTI K+STTI++  ++K E+Q RIAQ++
Sbjct  289  DIAILTDGQMISEEIGLSLDTATVEMLGTARKVTIDKESTTIVSGTSTKLEVQKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YDS+KL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLQETDSDYDSQKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+T + AIK++L +A+EK+GA+IVQ+AL  P   IA NAG EG V+V +
Sbjct  409  IVPGGGTTLIHLATKIDAIKNSL-NAEEKIGAEIVQRALEEPLKQIADNAGAEGSVIVCR  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ D  +GYNA T  +E+L+ AG+IDPAKV R ALQN+AS+AGMVLTT+AIVVE
Sbjct  468  VKETDINIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGMVLTTEAIVVE  522



>gb|ADI64918.1| chaperonin GroEL ['Nostoc azollae' 0708]
Length=576

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   VE LG ARKVTI K+STTI++  ++K E+Q RIAQ++
Sbjct  297  DIAILTDGQMISEEIGLSLDTATVEMLGTARKVTIDKESTTIVSGTSTKLEVQKRIAQIR  356

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YDS+KL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  357  KQLQETDSDYDSQKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  416

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+T + AIK++L +A+EK+GA+IVQ+AL  P   IA NAG EG V+V +
Sbjct  417  IVPGGGTTLIHLATKIDAIKNSL-NAEEKIGAEIVQRALEEPLKQIADNAGAEGSVIVCR  475

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ D  +GYNA T  +E+L+ AG+IDPAKV R ALQN+AS+AGMVLTT+AIVVE
Sbjct  476  VKETDINIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGMVLTTEAIVVE  530



>ref|WP_011610149.1| molecular chaperone GroEL [Trichodesmium erythraeum]
 sp|Q119S1.1|CH601_TRIEI RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 
1; AltName: Full=Protein Cpn60 1 [Trichodesmium erythraeum 
IMS101]
 gb|ABG49753.1| chaperonin GroEL [Trichodesmium erythraeum IMS101]
Length=561

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TG +  + ++GL +E   ++ +GI RK++I KD+TTI+AD  + +E++ RIAQ++
Sbjct  289  DIAILTGGQLISEEVGLSLEMVDLDMMGIGRKISINKDNTTIVADGGTAEEVKKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L E+DS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLGESDSDYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HLST V  +K +L + +EK+GADIV++AL AP + IA N+GVEG V+VEK
Sbjct  409  IVPGGGTTLIHLSTKVEELKGSLNNEEEKIGADIVRRALEAPLNQIANNSGVEGSVIVEK  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR  D+ VGYN +T  YE+L+ AG++DPA V R ALQN+ S+AGMVLTT+A+VVE
Sbjct  469  VRSTDFSVGYNVITGEYEDLIAAGILDPAMVVRSALQNAGSIAGMVLTTEAVVVE  523



>ref|WP_012407975.1| molecular chaperone GroEL [Nostoc punctiforme]
 gb|ACC79954.1| chaperonin GroEL [Nostoc punctiforme PCC 73102]
Length=560

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 187/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +EALG ARK+TI K+STTI+A + +K E+Q RI Q++
Sbjct  289  DIAILTDGQLISEEIGLSLDTAALEALGTARKITIDKESTTIVAGSVTKPEVQKRIGQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            ++L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  RQLEETDSEYDQEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+  V AIK TL++ +E++GADIV++AL AP   IA NAG EG V+V K
Sbjct  409  IVPGGGTTLIHLAKAVEAIKKTLQNDEERIGADIVERALEAPLRQIADNAGAEGSVIVSK  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VRD ++ +GYNA T  +E+L+ AG+IDPAKV R ALQN+ S+AG+VLTT+AIVVE
Sbjct  469  VRDSEFNIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAGSIAGLVLTTEAIVVE  523



>ref|WP_036001242.1| molecular chaperone GroEL [Leptolyngbya sp. JSC-1]
Length=558

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TG +  + D+GL ++   +E LG ARKVTITKD+TTI+A+A  K  +++RIAQ++
Sbjct  289  DIAVLTGGQMISEDIGLSLDMATLETLGNARKVTITKDTTTIVAEAPDKHALETRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            +EL ETDS YDSEKL ER+A+L GGVAVIKVGAATE EL+DRKLR+EDA NAT AA+EEG
Sbjct  349  RELAETDSEYDSEKLQERLARLVGGVAVIKVGAATETELKDRKLRLEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+  +   K TL D DE++GADIV +AL AP   IA+NAGVEG VVVEK
Sbjct  409  IVPGGGTTLLHLAQKMQDFKQTL-DTDEQIGADIVIRALEAPLRQIAENAGVEGSVVVEK  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V+  D+  GYNA+T+ +E+LV AG+IDPAKV R ALQ++AS+AGMV+TT+A+VVE
Sbjct  468  VKAMDFNHGYNALTNQFEDLVAAGIIDPAKVVRSALQDAASIAGMVITTEALVVE  522



>ref|WP_015219170.1| molecular chaperone GroEL [Cyanobacterium aponinum]
 gb|AFZ53441.1| 60 kDa chaperonin [Cyanobacterium aponinum PCC 10605]
Length=555

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TG    + ++GL ++ T ++ LG ARK+TI KD+T I+AD  +K EI+ R+AQ++
Sbjct  289  DIAILTGGRLISEEIGLSLDTTNLDDLGKARKITIEKDNTIIVADGENKAEIEKRVAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD+EKL ERIAKL+GGVAVIKVGAATE EL++RKLRIEDA NAT AA++EG
Sbjct  349  KQLEETDSEYDTEKLQERIAKLAGGVAVIKVGAATETELKERKLRIEDALNATKAAVDEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGGA+ +HLS  V  ++D+L   +EK+GADIV +A+ AP + IA+NAGVEG +VV K
Sbjct  409  IVPGGGASLIHLSPKVAELRDSLTIEEEKIGADIVLRAIQAPLAQIAKNAGVEGAIVVAK  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            V++ D  +GYNA+T  YE+L+ +G+IDPAKV R +LQN+AS+AG+VLTT+A+VVE
Sbjct  469  VQESDANIGYNALTGQYEDLIASGIIDPAKVVRTSLQNAASIAGLVLTTEALVVE  523



>ref|WP_017652866.1| molecular chaperone GroEL [Microchaete sp. PCC 7126]
Length=557

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +EALG AR++TI K++TTI+A  +++ EI+ RIAQ++
Sbjct  289  DIAILTDGQLISEEIGLSLDTASIEALGTARQITIDKENTTIVAGTSTQPEIEKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L +TDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLEDTDSDYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+  V AIK++L D++EK+GADIV +AL AP   IA NAG EG V+V +
Sbjct  409  IVPGGGTTLIHLAKKVEAIKNSLHDSEEKIGADIVGRALEAPLRQIADNAGAEGAVIVSR  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVV  176
            V+D D  VGYNA T  +E+L+ AG+IDPAKV R ALQN+AS+AG+VLTT+A+VV
Sbjct  469  VKDSDLSVGYNAATGKFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEALVV  522



>ref|WP_015221313.1| chaperonin GroEL [Cyanobacterium stanieri]
 gb|AFZ45993.1| chaperonin GroEL [Cyanobacterium stanieri PCC 7202]
Length=554

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TG    + D+GL ++  +++ LG ARK++I KD+TTI+AD+ +  ++Q R+AQ++
Sbjct  289  DIAILTGGRVISEDIGLSLDTVKLDELGKARKISIEKDNTTIVADSGNSADVQKRVAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            ++L ETDS YD+EKL ERIAKL+GGVAVIKVGAATE +L++RKLRIEDA +AT AA+EEG
Sbjct  349  QQLAETDSEYDAEKLQERIAKLAGGVAVIKVGAATETDLKERKLRIEDALSATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG+  +H+++ + A KDTL +A+EK+G DIV KAL AP   IA NAGVEG VVVEK
Sbjct  409  IVPGGGSTLIHMASKISAFKDTLTNAEEKVGVDIVLKALEAPLRQIATNAGVEGSVVVEK  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+    +GYNA+T  YE+L+  G++DPAKV R +LQN+AS+AGMVLTT+A+VVE
Sbjct  469  VRESAQNIGYNALTGVYEDLIATGIVDPAKVVRSSLQNAASIAGMVLTTEALVVE  523



>dbj|BAG90839.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 186/235 (79%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+TGA++ ASDLG  ++    + LG+A+K+TIT D+TTIIA  + + EI++RI QLK
Sbjct  99   DIAIMTGADFFASDLGWCLQGATSDQLGMAQKITITSDTTTIIAHPSMRPEIEARIQQLK  158

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ET S Y  E+ + RIAKLS G+AVIKVGAATEAELEDRKLR EDAKNATFAAI EG
Sbjct  159  KDLEETTSAYLKERFSSRIAKLSRGIAVIKVGAATEAELEDRKLRAEDAKNATFAAISEG  218

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            I PGGG  +V LS Y+P+I D ++D++EK+G +IV KAL+ PA  IA+NAG +G  VVEK
Sbjct  219  ITPGGGVTYVQLSKYIPSIMDLVDDSEEKIGVNIVGKALLVPAMTIARNAGADGPAVVEK  278

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            +   +W VGYNAMTD +E+LV+AGV+DP +V RC LQNSAS+AG++L TQA++ +
Sbjct  279  LLASEWRVGYNAMTDKFEDLVDAGVVDPCRVARCVLQNSASIAGLILMTQAMMFD  333



>ref|WP_006278498.1| molecular chaperone GroEL [Cylindrospermopsis raciborskii]
 gb|EFA68659.1| Chaperonin Cpn60/TCP-1 [Cylindrospermopsis raciborskii CS-505]
Length=561

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 188/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +E LG ARK+TI K++TTI++ + +K EIQ RIAQ++
Sbjct  296  DIAILTDGQMISEEIGLSLDTATLEMLGKARKITIDKENTTIVSGSENKPEIQKRIAQIR  355

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD+EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  356  KQLEETDSDYDAEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  415

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL   V AIKDTL D +EK+GA+IVQ++L AP   IA NAGVEG V+V +
Sbjct  416  IVPGGGTTLIHLVAKVDAIKDTL-DGEEKIGAEIVQRSLEAPLRQIANNAGVEGSVIVSQ  474

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+ D+ +GYNA T  +E+L+ AG+IDPAKV R +LQN+AS+AGMVLTT+ +VVE
Sbjct  475  VRNSDFNIGYNAATGEFEDLIAAGIIDPAKVVRSSLQNAASIAGMVLTTEVLVVE  529



>ref|WP_015186725.1| molecular chaperone GroEL [Gloeocapsa sp. PCC 7428]
 gb|AFZ28848.1| 60 kDa chaperonin [Gloeocapsa sp. PCC 7428]
Length=549

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TG +  + ++GL +++  +E +G+ARKVTI K++TTI+A   +KD++Q RIAQ++
Sbjct  289  DIAVLTGGQVISEEVGLSLDDASLEMMGVARKVTIDKEATTIVAGGDNKDDVQKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            ++L E+DS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  RQLEESDSEYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HLST V  IK++L D +EK+GADIV+++L AP   +A NAGVEG V+VEK
Sbjct  409  IVPGGGTMLIHLSTKVEDIKNSLND-EEKIGADIVKRSLEAPLRQMADNAGVEGSVIVEK  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+ ++ +GYNA T  +++L+ AG++DPAKV R ALQN+ S+AGMVLTT+A+VVE
Sbjct  468  VRETEFNIGYNAATGEFQDLIAAGILDPAKVVRSALQNAGSIAGMVLTTEALVVE  522



>ref|WP_009343442.1| molecular chaperone GroEL [Raphidiopsis brookii]
 gb|EFA72908.1| Chaperonin Cpn60/TCP-1 [Raphidiopsis brookii D9]
Length=561

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 187/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +E LG ARKVTI K++TTI++   +K EIQ RIAQ++
Sbjct  296  DIAILTDGQMISEEIGLSLDTATLEMLGKARKVTIDKENTTIVSGTENKPEIQKRIAQIR  355

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD+EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  356  KQLEETDSDYDAEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  415

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL   V AIKDTL D +EK+GA+IVQ++L AP   IA NAGVEG V+V +
Sbjct  416  IVPGGGTTLIHLVAKVDAIKDTL-DGEEKIGAEIVQRSLEAPLRQIANNAGVEGSVIVSQ  474

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+ D+ +GYNA T  +E+L+ AG+IDPAKV R +LQN+AS+AGMVLTT+ +VVE
Sbjct  475  VRNSDFNIGYNAATGEFEDLIAAGIIDPAKVVRSSLQNAASIAGMVLTTEVLVVE  529



>ref|WP_041555042.1| molecular chaperone GroEL [Nostoc sp. PCC 7524]
Length=557

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +E LG ARK+TI K++TTI+A +A K E+Q RIAQ++
Sbjct  289  DIAILTDGQMISEEIGLSLDTATLEMLGTARKITIDKENTTIVAGSAVKPEVQKRIAQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLEETDSEYDQEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HLS  V  IK++L D +EK+GADI++++L AP   IA NAG EG V+V +
Sbjct  409  IVPGGGTTLIHLSKKVDEIKNSL-DGEEKIGADIIKRSLEAPLRQIANNAGAEGSVIVSQ  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VRD ++ +GYNA T  +++L+ AG+IDPAKV R ALQN+AS+AGMVLTT+AI+ E
Sbjct  468  VRDSEFNMGYNAATGEFQDLIAAGIIDPAKVVRSALQNAASIAGMVLTTEAIIAE  522



>ref|WP_015111848.1| molecular chaperone GroEL [Nostoc sp. PCC 7107]
 gb|AFY41612.1| 60 kDa chaperonin [Nostoc sp. PCC 7107]
Length=554

 Score =   258 bits (659),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +E LG ARK+TI K++TTI+A + +K EIQ RI Q++
Sbjct  289  DIAILTDGQLISEEIGLSLDTASLENLGTARKITIDKENTTIVAGSTTKPEIQKRIGQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLEETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HLST +  +K +L + +EK+GADIV++AL AP   IA NAG EG V+V K
Sbjct  409  IVPGGGTTLIHLSTKIDELKHSLNE-EEKIGADIVKRALEAPLRQIADNAGDEGSVIVSK  467

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+ ++ VGYNA T  +++L+ AG+IDPAKV R ALQN+AS+AGMVLTT+AIVVE
Sbjct  468  VRETEFNVGYNAATGEFQDLIAAGIIDPAKVVRSALQNAASIAGMVLTTEAIVVE  522



>gb|AFY45941.1| chaperonin GroL [Nostoc sp. PCC 7524]
Length=565

 Score =   258 bits (660),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIAI+T  +  + ++GL ++   +E LG ARK+TI K++TTI+A +A K E+Q RIAQ++
Sbjct  297  DIAILTDGQMISEEIGLSLDTATLEMLGTARKITIDKENTTIVAGSAVKPEVQKRIAQIR  356

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  357  KQLEETDSEYDQEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVEEG  416

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HLS  V  IK++L D +EK+GADI++++L AP   IA NAG EG V+V +
Sbjct  417  IVPGGGTTLIHLSKKVDEIKNSL-DGEEKIGADIIKRSLEAPLRQIANNAGAEGSVIVSQ  475

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VRD ++ +GYNA T  +++L+ AG+IDPAKV R ALQN+AS+AGMVLTT+AI+ E
Sbjct  476  VRDSEFNMGYNAATGEFQDLIAAGIIDPAKVVRSALQNAASIAGMVLTTEAIIAE  530



>ref|WP_015230198.1| chaperonin GroL [Dactylococcopsis salina]
 gb|AFZ51208.1| chaperonin GroL [Dactylococcopsis salina PCC 8305]
Length=559

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -2

Query  877  DIAIVTGAEYQASDLGLLVENTQVEALGIARKVTITKDSTTIIADAASKDEIQSRIAQLK  698
            DIA++TG +  + D+GL +++  ++ LG AR+VTI KDST I+++  +K++++ R+ Q++
Sbjct  289  DIAVLTGGQLVSEDVGLTIDSVSLDMLGTARRVTINKDSTVIVSNGENKNDVEKRVNQIR  348

Query  697  KELFETDSIYDSEKLAERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAIEEG  518
            K+L ETDS YD EKL ERIAKL+GGVAVIKVGAATE EL+DRKLRIEDA NAT AA+EEG
Sbjct  349  KQLAETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATQAAVEEG  408

Query  517  IVPGGGAAFVHLSTYVPAIKDTLEDADEKLGADIVQKALVAPASLIAQNAgvegevvvek  338
            IVPGGG   +HL+  V   K+ L   +EK+GAD+V KAL AP S +A NAG EG VVVE 
Sbjct  409  IVPGGGTTLIHLAAKVAEFKNQLTHPEEKIGADLVGKALEAPLSQMADNAGAEGSVVVEN  468

Query  337  vrdrdweVGYNAMTDSYENLVEAGVIDPAKVTRCALQNSASVAGMVLTTQAIVVE  173
            VR+ ++ VGYNA+T  YE+++ AG+IDPAKV R ALQN+ S+AGM++TT+A+VVE
Sbjct  469  VRETEFNVGYNALTGEYEDMIAAGIIDPAKVIRAALQNAGSIAGMIITTEALVVE  523



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752