BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4249

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618515.1|  PREDICTED: uncharacterized protein LOC104110...    379   3e-122   
ref|XP_009765848.1|  PREDICTED: uncharacterized protein LOC104217...    374   2e-120   Nicotiana sylvestris
ref|XP_009618505.1|  PREDICTED: uncharacterized protein LOC104110...    379   3e-120   Nicotiana tomentosiformis
emb|CAN68801.1|  hypothetical protein VITISV_008808                     357   4e-120   Vitis vinifera
ref|XP_009629701.1|  PREDICTED: uncharacterized protein LOC104119814    377   3e-119   Nicotiana tomentosiformis
ref|XP_009765845.1|  PREDICTED: uncharacterized protein LOC104217...    375   1e-118   Nicotiana sylvestris
gb|KDO84266.1|  hypothetical protein CISIN_1g0017372mg                  359   2e-118   Citrus sinensis [apfelsine]
gb|KDO84264.1|  hypothetical protein CISIN_1g0017372mg                  358   2e-118   Citrus sinensis [apfelsine]
gb|KDO84265.1|  hypothetical protein CISIN_1g0017372mg                  357   2e-118   Citrus sinensis [apfelsine]
ref|XP_009761575.1|  PREDICTED: uncharacterized protein LOC104213728    372   2e-117   Nicotiana sylvestris
ref|XP_004252774.1|  PREDICTED: uncharacterized protein LOC101266203    369   2e-116   Solanum lycopersicum
ref|XP_011083822.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    364   1e-114   
gb|EYU25397.1|  hypothetical protein MIMGU_mgv1a000678mg                364   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_006342611.1|  PREDICTED: uncharacterized protein LOC102601564    364   2e-114   Solanum tuberosum [potatoes]
ref|XP_010664590.1|  PREDICTED: uncharacterized protein LOC100267...    354   2e-113   
ref|XP_011030451.1|  PREDICTED: uncharacterized protein LOC105129897    361   3e-113   Populus euphratica
ref|XP_006374985.1|  hypothetical protein POPTR_0014s03370g             360   4e-113   Populus trichocarpa [western balsam poplar]
gb|KDP38386.1|  hypothetical protein JCGZ_04311                         354   1e-112   Jatropha curcas
gb|KHG22709.1|  putative HTH-type transcriptional regulator ybfP        335   4e-112   Gossypium arboreum [tree cotton]
ref|XP_010098704.1|  hypothetical protein L484_026083                   354   4e-112   
ref|XP_006473361.1|  PREDICTED: uncharacterized protein LOC102621...    357   6e-112   Citrus sinensis [apfelsine]
ref|XP_011074457.1|  PREDICTED: uncharacterized protein LOC105159184    357   7e-112   Sesamum indicum [beniseed]
ref|XP_010664589.1|  PREDICTED: uncharacterized protein LOC100267...    354   1e-111   Vitis vinifera
ref|XP_007017323.1|  Calcineurin-like metallo-phosphoesterase sup...    356   2e-111   Theobroma cacao [chocolate]
ref|XP_006434822.1|  hypothetical protein CICLE_v10000140mg             355   3e-111   
ref|XP_012071694.1|  PREDICTED: uncharacterized protein LOC105633...    354   8e-111   Jatropha curcas
emb|CBI19565.3|  unnamed protein product                                354   8e-111   Vitis vinifera
ref|XP_010664588.1|  PREDICTED: uncharacterized protein LOC100267...    354   1e-110   Vitis vinifera
ref|XP_004238179.1|  PREDICTED: uncharacterized protein LOC101261408    353   2e-110   Solanum lycopersicum
ref|XP_008393833.1|  PREDICTED: uncharacterized protein LOC103455...    351   2e-110   
ref|XP_008383912.1|  PREDICTED: uncharacterized protein LOC103446557    353   2e-110   
ref|XP_011458950.1|  PREDICTED: uncharacterized protein LOC101313...    353   4e-110   Fragaria vesca subsp. vesca
ref|XP_004291134.1|  PREDICTED: uncharacterized protein LOC101313...    353   4e-110   Fragaria vesca subsp. vesca
ref|XP_011458951.1|  PREDICTED: uncharacterized protein LOC101313...    353   4e-110   Fragaria vesca subsp. vesca
ref|XP_009367394.1|  PREDICTED: uncharacterized protein LOC103957048    352   5e-110   
gb|KJB58436.1|  hypothetical protein B456_009G209900                    352   5e-110   Gossypium raimondii
ref|XP_008220172.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    352   6e-110   Prunus mume [ume]
ref|XP_009370173.1|  PREDICTED: uncharacterized protein LOC103959542    352   6e-110   Pyrus x bretschneideri [bai li]
gb|KCW86234.1|  hypothetical protein EUGRSUZ_B02922                     344   8e-110   Eucalyptus grandis [rose gum]
ref|XP_007227027.1|  hypothetical protein PRUPE_ppa000724mg             352   9e-110   Prunus persica
ref|XP_002510264.1|  hydrolase, putative                                350   2e-109   Ricinus communis
ref|XP_008393832.1|  PREDICTED: uncharacterized protein LOC103455...    350   2e-109   
emb|CDP01374.1|  unnamed protein product                                350   4e-109   Coffea canephora [robusta coffee]
ref|XP_004499083.1|  PREDICTED: uncharacterized protein LOC101514142    347   3e-108   Cicer arietinum [garbanzo]
ref|XP_010936846.1|  PREDICTED: uncharacterized protein LOC105056370    347   4e-108   Elaeis guineensis
ref|XP_006595961.1|  PREDICTED: uncharacterized protein LOC100820...    345   4e-108   
ref|XP_010044196.1|  PREDICTED: uncharacterized protein LOC104433...    344   1e-107   
ref|XP_007160825.1|  hypothetical protein PHAVU_001G019800g             345   2e-107   Phaseolus vulgaris [French bean]
ref|XP_003544449.1|  PREDICTED: uncharacterized protein LOC100820...    345   3e-107   Glycine max [soybeans]
ref|XP_010044195.1|  PREDICTED: uncharacterized protein LOC104433...    344   4e-107   Eucalyptus grandis [rose gum]
ref|XP_006601298.1|  PREDICTED: uncharacterized protein LOC100819...    343   6e-107   Glycine max [soybeans]
ref|XP_010275607.1|  PREDICTED: uncharacterized protein LOC104610601    343   7e-107   Nelumbo nucifera [Indian lotus]
emb|CAB44318.1|  putative protein                                       343   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550348.1|  PREDICTED: uncharacterized protein LOC100819...    343   1e-106   Glycine max [soybeans]
emb|CDX94143.1|  BnaC07g37770D                                          343   1e-106   
ref|NP_192917.3|  calcineurin-like phosphoesterase domain-contain...    343   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KHN12760.1|  hypothetical protein glysoja_008723                     343   1e-106   Glycine soja [wild soybean]
ref|XP_010268877.1|  PREDICTED: uncharacterized protein LOC104605707    343   2e-106   Nelumbo nucifera [Indian lotus]
gb|KEH40051.1|  calcineurin-like metallo-phosphoesterase superfam...    342   5e-106   Medicago truncatula
ref|XP_010062120.1|  PREDICTED: uncharacterized protein LOC104449...    342   7e-106   
gb|KEH40052.1|  calcineurin-like metallo-phosphoesterase superfam...    342   8e-106   Medicago truncatula
emb|CDX98782.1|  BnaA03g45670D                                          341   8e-106   
ref|XP_009137306.1|  PREDICTED: uncharacterized protein LOC103861350    341   9e-106   
ref|XP_010062121.1|  PREDICTED: uncharacterized protein LOC104449...    340   1e-105   Eucalyptus grandis [rose gum]
gb|KJB63807.1|  hypothetical protein B456_010G017500                    340   1e-105   Gossypium raimondii
gb|KCW69186.1|  hypothetical protein EUGRSUZ_F02708                     340   1e-105   Eucalyptus grandis [rose gum]
ref|XP_004152730.2|  PREDICTED: uncharacterized protein LOC101204257    340   2e-105   Cucumis sativus [cucumbers]
gb|KHG27255.1|  aat                                                     339   2e-105   Gossypium arboreum [tree cotton]
ref|XP_002874725.1|  predicted protein                                  340   2e-105   
ref|XP_010062116.1|  PREDICTED: uncharacterized protein LOC104449...    341   3e-105   
ref|XP_010455595.1|  PREDICTED: uncharacterized protein LOC104737182    339   4e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006396852.1|  hypothetical protein EUTSA_v10028387mg             339   4e-105   Eutrema salsugineum [saltwater cress]
dbj|BAK04122.1|  predicted protein                                      320   4e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010422134.1|  PREDICTED: uncharacterized protein LOC104707474    339   5e-105   Camelina sativa [gold-of-pleasure]
ref|XP_008444644.1|  PREDICTED: uncharacterized protein LOC103487913    339   6e-105   Cucumis melo [Oriental melon]
ref|XP_008775262.1|  PREDICTED: uncharacterized protein LOC103695663    314   1e-104   Phoenix dactylifera
ref|XP_010434128.1|  PREDICTED: uncharacterized protein LOC104718144    338   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006413590.1|  hypothetical protein EUTSA_v10024304mg             337   2e-104   Eutrema salsugineum [saltwater cress]
emb|CDX86745.1|  BnaA09g21350D                                          336   3e-104   
ref|XP_010540547.1|  PREDICTED: uncharacterized protein LOC104814...    336   5e-104   Tarenaya hassleriana [spider flower]
emb|CDY47423.1|  BnaA02g21590D                                          335   8e-104   Brassica napus [oilseed rape]
ref|XP_010684140.1|  PREDICTED: uncharacterized protein LOC104898734    335   1e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010433955.1|  PREDICTED: uncharacterized protein LOC104718...    333   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009128650.1|  PREDICTED: uncharacterized protein LOC103853501    335   1e-103   Brassica rapa
dbj|BAC81182.1|  unknown protein                                        320   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|NP_194031.5|  calcineurin-like metallo-phosphoesterase family...    335   2e-103   
emb|CDY52938.1|  BnaCnng23820D                                          335   2e-103   Brassica napus [oilseed rape]
ref|NP_001058842.1|  Os07g0134500                                       322   3e-103   
ref|XP_009102715.1|  PREDICTED: uncharacterized protein LOC103828821    334   3e-103   Brassica rapa
ref|XP_006286984.1|  hypothetical protein CARUB_v10000128mg             334   4e-103   Capsella rubella
ref|XP_002869795.1|  hypothetical protein ARALYDRAFT_914305             333   6e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_010433954.1|  PREDICTED: uncharacterized protein LOC104718...    333   7e-103   Camelina sativa [gold-of-pleasure]
dbj|BAJ98692.1|  predicted protein                                      320   9e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009392959.1|  PREDICTED: uncharacterized protein LOC103978...    332   1e-102   
ref|XP_010448789.1|  PREDICTED: uncharacterized protein LOC104731...    330   1e-102   Camelina sativa [gold-of-pleasure]
emb|CDY13280.1|  BnaC09g23760D                                          332   2e-102   Brassica napus [oilseed rape]
ref|XP_010529533.1|  PREDICTED: uncharacterized protein LOC104806367    332   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_009392951.1|  PREDICTED: uncharacterized protein LOC103978...    332   2e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799898.1|  PREDICTED: uncharacterized protein LOC103714...    331   4e-102   Phoenix dactylifera
ref|XP_008799897.1|  PREDICTED: uncharacterized protein LOC103714...    331   6e-102   Phoenix dactylifera
tpg|DAA39654.1|  TPA: hypothetical protein ZEAMMB73_888857              325   7e-102   
ref|XP_010448786.1|  PREDICTED: uncharacterized protein LOC104731...    330   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010932753.1|  PREDICTED: uncharacterized protein LOC105053...    328   1e-101   
ref|XP_009393277.1|  PREDICTED: uncharacterized protein LOC103979011    329   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006285736.1|  hypothetical protein CARUB_v10007209mg             329   3e-101   Capsella rubella
dbj|BAJ98325.1|  predicted protein                                      317   4e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT04291.1|  hypothetical protein F775_31134                         324   4e-101   
ref|XP_004987255.1|  PREDICTED: uncharacterized protein LOC101783...    321   5e-101   
ref|XP_008811244.1|  PREDICTED: uncharacterized protein LOC103722...    326   6e-101   
gb|KFK28866.1|  hypothetical protein AALP_AA7G058700                    328   7e-101   Arabis alpina [alpine rockcress]
ref|XP_010932752.1|  PREDICTED: uncharacterized protein LOC105053...    328   9e-101   Elaeis guineensis
ref|XP_008651926.1|  PREDICTED: uncharacterized protein LOC103631...    322   1e-100   
gb|EEE66522.1|  hypothetical protein OsJ_22999                          323   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657430.1|  PREDICTED: uncharacterized protein LOC102702861    327   2e-100   Oryza brachyantha
ref|XP_004987258.1|  PREDICTED: uncharacterized protein LOC101786...    321   2e-100   
ref|XP_008811243.1|  PREDICTED: uncharacterized protein LOC103722...    326   4e-100   Phoenix dactylifera
ref|XP_002461307.1|  hypothetical protein SORBIDRAFT_02g000620          326   4e-100   Sorghum bicolor [broomcorn]
ref|XP_010538790.1|  PREDICTED: uncharacterized protein LOC104813013    325   5e-100   Tarenaya hassleriana [spider flower]
gb|EMS63037.1|  hypothetical protein TRIUR3_32981                       324   5e-100   Triticum urartu
gb|EEC81473.1|  hypothetical protein OsI_24798                          324   5e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_008651925.1|  PREDICTED: uncharacterized protein LOC103631...    323   1e-99    Zea mays [maize]
ref|XP_010238514.1|  PREDICTED: uncharacterized protein LOC100842...    319   1e-99    
ref|XP_008670049.1|  PREDICTED: uncharacterized protein LOC103647275    325   1e-99    Zea mays [maize]
gb|EPS68439.1|  hypothetical protein M569_06328                         324   2e-99    Genlisea aurea
ref|XP_002461963.1|  hypothetical protein SORBIDRAFT_02g011280          322   5e-99    
ref|XP_008651921.1|  PREDICTED: uncharacterized protein LOC103631...    322   9e-99    
ref|XP_011627911.1|  PREDICTED: uncharacterized protein LOC18446479     322   1e-98    Amborella trichopoda
ref|XP_004987257.1|  PREDICTED: uncharacterized protein LOC101786...    322   2e-98    Setaria italica
gb|ERN18128.1|  hypothetical protein AMTR_s00054p00046250               322   2e-98    Amborella trichopoda
ref|XP_003557697.1|  PREDICTED: uncharacterized protein LOC100823404    321   3e-98    
ref|XP_010238513.1|  PREDICTED: uncharacterized protein LOC100842...    319   8e-98    Brachypodium distachyon [annual false brome]
ref|XP_010238512.1|  PREDICTED: uncharacterized protein LOC100842...    319   8e-98    Brachypodium distachyon [annual false brome]
ref|NP_001058702.1|  Os07g0106000                                       319   1e-97    
ref|XP_004956163.1|  PREDICTED: uncharacterized protein LOC101776542    318   3e-97    Setaria italica
gb|KCW86241.1|  hypothetical protein EUGRSUZ_B02927                     306   1e-92    Eucalyptus grandis [rose gum]
ref|XP_010540555.1|  PREDICTED: uncharacterized protein LOC104814...    305   1e-92    Tarenaya hassleriana [spider flower]
ref|XP_010044199.1|  PREDICTED: uncharacterized protein LOC104433215    305   1e-91    Eucalyptus grandis [rose gum]
ref|XP_004987249.1|  PREDICTED: uncharacterized protein LOC101783...    293   3e-90    
ref|XP_002974647.1|  hypothetical protein SELMODRAFT_102099             298   9e-90    
ref|XP_002963358.1|  hypothetical protein SELMODRAFT_80477              298   9e-90    
ref|XP_001765009.1|  predicted protein                                  290   1e-86    
emb|CDX86747.1|  BnaA09g21370D                                          265   7e-86    
gb|KDO84270.1|  hypothetical protein CISIN_1g0017372mg                  273   3e-85    Citrus sinensis [apfelsine]
gb|KJB58438.1|  hypothetical protein B456_009G209900                    268   3e-79    Gossypium raimondii
gb|KEH40050.1|  calcineurin-like metallo-phosphoesterase superfam...    268   3e-79    Medicago truncatula
gb|KHG27254.1|  aat                                                     268   7e-79    Gossypium arboreum [tree cotton]
ref|XP_010062117.1|  PREDICTED: uncharacterized protein LOC104449...    260   6e-76    
ref|XP_008651923.1|  PREDICTED: uncharacterized protein LOC103631...    257   4e-75    
gb|EMT21375.1|  hypothetical protein F775_01280                         241   1e-70    
ref|XP_001772190.1|  predicted protein                                  240   4e-69    
gb|KCW44765.1|  hypothetical protein EUGRSUZ_L01670                     236   7e-69    Eucalyptus grandis [rose gum]
ref|XP_010040937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    234   2e-66    
gb|KDD72728.1|  hypothetical protein H632_c2969p0                       204   4e-59    Helicosporidium sp. ATCC 50920
ref|XP_011397366.1|  hypothetical protein F751_3196                     185   5e-50    Auxenochlorella protothecoides
ref|XP_002954875.1|  hypothetical protein VOLCADRAFT_65342              183   1e-49    Volvox carteri f. nagariensis
ref|XP_001695554.1|  predicted protein                                  177   2e-48    Chlamydomonas reinhardtii
gb|EMS47321.1|  hypothetical protein TRIUR3_13192                       169   1e-44    Triticum urartu
ref|XP_008877911.1|  hypothetical protein, variant 4                    164   4e-42    Aphanomyces invadans
ref|XP_008877913.1|  hypothetical protein, variant 3                    164   5e-42    Aphanomyces invadans
ref|XP_008877896.1|  hypothetical protein H310_12570                    164   5e-42    Aphanomyces invadans
ref|XP_005651351.1|  hypothetical protein COCSUDRAFT_12255              157   8e-40    Coccomyxa subellipsoidea C-169
ref|XP_009843915.1|  hypothetical protein H257_16986                    155   9e-39    Aphanomyces astaci
gb|KDO31855.1|  hypothetical protein SPRG_03775                         153   4e-38    Saprolegnia parasitica CBS 223.65
ref|XP_008611391.1|  hypothetical protein SDRG_07341                    152   7e-38    Saprolegnia diclina VS20
ref|XP_008877903.1|  hypothetical protein, variant 18                   150   4e-37    Aphanomyces invadans
ref|XP_008877892.1|  hypothetical protein, variant 8                    150   4e-37    Aphanomyces invadans
ref|XP_008877893.1|  hypothetical protein, variant 9                    150   5e-37    Aphanomyces invadans
ref|XP_002909241.1|  conserved hypothetical protein                     144   5e-35    Phytophthora infestans T30-4
gb|ETL46182.1|  hypothetical protein, variant 1                         142   4e-34    Phytophthora parasitica
gb|ETI52906.1|  hypothetical protein, variant 1                         142   4e-34    Phytophthora parasitica P1569
gb|ETL46184.1|  hypothetical protein, variant 3                         141   4e-34    Phytophthora parasitica
gb|ETI52908.1|  hypothetical protein, variant 3                         141   4e-34    Phytophthora parasitica P1569
gb|ETP50694.1|  hypothetical protein, variant 3                         141   4e-34    Phytophthora parasitica P10297
gb|ETL99329.1|  hypothetical protein, variant 3                         141   5e-34    Phytophthora parasitica
gb|ETP50691.1|  hypothetical protein F442_04046                         142   5e-34    Phytophthora parasitica P10297
gb|ETL99327.1|  hypothetical protein, variant 1                         141   5e-34    Phytophthora parasitica
gb|ETL99326.1|  hypothetical protein L917_03802                         142   5e-34    Phytophthora parasitica
gb|ETI52905.1|  hypothetical protein F443_04062                         142   5e-34    Phytophthora parasitica P1569
gb|ETP50692.1|  hypothetical protein, variant 1                         141   5e-34    Phytophthora parasitica P10297
gb|ETL46181.1|  hypothetical protein L916_03887                         142   5e-34    Phytophthora parasitica
ref|XP_008901276.1|  hypothetical protein, variant 3                    140   8e-34    Phytophthora parasitica INRA-310
ref|XP_008901274.1|  hypothetical protein, variant 1                    141   8e-34    Phytophthora parasitica INRA-310
ref|XP_008901271.1|  hypothetical protein PPTG_08104                    141   8e-34    Phytophthora parasitica INRA-310
emb|CCA25522.1|  conserved hypothetical protein                         138   5e-33    Albugo laibachii Nc14
ref|XP_009529340.1|  hypothetical protein PHYSODRAFT_315827             139   5e-33    Phytophthora sojae
gb|ETM52471.1|  hypothetical protein, variant 1                         139   5e-33    Phytophthora parasitica
gb|ETM52473.1|  hypothetical protein, variant 3                         138   5e-33    Phytophthora parasitica
gb|ETM52470.1|  hypothetical protein L914_03906                         138   6e-33    Phytophthora parasitica
gb|ETL46183.1|  hypothetical protein, variant 2                         135   5e-32    Phytophthora parasitica
gb|ETP50693.1|  hypothetical protein, variant 2                         135   5e-32    Phytophthora parasitica P10297
gb|ETL99328.1|  hypothetical protein, variant 2                         135   5e-32    Phytophthora parasitica
gb|ETI52907.1|  hypothetical protein, variant 2                         135   5e-32    Phytophthora parasitica P1569
ref|XP_008901275.1|  hypothetical protein, variant 2                    135   9e-32    Phytophthora parasitica INRA-310
gb|ETM52472.1|  hypothetical protein, variant 2                         132   7e-31    Phytophthora parasitica
emb|CAB45564.1|  hypothetical protein                                   132   1e-30    Arabidopsis thaliana [mouse-ear cress]
gb|KHG25783.1|  hypothetical protein F383_07510                         111   1e-25    Gossypium arboreum [tree cotton]
ref|XP_007017324.1|  Calcineurin-like metallo-phosphoesterase sup...  96.3    5e-25    
gb|KJB58439.1|  hypothetical protein B456_009G209900                    111   1e-23    Gossypium raimondii
gb|EJK61150.1|  hypothetical protein THAOC_18408                      99.4    4e-20    Thalassiosira oceanica
ref|XP_002288749.1|  hypothetical protein THAPSDRAFT_261726           99.8    8e-20    Thalassiosira pseudonana CCMP1335
ref|XP_002783413.1|  hypothetical protein Pmar_PMAR006939             96.3    1e-19    Perkinsus marinus ATCC 50983
gb|KDO84271.1|  hypothetical protein CISIN_1g0017372mg                96.3    1e-19    Citrus sinensis [apfelsine]
ref|XP_012071695.1|  PREDICTED: uncharacterized protein LOC105633...  97.4    5e-19    Jatropha curcas
gb|ETO31334.1|  hypothetical protein RFI_05786                        96.7    7e-19    Reticulomyxa filosa
pir||T05132  hypothetical protein F7H19.190 - Arabidopsis thaliana    94.4    1e-18 
gb|KCW86237.1|  hypothetical protein EUGRSUZ_B02922                   94.0    4e-18    Eucalyptus grandis [rose gum]
gb|KJB58440.1|  hypothetical protein B456_009G209900                  92.8    1e-17    Gossypium raimondii
ref|XP_002778051.1|  hypothetical protein Pmar_PMAR018488             87.0    4e-17    Perkinsus marinus ATCC 50983
ref|XP_002778054.1|  hypothetical protein Pmar_PMAR018491             87.4    5e-17    Perkinsus marinus ATCC 50983
emb|CCC89292.1|  unnamed protein product                              88.2    4e-16    Trypanosoma congolense IL3000
ref|XP_002783415.1|  hypothetical protein Pmar_PMAR006941             86.3    6e-16    Perkinsus marinus ATCC 50983
ref|XP_002765607.1|  hypothetical protein Pmar_PMAR013671             87.4    1e-15    Perkinsus marinus ATCC 50983
gb|KHG18087.1|  hypothetical protein F383_21533                       79.3    2e-15    Gossypium arboreum [tree cotton]
gb|KHG23677.1|  Phosphoenolpyruvate carboxylase                       80.9    2e-15    Gossypium arboreum [tree cotton]
ref|XP_002781370.1|  hypothetical protein Pmar_PMAR020755             85.5    4e-15    Perkinsus marinus ATCC 50983
emb|CCC46388.1|  conserved hypothetical protein, fragment             81.3    9e-14    Trypanosoma vivax Y486
ref|XP_003875104.1|  conserved hypothetical protein                   80.9    1e-13    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010698662.1|  hypothetical protein LPMP_204610                 80.5    2e-13    Leishmania panamensis
ref|XP_003723012.1|  conserved hypothetical protein                   80.5    2e-13    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_001682794.1|  conserved hypothetical protein                   80.1    2e-13    Leishmania major strain Friedlin
ref|XP_001465175.1|  conserved hypothetical protein                   78.6    6e-13    Leishmania infantum JPCM5
ref|XP_001218808.1|  hypothetical protein                             76.6    2e-12    Trypanosoma brucei brucei TREU927
ref|XP_011771291.1|  hypothetical protein, conserved                  76.6    3e-12    Trypanosoma brucei gambiense DAL972
ref|XP_005846358.1|  hypothetical protein CHLNCDRAFT_135803           70.5    4e-11    Chlorella variabilis
ref|XP_008877889.1|  hypothetical protein, variant 34                 72.4    6e-11    Aphanomyces invadans
ref|XP_008877881.1|  hypothetical protein, variant 26                 72.4    6e-11    Aphanomyces invadans
ref|XP_008877905.1|  hypothetical protein, variant 21                 72.4    6e-11    Aphanomyces invadans
ref|XP_009313637.1|  hypothetical protein DQ04_07941000               71.2    2e-10    Trypanosoma grayi
ref|XP_003723013.1|  conserved hypothetical protein                   69.3    7e-10    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010698663.1|  hypothetical protein LPMP_204620                 69.3    7e-10    Leishmania panamensis
emb|CCW59812.1|  unnamed protein product                              68.2    1e-09    Phytomonas sp. isolate EM1
ref|WP_015353193.1|  hypothetical protein                             66.6    4e-09    Myxococcus stipitatus
ref|WP_044900946.1|  hypothetical protein                             66.2    5e-09    
ref|XP_003875105.1|  conserved hypothetical protein                   65.1    2e-08    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_001682795.1|  conserved hypothetical protein                   64.7    2e-08    Leishmania major strain Friedlin
gb|KFE61079.1|  hypothetical protein DB31_4514                        63.2    5e-08    Hyalangium minutum
ref|WP_044198433.1|  hypothetical protein                             63.2    5e-08    Hyalangium minutum
emb|CAN92791.1|  Calcineurin-like phosphoesterase family protein      63.2    5e-08    Sorangium cellulosum So ce56
ref|XP_001465174.1|  conserved hypothetical protein                   63.2    7e-08    Leishmania infantum JPCM5
ref|WP_044968419.1|  calcineurin                                      62.8    7e-08    
ref|WP_044198580.1|  hypothetical protein                             62.4    1e-07    Hyalangium minutum
ref|WP_020735096.1|  hypothetical protein                             62.0    1e-07    Sorangium cellulosum
ref|WP_043410718.1|  hypothetical protein                             62.0    2e-07    Archangium violaceum
ref|WP_028446622.1|  hypothetical protein                             61.6    2e-07    Chitinimonas koreensis
gb|AFE05765.1|  hypothetical protein COCOR_04316                      60.5    5e-07    Corallococcus coralloides DSM 2259
ref|WP_043323473.1|  hypothetical protein                             60.1    6e-07    
ref|WP_006609975.1|  hypothetical protein                             58.5    2e-06    Bradyrhizobium sp. ORS 285
ref|WP_009027423.1|  hypothetical protein                             58.5    2e-06    Bradyrhizobium sp. ORS 375
gb|AHG91819.1|  hypothetical protein J421_4282                        57.8    4e-06    Gemmatirosa kalamazoonesis
ref|WP_035319266.1|  hypothetical protein                             57.8    4e-06    
ref|WP_002615021.1|  hypothetical protein                             57.4    4e-06    Stigmatella aurantiaca
emb|CCF16816.1|  calcineurin-like phosphoesterase family protein      57.8    4e-06    Brevibacillus laterosporus GI-9
gb|EPX59759.1|  hypothetical protein D187_002503                      57.4    5e-06    Cystobacter fuscus DSM 2262
ref|WP_043431616.1|  hypothetical protein                             57.0    6e-06    Cystobacter fuscus
ref|WP_011556989.1|  hypothetical protein                             56.2    1e-05    Myxococcus xanthus
ref|WP_002633837.1|  hypothetical protein                             55.1    3e-05    Myxococcus hansupus
gb|ADO74394.1|  conserved uncharacterized protein                     55.1    3e-05    Stigmatella aurantiaca DW4/3-1
ref|WP_002610851.1|  hypothetical protein                             55.1    3e-05    Stigmatella aurantiaca
ref|WP_013937276.1|  hypothetical protein                             55.1    3e-05    Myxococcus macrosporus
gb|AFE03418.1|  hypothetical protein COCOR_00329                      55.1    3e-05    Corallococcus coralloides DSM 2259
ref|WP_043322535.1|  hypothetical protein                             54.3    5e-05    
ref|WP_011927548.1|  hypothetical protein                             54.3    6e-05    Bradyrhizobium sp. ORS 278
ref|WP_011554921.1|  hypothetical protein                             53.9    6e-05    Myxococcus xanthus
ref|WP_043405695.1|  hypothetical protein                             53.5    9e-05    
ref|WP_028373661.1|  hypothetical protein                             51.2    5e-04    Legionella lansingensis
ref|WP_027033117.1|  hypothetical protein                             50.8    7e-04    
emb|CAD31267.1|  HYPOTHETICAL PROTEIN                                 50.8    7e-04    Mesorhizobium japonicum R7A



>ref|XP_009618515.1| PREDICTED: uncharacterized protein LOC104110671 isoform X2 [Nicotiana 
tomentosiformis]
Length=797

 Score =   379 bits (973),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYRY E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM
Sbjct  588  LYEWYRYVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKKGM  647

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            D LSRGGAVIYY+SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  648  DFLSRGGAVIYYSSVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  707

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN KGDLEVFTLAVDKVPKEWKLD NW+ E   PQ+PSY++KFPSKWRA SL QD
Sbjct  708  FTRFHINNKGDLEVFTLAVDKVPKEWKLDPNWDGEPKQPQEPSYLQKFPSKWRAASLNQD  767

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
            P+NTVR++D FVIEQTE+ DSE  NG+  Q
Sbjct  768  PVNTVRIIDQFVIEQTEQHDSELTNGTVNQ  797



>ref|XP_009765848.1| PREDICTED: uncharacterized protein LOC104217330 isoform X2 [Nicotiana 
sylvestris]
Length=797

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYRY E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM
Sbjct  588  LYEWYRYVESEHFPDPTGLRTRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGM  647

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              LSRGGAVIYY+SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  648  GFLSRGGAVIYYSSVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  707

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN KG+LEVFTLAVDKVPKEWKLD NW+ E   PQ+PSY+RKFPSKWRA SL QD
Sbjct  708  FTRFHINNKGNLEVFTLAVDKVPKEWKLDPNWDGEQKQPQEPSYLRKFPSKWRAASLNQD  767

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
            P+ TVR++D FVIE+TEK DSE  NG+  Q
Sbjct  768  PVTTVRIIDQFVIERTEKHDSELTNGTVNQ  797



>ref|XP_009618505.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618510.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
Length=1019

 Score =   379 bits (974),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYRY E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM
Sbjct  810   LYEWYRYVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKKGM  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             D LSRGGAVIYY+SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  870   DFLSRGGAVIYYSSVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD NW+ E   PQ+PSY++KFPSKWRA SL QD
Sbjct  930   FTRFHINNKGDLEVFTLAVDKVPKEWKLDPNWDGEPKQPQEPSYLQKFPSKWRAASLNQD  989

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+NTVR++D FVIEQTE+ DSE  NG+  Q
Sbjct  990   PVNTVRIIDQFVIEQTEQHDSELTNGTVNQ  1019



>emb|CAN68801.1| hypothetical protein VITISV_008808 [Vitis vinifera]
Length=289

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  82   LYQWYRTVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGV  141

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  142  LSLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  201

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPI  257
            FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+
Sbjct  202  FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPL  261

Query  256  NTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             TVR+VDHFVI+QT K D E+  G  T 
Sbjct  262  ATVRIVDHFVIQQTGKPDLETRTGPVTH  289



>ref|XP_009629701.1| PREDICTED: uncharacterized protein LOC104119814 [Nicotiana tomentosiformis]
Length=1020

 Score =   377 bits (967),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 188/210 (90%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNGM
Sbjct  811   LYEWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWV STPVVSL+ GSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  871   DSLSRGGAVIYYASVFLYFWVLSTPVVSLILGSYLYICINWLHIHFDEAFSSLRIANYKA  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA  LQQD
Sbjct  931   FTRFHINKKGDLEVFTLAVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKLLQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+NTVR++DHFVIEQ EK DSE  NGS  Q
Sbjct  991   PVNTVRIIDHFVIEQKEKPDSELSNGSLNQ  1020



>ref|XP_009765845.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765846.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
Length=1019

 Score =   375 bits (963),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYRY E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM
Sbjct  810   LYEWYRYVESEHFPDPTGLRTRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGM  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
               LSRGGAVIYY+SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  870   GFLSRGGAVIYYSSVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KG+LEVFTLAVDKVPKEWKLD NW+ E   PQ+PSY+RKFPSKWRA SL QD
Sbjct  930   FTRFHINNKGNLEVFTLAVDKVPKEWKLDPNWDGEQKQPQEPSYLRKFPSKWRAASLNQD  989

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+ TVR++D FVIE+TEK DSE  NG+  Q
Sbjct  990   PVTTVRIIDQFVIERTEKHDSELTNGTVNQ  1019



>gb|KDO84266.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84267.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84268.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84269.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=458

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  249  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  308

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  309  QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  368

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN  GDLEV+TLAVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QD
Sbjct  369  FTRFHINHDGDLEVYTLAVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQD  428

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
            P+NTV+++DHFVI+QTEK D  + N S T
Sbjct  429  PLNTVKIIDHFVIQQTEKPDLGASNRSVT  457



>gb|KDO84264.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=422

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  213  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  272

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  273  QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  332

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN  GDLEV+TLAVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QD
Sbjct  333  FTRFHINHDGDLEVYTLAVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQD  392

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
            P+NTV+++DHFVI+QTEK D  + N S T
Sbjct  393  PLNTVKIIDHFVIQQTEKPDLGASNRSVT  421



>gb|KDO84265.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=424

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  215  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  274

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  275  QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  334

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN  GDLEV+TLAVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QD
Sbjct  335  FTRFHINHDGDLEVYTLAVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQD  394

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
            P+NTV+++DHFVI+QTEK D  + N S T
Sbjct  395  PLNTVKIIDHFVIQQTEKPDLGASNRSVT  423



>ref|XP_009761575.1| PREDICTED: uncharacterized protein LOC104213728 [Nicotiana sylvestris]
Length=1019

 Score =   372 bits (955),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 186/207 (90%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNGM
Sbjct  811   LYEWYRSVESEHFPDPTGLRPRIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWV STPVVSL+ GSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  871   DSLSRGGAVIYYASVFLYFWVLSTPVVSLILGSYLYICINWLHIHFDEAFSSLRIANYKA  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA +LQQD
Sbjct  931   FTRFHINIKGDLEVFTLAVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKTLQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+ TVR++DHFVIEQ EK DSE  NGS
Sbjct  991   PVKTVRIIDHFVIEQKEKPDSELSNGS  1017



>ref|XP_004252774.1| PREDICTED: uncharacterized protein LOC101266203 [Solanum lycopersicum]
Length=1020

 Score =   369 bits (947),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWY+  E+EHFPDPTGL+ RIE WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM
Sbjct  811   LYEWYKSVESEHFPDPTGLKERIEHWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   DSLSRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD  W+ E   PQ PSY++KFPSKWRA+S  QD
Sbjct  931   FTRFHINNKGDLEVFTLAVDKVPKEWKLDPKWDGESKHPQDPSYLQKFPSKWRASSPNQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P++TVR++D FVIE+TEK DSE  NGS  Q
Sbjct  991   PVDTVRIIDQFVIEKTEKHDSELANGSVNQ  1020



>ref|XP_011083822.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105166233 
[Sesamum indicum]
Length=1005

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAV+R NICKNGM
Sbjct  796   LYEWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVSRNNICKNGM  855

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGA IYY SVFLYFWVFSTP+VSLVFGSYLY+CINWLH+HFDEAFSSLRIANYKS
Sbjct  856   DSLSRGGAAIYYASVFLYFWVFSTPIVSLVFGSYLYVCINWLHIHFDEAFSSLRIANYKS  915

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD +WE E   PQ  S+ RKFPSKWR+ S QQD
Sbjct  916   FTRFHINLKGDLEVFTLAVDKVPKEWKLDPSWEGESKLPQNLSHRRKFPSKWRSASSQQD  975

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+NTVR+VD FVIE+T + +  S+NGS T 
Sbjct  976   PLNTVRIVDQFVIEKTVEPEFSSVNGSVTH  1005



>gb|EYU25397.1| hypothetical protein MIMGU_mgv1a000678mg [Erythranthe guttata]
Length=1021

 Score =   364 bits (935),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 187/208 (90%), Gaps = 4/208 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGM
Sbjct  811   LYEWYRSTESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGA IYY SVFLYFWVFSTP+VSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   DSLSRGGAAIYYASVFLYFWVFSTPIVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEV+TLAVDKVPKEWKLD +WE E   PQ  S+ RKFPSKWR+ S QQD
Sbjct  931   FTRFHINPKGDLEVYTLAVDKVPKEWKLDPSWEVESKLPQNQSHFRKFPSKWRSVSSQQD  990

Query  262   PINTVRVVDHFVIEQTEKSD-SESMNGS  182
             P+NTVR+VDHFVIEQT K +   S+NGS
Sbjct  991   PVNTVRIVDHFVIEQTVKPEFVASVNGS  1018



>ref|XP_006342611.1| PREDICTED: uncharacterized protein LOC102601564 [Solanum tuberosum]
Length=1020

 Score =   364 bits (934),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWY+  E+EHFPDPT L+ RIE WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM
Sbjct  811   LYEWYKSVESEHFPDPTDLKKRIEHWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   DSLSRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN KGDLEVFTLAVDKVPKEWKLD  W+ E   PQ PSY++KFPSKWRA+S  QD
Sbjct  931   FTRFHINNKGDLEVFTLAVDKVPKEWKLDPKWDGESKHPQDPSYLQKFPSKWRASSPNQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P++TVR++D FVIE+T K DSE  NGS  Q
Sbjct  991   PVDTVRIIDQFVIEKTAKHDSELANGSVNQ  1020



>ref|XP_010664590.1| PREDICTED: uncharacterized protein LOC100267859 isoform X3 [Vitis 
vinifera]
Length=722

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  515  LYQWYRTVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGV  574

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  575  LSLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  634

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPI  257
            FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+
Sbjct  635  FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPL  694

Query  256  NTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             TVR+VDHFVI+QT K D E+  G  T 
Sbjct  695  ATVRIVDHFVIQQTGKPDLETRTGPVTH  722



>ref|XP_011030451.1| PREDICTED: uncharacterized protein LOC105129897 [Populus euphratica]
Length=1021

 Score =   361 bits (926),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 187/207 (90%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYRY E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGM
Sbjct  812   LYEWYRYVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY SVF+YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  872   ESLSRGGAIIYYASVFIYFWVFSTPVVSLVFGSYLYICINWLHMHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A   QQ+
Sbjct  932   FTRFHINKDGDLEVFTLAVDKVPKEWKLDPHWDAEPKQPQQLSHHRKFPSKWSAAVAQQE  991

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VDHFV+ QTEK D  + +GS
Sbjct  992   PLNTVKIVDHFVVRQTEKPDFGTSSGS  1018



>ref|XP_006374985.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 ref|XP_006374986.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52782.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52783.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
Length=1021

 Score =   360 bits (925),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 187/207 (90%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYRY E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGM
Sbjct  812   LYEWYRYVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY SVF+YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  872   ESLSRGGAIIYYASVFIYFWVFSTPVVSLVFGSYLYICINWLHMHFDEAFSSLRIANYKA  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A   QQ+
Sbjct  932   FTRFHINKDGDLEVFTLAVDKVPKEWKLDPHWDAEPKQPQQLSHHRKFPSKWSAAVAQQE  991

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VDHFV+ QTEK D  + +GS
Sbjct  992   PLNTVKIVDHFVVRQTEKPDFGTSSGS  1018



>gb|KDP38386.1| hypothetical protein JCGZ_04311 [Jatropha curcas]
Length=795

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 3/204 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+
Sbjct  589  LYQWYRSVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGI  648

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA+IYY +VFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  649  ESLSRGGAIIYYAAVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  708

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN  GDLEV+TLAVDK+PKEWKLDSNW+ EP   QQ S+ R+FPSKWRA + Q D
Sbjct  709  FTRFHINKNGDLEVYTLAVDKIPKEWKLDSNWDAEPKQLQQLSHHRQFPSKWRAATSQLD  768

Query  262  PINTVRVVDHFVIEQTEKSDSESM  191
            P+NTV++VDHFVI QTE   SE +
Sbjct  769  PLNTVKIVDHFVIPQTENQISEQV  792



>gb|KHG22709.1| putative HTH-type transcriptional regulator ybfP [Gossypium arboreum]
Length=237

 Score =   335 bits (858),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 180/213 (85%), Gaps = 6/213 (3%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPE---VMAVTRQNICK  623
            LY+WYR  E+EHFPDP+GLRAR+E+W FGLYPACIKY MSAFDVPE   VMAVTR NICK
Sbjct  25   LYQWYRSVESEHFPDPSGLRARMEQWIFGLYPACIKYFMSAFDVPEHYQVMAVTRSNICK  84

Query  622  NGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIAN  443
            NG+ +LSRGGAVIYY SVFLYFWVFS PVVSLVFGSYLYICINW H+HFDEAFS LRIAN
Sbjct  85   NGIQALSRGGAVIYYASVFLYFWVFSNPVVSLVFGSYLYICINWFHLHFDEAFSYLRIAN  144

Query  442  YKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSL  272
            YKSFTRFHIN  G+LEVFTLAVDKVP++W LD +W+ E   PQQ S+ RK+PSKW A + 
Sbjct  145  YKSFTRFHINRDGNLEVFTLAVDKVPRDWMLDPDWDMEQKQPQQLSHRRKYPSKWSAAAG  204

Query  271  QQDPINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
            QQDP+NTVRVVDHFVI Q ++ D  S NGS ++
Sbjct  205  QQDPVNTVRVVDHFVIRQNQEPDFVSSNGSVSR  237



>ref|XP_010098704.1| hypothetical protein L484_026083 [Morus notabilis]
 gb|EXB75607.1| hypothetical protein L484_026083 [Morus notabilis]
Length=865

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  654  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKAGM  713

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  714  ESLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  773

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI T GDLEVFTLAVDKVPKEWKLD +W+ EP+QP   ++ RK+PSKW A S QQD
Sbjct  774  FTRFHITTDGDLEVFTLAVDKVPKEWKLDPDWDGEPKQPQQLNHNRKYPSKWSAASPQQD  833

Query  262  PINTVRVVDHFVIEQTEKSDSESMNG  185
            PI+TV++VDHFVI+QT++ D+ + NG
Sbjct  834  PIHTVKIVDHFVIKQTDEFDTGASNG  859



>ref|XP_006473361.1| PREDICTED: uncharacterized protein LOC102621653 isoform X1 [Citrus 
sinensis]
 ref|XP_006473362.1| PREDICTED: uncharacterized protein LOC102621653 isoform X2 [Citrus 
sinensis]
Length=1019

 Score =   357 bits (917),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  810   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  870   QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEV+TLAVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QD
Sbjct  930   FTRFHINHDGDLEVYTLAVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQD  989

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
             P+NTV+++DHFVI+QTEK D  + N S T
Sbjct  990   PLNTVKIIDHFVIQQTEKPDLGASNRSVT  1018



>ref|XP_011074457.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
 ref|XP_011074458.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
Length=1007

 Score =   357 bits (916),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 184/209 (88%), Gaps = 3/209 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPD TGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  798   LYEWYRSVESEHFPDRTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKNGM  857

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWVFSTP+VSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  858   DSLSRGGAVIYYASVFLYFWVFSTPIVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  917

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI +KGDLEVFTLAVDKVPK WKLD +W+ E + P   SY RKFPSKWR+ S QQD
Sbjct  918   FTRFHITSKGDLEVFTLAVDKVPKAWKLDPSWDCESKLPHSLSYRRKFPSKWRSVSPQQD  977

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
             P++TVR+VDHFV+E T K +  S+NG  T
Sbjct  978   PVSTVRIVDHFVVEHTAKPEGASVNGPVT  1006



>ref|XP_010664589.1| PREDICTED: uncharacterized protein LOC100267859 isoform X2 [Vitis 
vinifera]
Length=901

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  694  LYQWYRTVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGV  753

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  754  LSLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  813

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPI  257
            FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+
Sbjct  814  FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPL  873

Query  256  NTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             TVR+VDHFVI+QT K D E+  G  T 
Sbjct  874  ATVRIVDHFVIQQTGKPDLETRTGPVTH  901



>ref|XP_007017323.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY14548.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
Length=1019

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 184/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNG+
Sbjct  812   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSYICKNGL  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGAVIYY SVFLYFWVFSTPVVSLVFG YLY+CINWLH+HFDEAFSSLRIANYKS
Sbjct  872   QSLSRGGAVIYYASVFLYFWVFSTPVVSLVFGCYLYVCINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ EP+Q    S+ RK+PSKW A+S QQD
Sbjct  932   FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEPKQSPQLSHRRKYPSKWSASSSQQD  991

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTVRVVD FVI QT+K DS S NGS
Sbjct  992   PVNTVRVVDQFVIRQTDKPDSISSNGS  1018



>ref|XP_006434822.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48062.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=1004

 Score =   355 bits (912),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  795   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  854

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  855   QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  914

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEV+TLAVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QD
Sbjct  915   FTRFHINHDGDLEVYTLAVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQD  974

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKT  176
             P+NTV+++DHFVI+QT+K D  + N S T
Sbjct  975   PLNTVKIIDHFVIQQTDKPDLGASNRSVT  1003



>ref|XP_012071694.1| PREDICTED: uncharacterized protein LOC105633674 isoform X1 [Jatropha 
curcas]
Length=1016

 Score =   354 bits (909),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 3/204 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+
Sbjct  810   LYQWYRSVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGI  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY +VFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  870   ESLSRGGAIIYYAAVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEV+TLAVDK+PKEWKLDSNW+ EP   QQ S+ R+FPSKWRA + Q D
Sbjct  930   FTRFHINKNGDLEVYTLAVDKIPKEWKLDSNWDAEPKQLQQLSHHRQFPSKWRAATSQLD  989

Query  262   PINTVRVVDHFVIEQTEKSDSESM  191
             P+NTV++VDHFVI QTE   SE +
Sbjct  990   PLNTVKIVDHFVIPQTENQISEQV  1013



>emb|CBI19565.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   354 bits (909),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  810   LYQWYRTVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGV  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  870   LSLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPI  257
             FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+
Sbjct  930   FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPL  989

Query  256   NTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
              TVR+VDHFVI+QT K D E+  G  T 
Sbjct  990   ATVRIVDHFVIQQTGKPDLETRTGPVTH  1017



>ref|XP_010664588.1| PREDICTED: uncharacterized protein LOC100267859 isoform X1 [Vitis 
vinifera]
Length=1004

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  797   LYQWYRTVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGV  856

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  857   LSLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  916

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPI  257
             FTRFHIN  GDLEVFTLAVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+
Sbjct  917   FTRFHINRDGDLEVFTLAVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPL  976

Query  256   NTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
              TVR+VDHFVI+QT K D E+  G  T 
Sbjct  977   ATVRIVDHFVIQQTGKPDLETRTGPVTH  1004



>ref|XP_004238179.1| PREDICTED: uncharacterized protein LOC101261408 [Solanum lycopersicum]
Length=1010

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 180/199 (90%), Gaps = 3/199 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNG+
Sbjct  812   LYQWYQSVESEHFPDPTGLRERIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGI  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGAVIYY SVFLYFWV STPVVSL+ GSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  872   DSLSRGGAVIYYASVFLYFWVLSTPVVSLILGSYLYISINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHINTKGDLEVFTLAVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA + QQD
Sbjct  932   FTRFHINTKGDLEVFTLAVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKASQQD  991

Query  262   PINTVRVVDHFVIEQTEKS  206
             P+NTVR++DHFVIE  EK+
Sbjct  992   PVNTVRIIDHFVIEHREKN  1010



>ref|XP_008393833.1| PREDICTED: uncharacterized protein LOC103455994 isoform X2 [Malus 
domestica]
Length=903

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICK GM
Sbjct  693  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKTGM  752

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSR G VIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  753  ESLSRAGGVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  812

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TLAVDKVPK+WKLD  W+ EP+QP   S++RKFPSKW A++ QQD
Sbjct  813  FTRFHINSDGDLEVYTLAVDKVPKKWKLDPEWDREPKQPEQMSHLRKFPSKWSASAGQQD  872

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGS  182
            P+NTV++VD FVI QT+K D  + + S
Sbjct  873  PLNTVKIVDQFVIRQTDKXDVGASDAS  899



>ref|XP_008383912.1| PREDICTED: uncharacterized protein LOC103446557 [Malus domestica]
Length=1020

 Score =   353 bits (906),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRAGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVD+VPK WKLD  W+ EP+QP   S++RKFPSKW A + QQD
Sbjct  931   FTRFHINSDGDLEVYTLAVDRVPKAWKLDPEWDREPKQPEQMSHLRKFPSKWSAAAGQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P++TV++VD FVI QT+K+D  + +GS
Sbjct  991   PLHTVKIVDQFVIRQTDKTDVGASDGS  1017



>ref|XP_011458950.1| PREDICTED: uncharacterized protein LOC101313275 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1027

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  818   LYEWYRTAESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  877

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKS
Sbjct  878   ESLSRLGACIYYASVFLYFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKS  937

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHINT GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQD
Sbjct  938   FTRFHINTDGDLEVYTLAVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQD  997

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P++ V++VDHFVI QT+ +D    +GS
Sbjct  998   PLHNVKIVDHFVIRQTDNTDIAGSDGS  1024



>ref|XP_004291134.1| PREDICTED: uncharacterized protein LOC101313275 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1022

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  813   LYEWYRTAESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRLGACIYYASVFLYFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHINT GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQD
Sbjct  933   FTRFHINTDGDLEVYTLAVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQD  992

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P++ V++VDHFVI QT+ +D    +GS
Sbjct  993   PLHNVKIVDHFVIRQTDNTDIAGSDGS  1019



>ref|XP_011458951.1| PREDICTED: uncharacterized protein LOC101313275 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1024

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  815   LYEWYRTAESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKS
Sbjct  875   ESLSRLGACIYYASVFLYFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKS  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHINT GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQD
Sbjct  935   FTRFHINTDGDLEVYTLAVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQD  994

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P++ V++VDHFVI QT+ +D    +GS
Sbjct  995   PLHNVKIVDHFVIRQTDNTDIAGSDGS  1021



>ref|XP_009367394.1| PREDICTED: uncharacterized protein LOC103957048 [Pyrus x bretschneideri]
Length=1020

 Score =   352 bits (904),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 185/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR G VIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRAGGVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPK+WKLD  W+ EP+QP   S++R+FPSKW A++ QQD
Sbjct  931   FTRFHINSDGDLEVYTLAVDKVPKKWKLDPEWDREPKQPEQMSHLREFPSKWSASAGQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VD FVI QT+K+D  + + S
Sbjct  991   PLNTVKIVDQFVIRQTDKTDVGASDAS  1017



>gb|KJB58436.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=1021

 Score =   352 bits (903),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDP+GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+
Sbjct  812   LYQWYRSVESEHFPDPSGLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGI  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              +LSRGGAVIYY S+FLYFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  872   QALSRGGAVIYYASIFLYFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLAVDKVP+EW LD +W+ E   PQQ S+ RK+PSKW A + QQD
Sbjct  932   FTRFHINRDGDLEVFTLAVDKVPREWMLDPDWDMEQKQPQQLSHRRKYPSKWSAAAGQQD  991

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+NTVRVVDHFVI Q EK D  S NGS ++
Sbjct  992   PVNTVRVVDHFVIRQNEKPDFVSSNGSVSR  1021



>ref|XP_008220172.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320287 
[Prunus mume]
Length=1020

 Score =   352 bits (903),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 186/207 (90%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR +ICKNGM
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRXHICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA+IYY SVFLYFW+FSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRAGAIIYYASVFLYFWMFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI + GDLEV+TLAVDKVPKEWKLD  W++E   PQQ S++RKFPSKW A + QQD
Sbjct  931   FTRFHIKSDGDLEVYTLAVDKVPKEWKLDPEWDSELRQPQQMSHLRKFPSKWNAAAAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VDHFVI QT+K+ + + +GS
Sbjct  991   PLNTVKIVDHFVIRQTDKTVNGASDGS  1017



>ref|XP_009370173.1| PREDICTED: uncharacterized protein LOC103959542 [Pyrus x bretschneideri]
Length=1020

 Score =   352 bits (903),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRVGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVD+VPK WKLD  W+ EP+QP   S++RKFPSKW A + QQD
Sbjct  931   FTRFHINSDGDLEVYTLAVDRVPKAWKLDPEWDREPKQPEQMSHLRKFPSKWSAAAGQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P++TV++VD FVI QT+K+D  + +GS
Sbjct  991   PLHTVKIVDQFVIRQTDKTDVGASDGS  1017



>gb|KCW86234.1| hypothetical protein EUGRSUZ_B02922 [Eucalyptus grandis]
Length=706

 Score =   344 bits (883),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM
Sbjct  496  LYQWYRTVESEHFPDPTGLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGM  555

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK 
Sbjct  556  ESLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKG  615

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TL VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QD
Sbjct  616  FTRFHINSGGDLEVYTLVVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQD  675

Query  262  PINTVRVVDHFVIEQTEKSDSESMNG  185
            P+ TVR+VDHFVI +  K+ SE+ NG
Sbjct  676  PVKTVRIVDHFVINRMVKTQSEASNG  701



>ref|XP_007227027.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
 gb|EMJ28226.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
Length=1021

 Score =   352 bits (902),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 6/210 (3%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM
Sbjct  809   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGM  868

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  869   ESLSRAGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  928

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE------PQQPSYVRKFPSKWRATSL  272
             FTRFHI + GDL+V+TLAVDKVPKEWKLD  W++E      PQQ S+ RKFPSKW A + 
Sbjct  929   FTRFHIGSNGDLDVYTLAVDKVPKEWKLDPEWDSEDRKPRQPQQMSHHRKFPSKWSAAAA  988

Query  271   QQDPINTVRVVDHFVIEQTEKSDSESMNGS  182
             QQDP+NTV++VDHFVI QT+K+ + + +GS
Sbjct  989   QQDPLNTVKIVDHFVIRQTDKTVNGASDGS  1018



>ref|XP_002510264.1| hydrolase, putative [Ricinus communis]
 gb|EEF52451.1| hydrolase, putative [Ricinus communis]
Length=1006

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 184/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  797   LYQWYRSVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGI  856

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  857   ESLSRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKS  916

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW---ETEPQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLAVDK+PK+WKLDS W   E +PQQ S+ R++PSKWRA + QQD
Sbjct  917   FTRFHINKDGDLEVFTLAVDKIPKDWKLDSKWDGEEKQPQQLSHQRRYPSKWRAATSQQD  976

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VD FVI +TE  ++ + NGS
Sbjct  977   PLNTVKIVDSFVIRRTENPNTGASNGS  1003



>ref|XP_008393832.1| PREDICTED: uncharacterized protein LOC103455994 isoform X1 [Malus 
domestica]
Length=1021

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICK GM
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKTGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR G VIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRAGGVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPK+WKLD  W+ EP+QP   S++RKFPSKW A++ QQD
Sbjct  931   FTRFHINSDGDLEVYTLAVDKVPKKWKLDPEWDREPKQPEQMSHLRKFPSKWSASAGQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTV++VD FVI QT+K D  + + S
Sbjct  991   PLNTVKIVDQFVIRQTDKXDVGASDAS  1017



>emb|CDP01374.1| unnamed protein product [Coffea canephora]
Length=1010

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK G+
Sbjct  813   LYEWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNYICKKGI  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRQGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP-SYVRKFPSKWRATSLQQDPI  257
             FTRFHI+ KGDLEVFTLAVDKVPKEWKLD NW+ EP+Q  S+ RKFPSKWRATS QQDP+
Sbjct  933   FTRFHIDRKGDLEVFTLAVDKVPKEWKLDPNWDAEPKQHLSHQRKFPSKWRATSSQQDPV  992

Query  256   NTVRVVDHFVIEQTEKSD  203
             + VR++DHFVI+QT+K +
Sbjct  993   SAVRIIDHFVIQQTQKEN  1010



>ref|XP_004499083.1| PREDICTED: uncharacterized protein LOC101514142 [Cicer arietinum]
Length=1017

 Score =   347 bits (891),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 188/211 (89%), Gaps = 4/211 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG+
Sbjct  807   LYQWYQSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGL  866

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  867   ESLSRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  926

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLDS W+ E   PQ  S++R+FPSKWRA    QD
Sbjct  927   FTRFHINSDGDLEVYTLAVDKVPKEWKLDSEWDGETKNPQMLSHLRRFPSKWRAVIANQD  986

Query  262   PINTVRVVDHFVIEQT-EKSDSESMNGSKTQ  173
             P++TV++VDHF+IE+T +K++ ++ +    Q
Sbjct  987   PVHTVKIVDHFIIERTNDKNECDTASNGLDQ  1017



>ref|XP_010936846.1| PREDICTED: uncharacterized protein LOC105056370 [Elaeis guineensis]
Length=1032

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 181/206 (88%), Gaps = 4/206 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYRY E+EHFPDPTGLR R+ERWTFGLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  828   LYEWYRYMESEHFPDPTGLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKNGM  887

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY SVFLYFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  888   ESLSRGGAIIYYGSVFLYFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKA  947

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPKEWKLD  W+ EP+QP   S+ R+FPSKW+A S   D
Sbjct  948   FTRFHIAVSGDLEVFTLAVDKVPKEWKLDPEWDAEPKQPKQLSHRRRFPSKWKAAS-GPD  1006

Query  262   PINTVRVVDHFVIEQTEKSDSESMNG  185
             P+N+VR+VDHFVI+++    +E  NG
Sbjct  1007  PVNSVRIVDHFVIQRSLTDLTEGGNG  1032



>ref|XP_006595961.1| PREDICTED: uncharacterized protein LOC100820584 isoform X3 [Glycine 
max]
Length=910

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 182/203 (90%), Gaps = 3/203 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC NG+
Sbjct  700  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICNNGL  759

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +S+SRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  760  ESISRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  819

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA    QD
Sbjct  820  FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHQD  879

Query  262  PINTVRVVDHFVIEQTEKSDSES  194
            P+ TV++VDHFVI +T+K+D  +
Sbjct  880  PVRTVKIVDHFVIGRTDKNDCAT  902



>ref|XP_010044196.1| PREDICTED: uncharacterized protein LOC104433212 isoform X2 [Eucalyptus 
grandis]
Length=926

 Score =   344 bits (882),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM
Sbjct  716  LYQWYRTVESEHFPDPTGLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGM  775

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK 
Sbjct  776  ESLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKG  835

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TL VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QD
Sbjct  836  FTRFHINSGGDLEVYTLVVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQD  895

Query  262  PINTVRVVDHFVIEQTEKSDSESMNG  185
            P+ TVR+VDHFVI +  K+ SE+ NG
Sbjct  896  PVKTVRIVDHFVINRMVKTQSEASNG  921



>ref|XP_007160825.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
 gb|ESW32819.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
Length=1010

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 182/200 (91%), Gaps = 3/200 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG+
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGL  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEV+T+AVDKVPKEWKLD +W+ E   PQ+ S+ R+FPSKWRA +  QD
Sbjct  931   FTRFHINYDGDLEVYTMAVDKVPKEWKLDPDWDGEAKHPQELSHFRRFPSKWRAVTAHQD  990

Query  262   PINTVRVVDHFVIEQTEKSD  203
             P++TV++VDHFVI +TE ++
Sbjct  991   PVHTVKIVDHFVISRTENNE  1010



>ref|XP_003544449.1| PREDICTED: uncharacterized protein LOC100820584 isoform X1 [Glycine 
max]
 ref|XP_006595960.1| PREDICTED: uncharacterized protein LOC100820584 isoform X2 [Glycine 
max]
 gb|KHN46303.1| hypothetical protein glysoja_045314 [Glycine soja]
Length=1021

 Score =   345 bits (884),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 182/203 (90%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC NG+
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICNNGL  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S+SRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESISRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA    QD
Sbjct  931   FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P+ TV++VDHFVI +T+K+D  +
Sbjct  991   PVRTVKIVDHFVIGRTDKNDCAT  1013



>ref|XP_010044195.1| PREDICTED: uncharacterized protein LOC104433212 isoform X1 [Eucalyptus 
grandis]
Length=1012

 Score =   344 bits (883),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM
Sbjct  802   LYQWYRTVESEHFPDPTGLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGM  861

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK 
Sbjct  862   ESLSRGGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKG  921

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TL VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QD
Sbjct  922   FTRFHINSGGDLEVYTLVVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQD  981

Query  262   PINTVRVVDHFVIEQTEKSDSESMNG  185
             P+ TVR+VDHFVI +  K+ SE+ NG
Sbjct  982   PVKTVRIVDHFVINRMVKTQSEASNG  1007



>ref|XP_006601298.1| PREDICTED: uncharacterized protein LOC100819940 isoform X4 [Glycine 
max]
Length=987

 Score =   343 bits (881),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 3/203 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG+
Sbjct  777  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGL  836

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +S+SRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  837  ESISRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  896

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     D
Sbjct  897  FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLD  956

Query  262  PINTVRVVDHFVIEQTEKSDSES  194
            P++TV++VDHFVI +T+K+D  +
Sbjct  957  PVHTVKIVDHFVIGRTDKNDCAT  979



>ref|XP_010275607.1| PREDICTED: uncharacterized protein LOC104610601 [Nelumbo nucifera]
Length=1000

 Score =   343 bits (881),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPT LRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM
Sbjct  797  LYEWYRSVESEHFPDPTDLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSTICKQGM  856

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  857  ESLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKA  916

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP-SYVRKFPSKWRATSLQQDPI  257
            FTR HI  +GDLEVFTLAVDKVPKEWKLD +W+ EP+QP SY+RKFPSKW A +L QDP+
Sbjct  917  FTRCHITPEGDLEVFTLAVDKVPKEWKLDPDWDREPKQPQSYLRKFPSKWCAAALPQDPV  976

Query  256  NTVRVVDHFVIEQT  215
            +TVR+VDHF+I++T
Sbjct  977  STVRIVDHFIIQKT  990



>emb|CAB44318.1| putative protein [Arabidopsis thaliana]
 emb|CAB78223.1| putative protein [Arabidopsis thaliana]
Length=1012

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWY+  ENEHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  810   LYEWYKSVENEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGM  869

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  870   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  929

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A++ QQD
Sbjct  930   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWGASTSQQD  989

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD FVI +++K + E
Sbjct  990   PVNTVKIVDRFVIHRSQKENGE  1011



>ref|XP_003550348.1| PREDICTED: uncharacterized protein LOC100819940 isoform X1 [Glycine 
max]
 ref|XP_006601296.1| PREDICTED: uncharacterized protein LOC100819940 isoform X2 [Glycine 
max]
 ref|XP_006601297.1| PREDICTED: uncharacterized protein LOC100819940 isoform X3 [Glycine 
max]
Length=1021

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG+
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGL  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S+SRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESISRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     D
Sbjct  931   FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLD  990

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P++TV++VDHFVI +T+K+D  +
Sbjct  991   PVHTVKIVDHFVIGRTDKNDCAT  1013



>emb|CDX94143.1| BnaC07g37770D [Brassica napus]
Length=1007

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  805   LYQWYKSVENEHFPDPTGLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  864

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  865   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  924

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI + GDLEVFTL VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+LQQD
Sbjct  925   FTRFHIKSDGDLEVFTLGVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTLQQD  984

Query  262   PINTVRVVDHFVIEQTEK  209
             PINTV++VDHFVI +++K
Sbjct  985   PINTVKIVDHFVITRSDK  1002



>ref|NP_192917.3| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83050.1| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
Length=1013

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWY+  ENEHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  811   LYEWYKSVENEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A++ QQD
Sbjct  931   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWGASTSQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD FVI +++K + E
Sbjct  991   PVNTVKIVDRFVIHRSQKENGE  1012



>gb|KHN12760.1| hypothetical protein glysoja_008723 [Glycine soja]
Length=1021

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG+
Sbjct  811   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGL  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S+SRGGAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESISRGGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     D
Sbjct  931   FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLD  990

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P++TV++VDHFVI +T+K+D  +
Sbjct  991   PVHTVKIVDHFVIGRTDKNDCAT  1013



>ref|XP_010268877.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
 ref|XP_010268883.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
Length=1012

 Score =   343 bits (879),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  812   LYEWYRSVESEHFPDPTGLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWL +HFDEAFSSLRIANYK+
Sbjct  872   ESLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLQIHFDEAFSSLRIANYKA  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP-QQPSYVRKFPSKWRATSLQQDPI  257
             FTR H+   GDLEVFTLAVDKVPKEWKLD +W+ EP QQ S++RKFPSKW AT++ QDPI
Sbjct  932   FTRCHVTHDGDLEVFTLAVDKVPKEWKLDPDWDQEPRQQLSHLRKFPSKWSATAVSQDPI  991

Query  256   NTVRVVDHFVIEQT  215
             +TVR+VDHFVI++T
Sbjct  992   STVRIVDHFVIQKT  1005



>gb|KEH40051.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1020

 Score =   342 bits (876),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 183/210 (87%), Gaps = 5/210 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG+
Sbjct  808   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGL  867

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S+SRGGA+IYY +VFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  868   ESVSRGGAIIYYAAVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  927

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI++ G+LEVFTLAVDKVPK+WKLDS WE E   PQ  S++R FPSKWRA    QD
Sbjct  928   FTRFHISSDGNLEVFTLAVDKVPKDWKLDSEWEKETKNPQISSHLRSFPSKWRAAVANQD  987

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+ TV++VDHF+IE+T+  D     G+ + 
Sbjct  988   PVQTVKIVDHFIIERTD--DKNECGGTDSN  1015



>ref|XP_010062120.1| PREDICTED: uncharacterized protein LOC104449600 isoform X3 [Eucalyptus 
grandis]
Length=1044

 Score =   342 bits (876),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+
Sbjct  838   LYQWYREVESEHFPDPTGLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGL  897

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  898   ASLSRGGAAIYYASVFLYFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKA  957

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QD
Sbjct  958   FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQD  1017

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTVR+VDHFVI+Q EK   E
Sbjct  1018  PVNTVRIVDHFVIKQAEKPHLE  1039



>gb|KEH40052.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1067

 Score =   342 bits (877),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 183/210 (87%), Gaps = 5/210 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG+
Sbjct  855   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGL  914

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S+SRGGA+IYY +VFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  915   ESVSRGGAIIYYAAVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  974

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI++ G+LEVFTLAVDKVPK+WKLDS WE E   PQ  S++R FPSKWRA    QD
Sbjct  975   FTRFHISSDGNLEVFTLAVDKVPKDWKLDSEWEKETKNPQISSHLRSFPSKWRAAVANQD  1034

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+ TV++VDHF+IE+T+  D     G+ + 
Sbjct  1035  PVQTVKIVDHFIIERTD--DKNECGGTDSN  1062



>emb|CDX98782.1| BnaA03g45670D [Brassica napus]
Length=1007

 Score =   341 bits (874),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  805   LYQWYKSVENEHFPDPTGLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  864

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  865   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  924

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI + GDLEVFTL VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+ QQD
Sbjct  925   FTRFHIKSDGDLEVFTLGVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTSQQD  984

Query  262   PINTVRVVDHFVIEQTEK  209
             PINTV++VDHFVI +++K
Sbjct  985   PINTVKIVDHFVISRSDK  1002



>ref|XP_009137306.1| PREDICTED: uncharacterized protein LOC103861350 [Brassica rapa]
Length=1007

 Score =   341 bits (874),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  805   LYQWYKSVENEHFPDPTGLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  864

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  865   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  924

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI + GDLEVFTL VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+ QQD
Sbjct  925   FTRFHIKSDGDLEVFTLGVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTSQQD  984

Query  262   PINTVRVVDHFVIEQTEK  209
             PINTV++VDHFVI +++K
Sbjct  985   PINTVKIVDHFVISRSDK  1002



>ref|XP_010062121.1| PREDICTED: uncharacterized protein LOC104449600 isoform X4 [Eucalyptus 
grandis]
Length=1011

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+
Sbjct  805   LYQWYREVESEHFPDPTGLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGL  864

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  865   ASLSRGGAAIYYASVFLYFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKA  924

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QD
Sbjct  925   FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQD  984

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTVR+VDHFVI+Q EK   E
Sbjct  985   PVNTVRIVDHFVIKQAEKPHLE  1006



>gb|KJB63807.1| hypothetical protein B456_010G017500 [Gossypium raimondii]
Length=1017

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 179/207 (86%), Gaps = 3/207 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+
Sbjct  808   LYQWYQSVETEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGI  867

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  868   QSLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  927

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHIN  GDLEVFTLA+DKVP+EWKLD +W+ E   PQQ S+  K PSKW A+   QD
Sbjct  928   FTRFHINCDGDLEVFTLAIDKVPREWKLDPDWDGEAKQPQQWSHRIKHPSKWSASVSHQD  987

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGS  182
             P+NTVR+VD F+I+QT+  D  S NGS
Sbjct  988   PLNTVRIVDRFIIKQTDNQDFASSNGS  1014



>gb|KCW69186.1| hypothetical protein EUGRSUZ_F02708 [Eucalyptus grandis]
Length=996

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+
Sbjct  790  LYQWYREVESEHFPDPTGLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGL  849

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA IYY SVFLYFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  850  ASLSRGGAAIYYASVFLYFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKA  909

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QD
Sbjct  910  FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQD  969

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+NTVR+VDHFVI+Q EK   E
Sbjct  970  PVNTVRIVDHFVIKQAEKPHLE  991



>ref|XP_004152730.2| PREDICTED: uncharacterized protein LOC101204257 [Cucumis sativus]
 gb|KGN62541.1| hypothetical protein Csa_2G360580 [Cucumis sativus]
Length=1025

 Score =   340 bits (873),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 180/214 (84%), Gaps = 7/214 (3%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E EHFPDPTGLRAR+E WT+GLYPACIKYLMSAFD+PEVMAV+R NICKNGM
Sbjct  812   LYDWYRTKEGEHFPDPTGLRARLEEWTYGLYPACIKYLMSAFDIPEVMAVSRSNICKNGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGA+IYY SVF YFWVFSTPVVS VFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  872   DSLSRGGAMIYYGSVFFYFWVFSTPVVSFVFGSYLYICINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP------QQPSYVRKFPSKWRATSL  272
             FTRFHIN  GDLEVFTLAVDKVPKEWKLDS WE E       Q+ S+ R +PSKW+A + 
Sbjct  932   FTRFHINRDGDLEVFTLAVDKVPKEWKLDSKWEGEAREMEGGQKMSHQRSYPSKWKAAAP  991

Query  271   QQDPINTVRVVDHFVIEQTEKSDS-ESMNGSKTQ  173
              QDP++TV++VD FVI Q   +D+ E +NGS+  
Sbjct  992   HQDPVHTVKIVDQFVIRQARGNDNFEDVNGSEIH  1025



>gb|KHG27255.1| aat [Gossypium arboreum]
Length=986

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 178/207 (86%), Gaps = 3/207 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  E EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+
Sbjct  777  LYQWYQSVETEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGI  836

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  837  QSLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  896

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN  GDLEVFTLA+DKVP+EWKLD +W+ E   PQQ S+  K PSKW A    QD
Sbjct  897  FTRFHINRDGDLEVFTLAIDKVPREWKLDPDWDGEAKQPQQWSHRIKHPSKWSACVSHQD  956

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGS  182
            P+NTVR+VD F+I+QT+  D  S NGS
Sbjct  957  PLNTVRIVDRFIIKQTDNQDFASSNGS  983



>ref|XP_002874725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1027

 Score =   340 bits (872),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 181/202 (90%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWY+  EN+HFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  825   LYEWYKSVENQHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGM  884

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  885   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHLHFDEAFSSLRIANYKS  944

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW +++ QQD
Sbjct  945   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWCSSTAQQD  1004

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD FVI +++K + E
Sbjct  1005  PVNTVKIVDRFVIHRSQKENGE  1026



>ref|XP_010062116.1| PREDICTED: uncharacterized protein LOC104449600 isoform X1 [Eucalyptus 
grandis]
Length=1109

 Score =   341 bits (874),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+
Sbjct  903   LYQWYREVESEHFPDPTGLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGL  962

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  963   ASLSRGGAAIYYASVFLYFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKA  1022

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHIN+ GDLEV+TLAVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QD
Sbjct  1023  FTRFHINSDGDLEVYTLAVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQD  1082

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTVR+VDHFVI+Q EK   E
Sbjct  1083  PVNTVRIVDHFVIKQAEKPHLE  1104



>ref|XP_010455595.1| PREDICTED: uncharacterized protein LOC104737182 [Camelina sativa]
Length=1013

 Score =   339 bits (870),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 180/202 (89%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQD
Sbjct  931   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD F+I ++EK + E
Sbjct  991   PVNTVKIVDRFMIHRSEKQNGE  1012



>ref|XP_006396852.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
 gb|ESQ38305.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
Length=1013

 Score =   339 bits (870),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI    D+EVFTLAVDKVPK+W LD +W++EP+Q    SY RKFPSKW A++ QQD
Sbjct  931   FTRFHIKENKDIEVFTLAVDKVPKDWNLDKDWDSEPKQSGVMSYKRKFPSKWSASTAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ TV+VVD+FVI +++K + E
Sbjct  991   PVTTVKVVDYFVIHRSQKQNGE  1012



>dbj|BAK04122.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLR R+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM
Sbjct  119  LYDWYRSMESEHFPDPTGLRTRLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGM  178

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  179  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  238

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE E   P Q  + R++PSKWR+ S   D
Sbjct  239  FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPKWEAEERGPHQLGHHRRYPSKWRSAS-SPD  297

Query  262  PINTVRVVDHFVIEQTEKSDSES  194
            P+ +VRVVDHF I +T   D E+
Sbjct  298  PVRSVRVVDHFTITRTVAPDPET  320



>ref|XP_010422134.1| PREDICTED: uncharacterized protein LOC104707474 [Camelina sativa]
Length=1013

 Score =   339 bits (869),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQD
Sbjct  931   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD F I ++EK + E
Sbjct  991   PVNTVKIVDRFTIHRSEKQNGE  1012



>ref|XP_008444644.1| PREDICTED: uncharacterized protein LOC103487913 [Cucumis melo]
Length=1025

 Score =   339 bits (869),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 177/214 (83%), Gaps = 7/214 (3%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E EHFPDPTGLRAR+E WT+GLYPACIKYLMSAFD+PEVMAV+R NICKNGM
Sbjct  812   LYEWYRTKEGEHFPDPTGLRARLEEWTYGLYPACIKYLMSAFDIPEVMAVSRSNICKNGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSRGGA+IYY SVF YFWVFSTPVVS VFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  872   DSLSRGGAMIYYGSVFFYFWVFSTPVVSFVFGSYLYICINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP------QQPSYVRKFPSKWRATSL  272
             FTRFHIN  GDLEVFTLAVDKVPKEWKLDS WE E       Q+ S+ R FPSKW+A + 
Sbjct  932   FTRFHINRDGDLEVFTLAVDKVPKEWKLDSKWEGEAREMEGDQKMSHQRSFPSKWKAAAP  991

Query  271   QQDPINTVRVVDHFVIEQTEKSDS-ESMNGSKTQ  173
              QDP++TV++VD FVI Q   +D     NGS+  
Sbjct  992   HQDPVHTVKIVDQFVIRQGRGNDRFGDANGSEIH  1025



>ref|XP_008775262.1| PREDICTED: uncharacterized protein LOC103695663 [Phoenix dactylifera]
Length=195

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 170/192 (89%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  ENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGA  590
            E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM+SL R  A
Sbjct  2    ESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGMESLPRSSA  61

Query  589  VIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINT  410
            +IYY SVFLYFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+FTRFHI +
Sbjct  62   IIYYASVFLYFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKAFTRFHITS  121

Query  409  KGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVV  239
             GDLEVFTLA+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   DP+N++R+V
Sbjct  122  TGDLEVFTLALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPDPVNSMRIV  180

Query  238  DHFVIEQTEKSD  203
            DHF+I++++ ++
Sbjct  181  DHFIIQKSQDAN  192



>ref|XP_010434128.1| PREDICTED: uncharacterized protein LOC104718144 [Camelina sativa]
Length=1013

 Score =   338 bits (866),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  871   ASLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQD
Sbjct  931   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+NTV++VD F I ++EK + E
Sbjct  991   PVNTVKIVDRFTIHRSEKQNGE  1012



>ref|XP_006413590.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
 gb|ESQ55043.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
Length=1005

 Score =   337 bits (865),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 178/203 (88%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLRARIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  803   LYQWYKSVENEHFPDPTGLRARIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  862

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             ++LSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  863   ETLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  922

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTL VDKVPKEWKLD +W++EP+   + S+ R+FPSKW AT+LQQD
Sbjct  923   FTRFHIKPDGDLEVFTLGVDKVPKEWKLDKDWDSEPRPTVKMSHHRRFPSKWCATTLQQD  982

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             PINTV++VD FVI +++K    S
Sbjct  983   PINTVKIVDRFVIRRSDKEIGGS  1005



>emb|CDX86745.1| BnaA09g21350D [Brassica napus]
Length=960

 Score =   336 bits (861),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 176/202 (87%), Gaps = 3/202 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  758  LYQWYKSVESEHFPDPTGLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGM  817

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  818  ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  877

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q    S+ RKFPSKW A+S QQD
Sbjct  878  FTRFHIKKNKDIEVFTLAVDKVPKDWKLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQD  937

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+  V+VVDHFVI +++  + E
Sbjct  938  PVAAVKVVDHFVIYRSQNQNGE  959



>ref|XP_010540547.1| PREDICTED: uncharacterized protein LOC104814278 isoform X1 [Tarenaya 
hassleriana]
Length=1012

 Score =   336 bits (862),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  813   LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS
Sbjct  873   ESLSRTGAAIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLA+DKVPK+WKLD +W++EP+Q    S+ R++PSKW AT+ QQD
Sbjct  933   FTRFHIRRDGDIEVFTLAIDKVPKDWKLDRDWDSEPKQAGKMSHERRYPSKWCATTAQQD  992

Query  262   PINTVRVVDHFVIEQTEK  209
             P+NTV++VD FVI ++ +
Sbjct  993   PVNTVKIVDRFVIRKSGR  1010



>emb|CDY47423.1| BnaA02g21590D [Brassica napus]
Length=960

 Score =   335 bits (858),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  758  LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGM  817

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  818  ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  877

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQD
Sbjct  878  FTRFHIKENKDIEVFTLAVDKVPKDWKLDKDWDAEPKQSGVMSHKREFPSKWCASSAQQD  937

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+ TV+VVD+F+I +++  + E
Sbjct  938  PVATVKVVDYFLIHRSQNQNGE  959



>ref|XP_010684140.1| PREDICTED: uncharacterized protein LOC104898734 [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   335 bits (860),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 173/200 (87%), Gaps = 3/200 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E EHFPDPTGLRARIE+WTFGLYPACIKYLM AFDVPEVMAVTR NICKNG+
Sbjct  807   LYEWYRQMEREHFPDPTGLRARIEQWTFGLYPACIKYLMFAFDVPEVMAVTRSNICKNGI  866

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRG A IYY SVFLY+WVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYKS
Sbjct  867   QSLSRGYAAIYYASVFLYYWVFSTPVVSLIFGSYLYVCINWFHIHFDEAFSSLRIANYKS  926

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPK+WKLD  W+ EP   QQ S+ RK PSKW ATS  QD
Sbjct  927   FTRFHIKCNGDLEVFTLAVDKVPKKWKLDPKWDGEPKQSQQSSHCRKHPSKWTATSKHQD  986

Query  262   PINTVRVVDHFVIEQTEKSD  203
             P++TVR++D FVI++TE +D
Sbjct  987   PLSTVRIIDQFVIQKTESTD  1006



>ref|XP_010433955.1| PREDICTED: uncharacterized protein LOC104718003 isoform X2 [Camelina 
sativa]
Length=902

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  703  LYQWYKSVENEHFPDPTGLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  762

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  763  ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  822

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
            FTR HI   GDLEVFTL VDKVPKEWKLD +W+ EP+     S+ R+FPSKW AT+LQQD
Sbjct  823  FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPRPTVNMSHHRRFPSKWCATTLQQD  882

Query  262  PINTVRVVDHFVIEQTEK  209
            P+NTV++VDHFVI ++EK
Sbjct  883  PVNTVKIVDHFVISRSEK  900



>ref|XP_009128650.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
 ref|XP_009128652.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
Length=1013

 Score =   335 bits (859),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQD
Sbjct  931   FTRFHIKENKDIEVFTLAVDKVPKDWKLDKDWDAEPKQSGVMSHKREFPSKWCASSAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ TV+VVD+F+I +++  + E
Sbjct  991   PVATVKVVDYFLIHRSQNQNGE  1012



>dbj|BAC81182.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31942.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31123.1| unknown protein [Oryza sativa Japonica Group]
Length=443

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 170/200 (85%), Gaps = 4/200 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  240  LYDWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  299

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  300  MSLSRSVLMMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  359

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   G+LE+FTLAVDKVPK+WKLD  WE E   P Q S+ RK PSKWR++S   D
Sbjct  360  FTRFHIKKDGNLEIFTLAVDKVPKDWKLDPKWEAEERRPHQLSHHRKHPSKWRSSS-SPD  418

Query  262  PINTVRVVDHFVIEQTEKSD  203
            P+ +VRVVDHF I +T  SD
Sbjct  419  PVTSVRVVDHFTISRTRTSD  438



>ref|NP_194031.5| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
 gb|AEE84691.1| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
Length=1015

 Score =   335 bits (858),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 176/203 (87%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  813   LYQWYKSVENEHFPDPTGLRDRIEQWTFGLYPACIKYLMSAFDIPEVMAVTRTNICREGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTL VDKVPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQD
Sbjct  933   FTRFHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPRSTVKMSHHRRFPSKWCATTLQQD  992

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P+NTV++VD FVI ++EK    S
Sbjct  993   PVNTVKIVDKFVIHRSEKETGGS  1015



>emb|CDY52938.1| BnaCnng23820D [Brassica napus]
Length=1013

 Score =   335 bits (858),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 178/202 (88%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQD
Sbjct  931   FTRFHIKENKDIEVFTLAVDKVPKDWKLDKHWDAEPKQSGVMSHKREFPSKWCASSAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ TV+VVD+F+I +++  + E
Sbjct  991   PVATVKVVDYFLIHRSQNQNGE  1012



>ref|NP_001058842.1| Os07g0134500 [Oryza sativa Japonica Group]
 dbj|BAC83511.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20756.1| Os07g0134500 [Oryza sativa Japonica Group]
Length=527

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  322  LYEWYRKVESEHFPDPTGLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  381

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  382  ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKA  441

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFT AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   D
Sbjct  442  FTRFHIKKNGDLEVFTFAVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSD  500

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGS  182
            P N VR+VDHFVI +T      S + S
Sbjct  501  PTNAVRIVDHFVIPRTPPDSPTSGSAS  527



>ref|XP_009102715.1| PREDICTED: uncharacterized protein LOC103828821 [Brassica rapa]
Length=1014

 Score =   334 bits (857),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 175/202 (87%), Gaps = 3/202 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  812   LYQWYKSVESEHFPDPTGLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  872   ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI    D+EVFTLAVDKVPK+W LD +W+ EP+Q    S+ RKFPSKW A+S QQD
Sbjct  932   FTRFHIKKNKDIEVFTLAVDKVPKDWTLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQD  991

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+  V+VVDHFVI +++  + E
Sbjct  992   PVAAVKVVDHFVIYRSQNQNGE  1013



>ref|XP_006286984.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
 gb|EOA19882.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
Length=1013

 Score =   334 bits (856),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  811   LYQWYKSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRSGAVIYYASVFLYFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPK+WKLD  W++EP+Q    SY RK+PSKW A + QQD
Sbjct  931   FTRFHILEDGDIEVFTLAVDKVPKDWKLDKEWDSEPKQSFKMSYERKYPSKWCAPTAQQD  990

Query  262   PINTVRVVDHFVIEQTEKSDS  200
             P+NTV++VD F I ++ K + 
Sbjct  991   PVNTVKIVDRFTIHRSAKENG  1011



>ref|XP_002869795.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46054.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
Length=1015

 Score =   333 bits (855),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 174/198 (88%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WT G YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  813   LYQWYKSVENEHFPDPTGLRDRIEQWTLGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTL VDKVPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQD
Sbjct  933   FTRFHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPRSIVKMSHHRRFPSKWCATTLQQD  992

Query  262   PINTVRVVDHFVIEQTEK  209
             P+NTV++VDHFVI ++EK
Sbjct  993   PVNTVKIVDHFVIRKSEK  1010



>ref|XP_010433954.1| PREDICTED: uncharacterized protein LOC104718003 isoform X1 [Camelina 
sativa]
Length=1013

 Score =   333 bits (854),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  814   LYQWYKSVENEHFPDPTGLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGM  873

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  874   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  933

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTR HI   GDLEVFTL VDKVPKEWKLD +W+ EP+     S+ R+FPSKW AT+LQQD
Sbjct  934   FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPRPTVNMSHHRRFPSKWCATTLQQD  993

Query  262   PINTVRVVDHFVIEQTEK  209
             P+NTV++VDHFVI ++EK
Sbjct  994   PVNTVKIVDHFVISRSEK  1011



>dbj|BAJ98692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   320 bits (820),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EH PDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  296  LYEWYRQAESEHSPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  355

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  356  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKA  415

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   D
Sbjct  416  FTRFHIKKNGDLEVFTLAVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAGSGWSD  475

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  476  PTSVVRVVDQFVIPRT  491



>ref|XP_009392959.1| PREDICTED: uncharacterized protein LOC103978755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   332 bits (851),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC +GM
Sbjct  793  LYEWYRAMEIEHFPDPTGLRARMEKWTFGLYPACIKYLMSAFDIPEVMAVTRGNICNSGM  852

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRG A+IYY SVFLYFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  853  ESLSRGSAIIYYASVFLYFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKA  912

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPK WKLD  W+ E   PQQ S+ R+FPSKW+A S   +
Sbjct  913  FTRFHITVDGDLEVFTLAVDKVPKSWKLDPEWDAEVRLPQQLSHHRRFPSKWKAAS-GPE  971

Query  262  PINTVRVVDHFVIEQTEKSDS  200
            PIN+VRVVDHFVIE+T+ + S
Sbjct  972  PINSVRVVDHFVIERTKPNQS  992



>ref|XP_010448789.1| PREDICTED: uncharacterized protein LOC104731191 isoform X2 [Camelina 
sativa]
Length=901

 Score =   330 bits (847),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC++GM
Sbjct  702  LYQWYKSVENEHFPDPTGLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICRDGM  761

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  762  ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  821

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
            FTR HI   GDLEVFTL VDKVPKEWKLD +W+ EP+   + S+ R FPSKW AT+LQQD
Sbjct  822  FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPKPTVKMSHHRMFPSKWCATTLQQD  881

Query  262  PINTVRVVDHFVIEQTEK  209
            P+NTV++VD FVI ++EK
Sbjct  882  PVNTVKIVDRFVISRSEK  899



>emb|CDY13280.1| BnaC09g23760D [Brassica napus]
Length=1014

 Score =   332 bits (851),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 175/201 (87%), Gaps = 3/201 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM
Sbjct  812   LYQWYKSVESEHFPDPTGLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  872   ESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q    S+ RKFPSKW A+S QQD
Sbjct  932   FTRFHIKKNKDIEVFTLAVDKVPKDWKLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQD  991

Query  262   PINTVRVVDHFVIEQTEKSDS  200
             P+ TV+VVD FVI +++  + 
Sbjct  992   PVATVKVVDRFVIYRSQNQNG  1012



>ref|XP_010529533.1| PREDICTED: uncharacterized protein LOC104806367 [Tarenaya hassleriana]
Length=1014

 Score =   332 bits (851),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 176/197 (89%), Gaps = 3/197 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  813   LYQWYRAVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             + LSR GA IYY SVFLYFWVFSTPVVSLVFGSYLY+CINWLH+HFDEAFSSLRIANYKS
Sbjct  873   EKLSRTGAAIYYASVFLYFWVFSTPVVSLVFGSYLYVCINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GD+EVFTLAVDKVPKEWKLD +W++EP+Q    S+ R +PSKW A+++QQD
Sbjct  933   FTRFHIRRDGDIEVFTLAVDKVPKEWKLDRDWDSEPKQAGKMSHERIYPSKWSASTVQQD  992

Query  262   PINTVRVVDHFVIEQTE  212
             P+N+V++VD FVI ++ 
Sbjct  993   PVNSVKIVDRFVIRKSN  1009



>ref|XP_009392951.1| PREDICTED: uncharacterized protein LOC103978755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1031

 Score =   332 bits (851),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC +GM
Sbjct  827   LYEWYRAMEIEHFPDPTGLRARMEKWTFGLYPACIKYLMSAFDIPEVMAVTRGNICNSGM  886

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRG A+IYY SVFLYFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  887   ESLSRGSAIIYYASVFLYFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKA  946

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPK WKLD  W+ E   PQQ S+ R+FPSKW+A S   +
Sbjct  947   FTRFHITVDGDLEVFTLAVDKVPKSWKLDPEWDAEVRLPQQLSHHRRFPSKWKAAS-GPE  1005

Query  262   PINTVRVVDHFVIEQTEKSDS  200
             PIN+VRVVDHFVIE+T+ + S
Sbjct  1006  PINSVRVVDHFVIERTKPNQS  1026



>ref|XP_008799898.1| PREDICTED: uncharacterized protein LOC103714434 isoform X2 [Phoenix 
dactylifera]
Length=984

 Score =   331 bits (848),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR R+ERWTFGLYPACIKYLMSAFDVPEVMAV R NICK GM
Sbjct  780  LYEWYRSMESEHFPDPTGLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVARSNICKKGM  839

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRGGA+IYY SVFLYFWVFSTPVVSL+FGSYLYI INW H+HFDEAFSSLRIANYK+
Sbjct  840  ESLSRGGAIIYYASVFLYFWVFSTPVVSLIFGSYLYISINWFHIHFDEAFSSLRIANYKA  899

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLA+DKVPK+WKLD  W+ EP+QP   S+ R+FPSKW+A S   D
Sbjct  900  FTRFHITVNGDLEVFTLAIDKVPKKWKLDPEWDAEPKQPQQLSHRRRFPSKWKAAS-GPD  958

Query  262  PINTVRVVDHFVIEQTEKSDSESMNG  185
            P+++VR+VDHFVI+++    +  ++G
Sbjct  959  PVHSVRIVDHFVIQRSHTDLTLEVSG  984



>ref|XP_008799897.1| PREDICTED: uncharacterized protein LOC103714434 isoform X1 [Phoenix 
dactylifera]
Length=1018

 Score =   331 bits (848),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLR R+ERWTFGLYPACIKYLMSAFDVPEVMAV R NICK GM
Sbjct  814   LYEWYRSMESEHFPDPTGLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVARSNICKKGM  873

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRGGA+IYY SVFLYFWVFSTPVVSL+FGSYLYI INW H+HFDEAFSSLRIANYK+
Sbjct  874   ESLSRGGAIIYYASVFLYFWVFSTPVVSLIFGSYLYISINWFHIHFDEAFSSLRIANYKA  933

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLA+DKVPK+WKLD  W+ EP+QP   S+ R+FPSKW+A S   D
Sbjct  934   FTRFHITVNGDLEVFTLAIDKVPKKWKLDPEWDAEPKQPQQLSHRRRFPSKWKAAS-GPD  992

Query  262   PINTVRVVDHFVIEQTEKSDSESMNG  185
             P+++VR+VDHFVI+++    +  ++G
Sbjct  993   PVHSVRIVDHFVIQRSHTDLTLEVSG  1018



>tpg|DAA39654.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=756

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G+
Sbjct  530  LYEWYRKVESEHFPDPTGLRARLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGI  589

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  590  ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKA  649

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTR HI   GDLEVFTLAVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   D
Sbjct  650  FTRLHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLD  708

Query  262  PINTVRVVDHFVIEQTEKS  206
            PIN VR+VD FVI +T  S
Sbjct  709  PINAVRIVDRFVIPRTPSS  727



>ref|XP_010448786.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
 ref|XP_010448787.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
Length=1012

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC++GM
Sbjct  813   LYQWYKSVENEHFPDPTGLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICRDGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTR HI   GDLEVFTL VDKVPKEWKLD +W+ EP+   + S+ R FPSKW AT+LQQD
Sbjct  933   FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAEPKPTVKMSHHRMFPSKWCATTLQQD  992

Query  262   PINTVRVVDHFVIEQTEK  209
             P+NTV++VD FVI ++EK
Sbjct  993   PVNTVKIVDRFVISRSEK  1010



>ref|XP_010932753.1| PREDICTED: uncharacterized protein LOC105053349 isoform X2 [Elaeis 
guineensis]
Length=904

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 4/202 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM
Sbjct  703  LYEWYRSMESEHFPDPTGLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSKICKKGM  762

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL R  A+IYY SVFLYFWVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  763  ESLPRSSAIIYYASVFLYFWVFSTPVVSLIFGSYLYLCINWFHIHFDEAFSSLRIANYKA  822

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI T GDLEVFTLA+DKVPKEWKLD  W+ EP+ P   S++R+FPSKWRA S   D
Sbjct  823  FTRFHITTTGDLEVFTLALDKVPKEWKLDPEWDAEPKPPLQLSHLREFPSKWRAAS-GPD  881

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+N++R+VDHF+I++++  ++ 
Sbjct  882  PVNSIRIVDHFIIQKSQDPNNR  903



>ref|XP_009393277.1| PREDICTED: uncharacterized protein LOC103979011 [Musa acuminata 
subsp. malaccensis]
Length=1017

 Score =   329 bits (844),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R  IC+ G+
Sbjct  814   LYEWYRSMESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSTICRKGI  873

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             ++L RGGA+IYY SVFLYFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  874   ETLPRGGAIIYYASVFLYFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKA  933

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPK+WKLDS W+TEP++P   S++R FPSKW A +   D
Sbjct  934   FTRFHITPTGDLEVFTLAVDKVPKDWKLDSKWDTEPKEPLQLSHLRMFPSKWTAAT-GTD  992

Query  262   PINTVRVVDHFVIEQTEKSDSESMNG  185
             P+N+VR++DHFVI++T    +++ NG
Sbjct  993   PVNSVRIIDHFVIQRTPNPTADA-NG  1017



>ref|XP_006285736.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
 gb|EOA18634.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
Length=1015

 Score =   329 bits (843),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 173/203 (85%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  ENEHFPDPTGLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  813   LYQWYKSVENEHFPDPTGLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICQKGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKS
Sbjct  873   DSLSRSGAAIYYASVFLYFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTR HI   GDLEVFTL VDKVPKEWKLD +W+ E +   + S+ R +PSKW AT LQQD
Sbjct  933   FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDAESRPTVKMSHHRMYPSKWCATILQQD  992

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P+NTV+VVDHFVI ++EK  + S
Sbjct  993   PVNTVKVVDHFVIHRSEKEIAGS  1015



>dbj|BAJ98325.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLR R+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM
Sbjct  331  LYDWYRSMESEHFPDPTGLRTRLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGM  390

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  391  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  450

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE E   P Q  + R++PSKWR+ S   D
Sbjct  451  FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPKWEAEERGPHQLGHHRRYPSKWRSAS-SPD  509

Query  262  PINTVRVVDHFVIEQTEKSDSES  194
            P+ +VRVVDHF I +T   D E+
Sbjct  510  PVRSVRVVDHFTITRTVAPDPET  532



>gb|EMT04291.1| hypothetical protein F775_31134 [Aegilops tauschii]
Length=789

 Score =   324 bits (830),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  583  LYEWYRQAESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  642

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  643  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKA  702

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   D
Sbjct  703  FTRFHIKKSGDLEVFTLAVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAASGWSD  762

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  763  PTSVVRVVDQFVIPRT  778



>ref|XP_004987255.1| PREDICTED: uncharacterized protein LOC101783935 isoform X7 [Setaria 
italica]
Length=698

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  495  LYEWYRSMESEHFPDPTGLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  554

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  555  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  614

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   D
Sbjct  615  FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPD  673

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+ +VRVVDHF IE+T   D E
Sbjct  674  PVRSVRVVDHFTIERTRTPDME  695



>ref|XP_008811244.1| PREDICTED: uncharacterized protein LOC103722455 isoform X2 [Phoenix 
dactylifera]
Length=896

 Score =   326 bits (835),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 176/200 (88%), Gaps = 4/200 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM
Sbjct  695  LYEWYRSMESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGM  754

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL R  A+IYY SVFLYFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+
Sbjct  755  ESLPRSSAIIYYASVFLYFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKA  814

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
            FTRFHI + GDLEVFTLA+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   D
Sbjct  815  FTRFHITSTGDLEVFTLALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPD  873

Query  262  PINTVRVVDHFVIEQTEKSD  203
            P+N++R+VDHF+I++++ ++
Sbjct  874  PVNSMRIVDHFIIQKSQDAN  893



>gb|KFK28866.1| hypothetical protein AALP_AA7G058700 [Arabis alpina]
Length=1015

 Score =   328 bits (840),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 174/203 (86%), Gaps = 3/203 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WY+  E+EHFPDPTGLR R+E+ TFGLYPACIKYLMSAFD+PEVMAVTR NIC+ GM
Sbjct  813   LYQWYKSVEDEHFPDPTGLRVRMEQLTFGLYPACIKYLMSAFDIPEVMAVTRTNICREGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +S SR GA IYY SVFLYFWVFSTP+VSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESFSRSGAAIYYASVFLYFWVFSTPIVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQD  263
             FTR HI   GDLEVFTL VDKVPKEWKLD +W++EP   ++ S+ R+FPSKW AT+L QD
Sbjct  933   FTRLHIKPDGDLEVFTLGVDKVPKEWKLDKDWDSEPKPTEKMSHHRRFPSKWCATALHQD  992

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             PINTV++VD FVI ++EK    S
Sbjct  993   PINTVKIVDRFVIHRSEKETGGS  1015



>ref|XP_010932752.1| PREDICTED: uncharacterized protein LOC105053349 isoform X1 [Elaeis 
guineensis]
Length=1015

 Score =   328 bits (840),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 4/202 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM
Sbjct  814   LYEWYRSMESEHFPDPTGLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSKICKKGM  873

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SL R  A+IYY SVFLYFWVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  874   ESLPRSSAIIYYASVFLYFWVFSTPVVSLIFGSYLYLCINWFHIHFDEAFSSLRIANYKA  933

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI T GDLEVFTLA+DKVPKEWKLD  W+ EP+ P   S++R+FPSKWRA S   D
Sbjct  934   FTRFHITTTGDLEVFTLALDKVPKEWKLDPEWDAEPKPPLQLSHLREFPSKWRAAS-GPD  992

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+N++R+VDHF+I++++  ++ 
Sbjct  993   PVNSIRIVDHFIIQKSQDPNNR  1014



>ref|XP_008651926.1| PREDICTED: uncharacterized protein LOC103631870 isoform X5 [Zea 
mays]
 ref|XP_008651927.1| PREDICTED: uncharacterized protein LOC103631870 isoform X5 [Zea 
mays]
Length=762

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM
Sbjct  559  LYEWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGM  618

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  619  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  678

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFH+   GDLE+FTLAVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   D
Sbjct  679  FTRFHVKKDGDLEIFTLAVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STD  737

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+ +VRVVDHF IE+T   D E
Sbjct  738  PVRSVRVVDHFTIERTRTPDME  759



>gb|EEE66522.1| hypothetical protein OsJ_22999 [Oryza sativa Japonica Group]
Length=821

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  616  LYEWYRKVESEHFPDPTGLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  675

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  676  ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKA  735

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFT AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   D
Sbjct  736  FTRFHIKKNGDLEVFTFAVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSD  794

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGS  182
            P N VR+VDHFVI +T      S + S
Sbjct  795  PTNAVRIVDHFVIPRTPPDSPTSGSAS  821



>ref|XP_006657430.1| PREDICTED: uncharacterized protein LOC102702861 [Oryza brachyantha]
Length=1021

 Score =   327 bits (838),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 4/196 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLR R+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  815   LYEWYRKVESEHFPDPTGLRTRLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  875   ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKA  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPKEW LD +W+ EP++P   SY RKFPSKWRA S   D
Sbjct  935   FTRFHIKKNGDLEVFTLAVDKVPKEWMLDPDWDMEPKEPFQMSYSRKFPSKWRAAS-GSD  993

Query  262   PINTVRVVDHFVIEQT  215
             P N VRVVDHFVI +T
Sbjct  994   PTNAVRVVDHFVISRT  1009



>ref|XP_004987258.1| PREDICTED: uncharacterized protein LOC101786352 isoform X2 [Setaria 
italica]
Length=762

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  559  LYEWYRSMESEHFPDPTGLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  618

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  619  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  678

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   D
Sbjct  679  FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPD  737

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+ +VRVVDHF IE+T   D E
Sbjct  738  PVRSVRVVDHFTIERTRTPDME  759



>ref|XP_008811243.1| PREDICTED: uncharacterized protein LOC103722455 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score =   326 bits (835),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 176/200 (88%), Gaps = 4/200 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM
Sbjct  814   LYEWYRSMESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGM  873

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SL R  A+IYY SVFLYFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+
Sbjct  874   ESLPRSSAIIYYASVFLYFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKA  933

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQD  263
             FTRFHI + GDLEVFTLA+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   D
Sbjct  934   FTRFHITSTGDLEVFTLALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPD  992

Query  262   PINTVRVVDHFVIEQTEKSD  203
             P+N++R+VDHF+I++++ ++
Sbjct  993   PVNSMRIVDHFIIQKSQDAN  1012



>ref|XP_002461307.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
 gb|EER97828.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
Length=1018

 Score =   326 bits (835),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 172/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  815   LYEWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  875   MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLE+FTLAVDKVPK WKLD  WE+E   P Q S+ RK PSKWR+ S   D
Sbjct  935   FTRFHIKKDGDLEIFTLAVDKVPKGWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-SPD  993

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ +VRVVDHF IE+T  SD+E
Sbjct  994   PVRSVRVVDHFTIERTRTSDTE  1015



>ref|XP_010538790.1| PREDICTED: uncharacterized protein LOC104813013 [Tarenaya hassleriana]
Length=1007

 Score =   325 bits (834),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 174/195 (89%), Gaps = 1/195 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM
Sbjct  813   LYQWYRSVESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKDGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSR GA IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  873   ESLSRTGAGIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQ-PSYVRKFPSKWRATSLQQDPI  257
             FTRFHI   GD+EVFTLAVDKVPKEWKLDS+W++EP+Q  S+ R  PSKW A++   DP+
Sbjct  933   FTRFHIRRDGDIEVFTLAVDKVPKEWKLDSDWDSEPRQMMSHHRTHPSKWSASASHHDPL  992

Query  256   NTVRVVDHFVIEQTE  212
             ++V++VD F+I ++ 
Sbjct  993   HSVKIVDRFLISKSN  1007



>gb|EMS63037.1| hypothetical protein TRIUR3_32981 [Triticum urartu]
Length=913

 Score =   324 bits (830),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  707  LYEWYRQAESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  766

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  767  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKA  826

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   D
Sbjct  827  FTRFHIKKNGDLEVFTLAVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAASGWSD  886

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  887  PTSVVRVVDQFVIPRT  902



>gb|EEC81473.1| hypothetical protein OsI_24798 [Oryza sativa Indica Group]
Length=935

 Score =   324 bits (830),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  730  LYEWYRKVESEHFPDPTGLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  789

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  790  ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKA  849

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFT AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   D
Sbjct  850  FTRFHIKKNGDLEVFTFAVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSD  908

Query  262  PINTVRVVDHFVIEQTEKSDSESMNGS  182
            P N VR+VDHFVI +T      S + S
Sbjct  909  PTNAVRIVDHFVIPRTPPDSPTSGSAS  935



>ref|XP_008651925.1| PREDICTED: uncharacterized protein LOC103631870 isoform X4 [Zea 
mays]
Length=907

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM
Sbjct  704  LYEWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGM  763

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  764  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  823

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
            FTRFH+   GDLE+FTLAVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   D
Sbjct  824  FTRFHVKKDGDLEIFTLAVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STD  882

Query  262  PINTVRVVDHFVIEQTEKSDSE  197
            P+ +VRVVDHF IE+T   D E
Sbjct  883  PVRSVRVVDHFTIERTRTPDME  904



>ref|XP_010238514.1| PREDICTED: uncharacterized protein LOC100842069 isoform X3 [Brachypodium 
distachyon]
Length=762

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  556  LYEWYRKAESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGI  615

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  616  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKA  675

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   D
Sbjct  676  FTRFHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSD  735

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  736  PTSVVRVVDQFVIPRT  751



>ref|XP_008670049.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 ref|XP_008670050.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 tpg|DAA39653.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=1041

 Score =   325 bits (832),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRAR+E WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G+
Sbjct  815   LYEWYRKVESEHFPDPTGLRARLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGI  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  875   ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKA  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTR HI   GDLEVFTLAVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   D
Sbjct  935   FTRLHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLD  993

Query  262   PINTVRVVDHFVIEQTEKS  206
             PIN VR+VD FVI +T  S
Sbjct  994   PINAVRIVDRFVIPRTPSS  1012



>gb|EPS68439.1| hypothetical protein M569_06328, partial [Genlisea aurea]
Length=1008

 Score =   324 bits (831),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 171/200 (86%), Gaps = 8/200 (4%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R +IC+NGM
Sbjct  811   LYEWYRSVEVEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNSICRNGM  870

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRG A+IYY SVFLYFWVFSTPVVSL+FGSYLY CINWLH+HFDEAFSSLRIANYKS
Sbjct  871   ESLSRGVAIIYYASVFLYFWVFSTPVVSLIFGSYLYFCINWLHIHFDEAFSSLRIANYKS  930

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE-----PQQPSYVRKFPSKWRATSLQ  269
             FTRFHIN  GDLEV+TLA   VPKEWKLD  WE E     P   S++RKFPSKWRA S Q
Sbjct  931   FTRFHINPTGDLEVYTLA---VPKEWKLDQKWEGESKTSPPNLSSHLRKFPSKWRAVSSQ  987

Query  268   QDPINTVRVVDHFVIEQTEK  209
              DP+ T++++D FVIE+T K
Sbjct  988   HDPLTTLKIIDQFVIERTVK  1007



>ref|XP_002461963.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
 gb|EER98484.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
Length=936

 Score =   322 bits (824),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR R+E WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  724  LYEWYRKVESEHFPDPTGLRTRLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGI  783

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  784  ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKA  843

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   D
Sbjct  844  FTRFHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLD  902

Query  262  PINTVRVVDHFVI  224
            PIN VR+VD FVI
Sbjct  903  PINAVRIVDRFVI  915



>ref|XP_008651921.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 ref|XP_008651922.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 tpg|DAA59346.1| TPA: hypothetical protein ZEAMMB73_449975 [Zea mays]
Length=1018

 Score =   322 bits (826),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM
Sbjct  815   LYEWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGM  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  875   MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFH+   GDLE+FTLAVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   D
Sbjct  935   FTRFHVKKDGDLEIFTLAVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STD  993

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ +VRVVDHF IE+T   D E
Sbjct  994   PVRSVRVVDHFTIERTRTPDME  1015



>ref|XP_011627911.1| PREDICTED: uncharacterized protein LOC18446479 [Amborella trichopoda]
Length=1019

 Score =   322 bits (824),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 172/196 (88%), Gaps = 3/196 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPT LRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  815   LYEWYRSVESEHFPDPTELRARLEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKRGL  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRG A+IYY SVFLYFWVFSTPVVSLVFG YLY+CINWLHVHFDEAFSSLRIANYKS
Sbjct  875   ESLSRGHAIIYYASVFLYFWVFSTPVVSLVFGCYLYLCINWLHVHFDEAFSSLRIANYKS  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI+ KGDLEV+TLAVDKVPK+WKLD +W+ E +Q    S++R++PSKW A     D
Sbjct  935   FTRFHISPKGDLEVYTLAVDKVPKDWKLDPDWDGELKQQQKFSHLRRYPSKWSAAVSNHD  994

Query  262   PINTVRVVDHFVIEQT  215
             P++TVR+VD FVI +T
Sbjct  995   PLSTVRIVDQFVIHRT  1010



>ref|XP_004987257.1| PREDICTED: uncharacterized protein LOC101786352 isoform X1 [Setaria 
italica]
Length=1018

 Score =   322 bits (824),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPTGLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  815   LYEWYRSMESEHFPDPTGLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  875   MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   D
Sbjct  935   FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPD  993

Query  262   PINTVRVVDHFVIEQTEKSDSE  197
             P+ +VRVVDHF IE+T   D E
Sbjct  994   PVRSVRVVDHFTIERTRTPDME  1015



>gb|ERN18128.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
Length=1067

 Score =   322 bits (825),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 172/196 (88%), Gaps = 3/196 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E+EHFPDPT LRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+
Sbjct  863   LYEWYRSVESEHFPDPTELRARLEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKRGL  922

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRG A+IYY SVFLYFWVFSTPVVSLVFG YLY+CINWLHVHFDEAFSSLRIANYKS
Sbjct  923   ESLSRGHAIIYYASVFLYFWVFSTPVVSLVFGCYLYLCINWLHVHFDEAFSSLRIANYKS  982

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI+ KGDLEV+TLAVDKVPK+WKLD +W+ E +Q    S++R++PSKW A     D
Sbjct  983   FTRFHISPKGDLEVYTLAVDKVPKDWKLDPDWDGELKQQQKFSHLRRYPSKWSAAVSNHD  1042

Query  262   PINTVRVVDHFVIEQT  215
             P++TVR+VD FVI +T
Sbjct  1043  PLSTVRIVDQFVIHRT  1058



>ref|XP_003557697.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
 ref|XP_010228472.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
Length=1016

 Score =   321 bits (822),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 171/203 (84%), Gaps = 4/203 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM
Sbjct  813   LYDWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  873   MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE E   P Q S+ R++PSKWR+ S   D
Sbjct  933   FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPKWEAEERGPHQLSHDRRYPSKWRSAS-SPD  991

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P+ +VRVVDHF I +T   D E+
Sbjct  992   PVRSVRVVDHFTITRTRAPDPET  1014



>ref|XP_010238513.1| PREDICTED: uncharacterized protein LOC100842069 isoform X2 [Brachypodium 
distachyon]
Length=1003

 Score =   319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  797  LYEWYRKAESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGI  856

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  857  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKA  916

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   D
Sbjct  917  FTRFHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSD  976

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  977  PTSVVRVVDQFVIPRT  992



>ref|XP_010238512.1| PREDICTED: uncharacterized protein LOC100842069 isoform X1 [Brachypodium 
distachyon]
Length=1003

 Score =   319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G+
Sbjct  797  LYEWYRKAESEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGI  856

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SL RGGA+IYY SVFLYFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+
Sbjct  857  ESLPRGGAIIYYVSVFLYFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKA  916

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQD  263
            FTRFHI   GDLEVFTLAVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   D
Sbjct  917  FTRFHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSD  976

Query  262  PINTVRVVDHFVIEQT  215
            P + VRVVD FVI +T
Sbjct  977  PTSVVRVVDQFVIPRT  992



>ref|NP_001058702.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAC81181.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31941.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20616.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAG93283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81383.1| hypothetical protein OsI_24595 [Oryza sativa Indica Group]
 gb|EEE66435.1| hypothetical protein OsJ_22800 [Oryza sativa Japonica Group]
Length=1016

 Score =   319 bits (818),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 171/203 (84%), Gaps = 4/203 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  813   LYDWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  872

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  873   MSLSRSVLMMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  932

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQD  263
             FTRFHI   G+LE+FTLAVDKVPK+WKLD  WE E   P Q S+ RK PSKWR++S   D
Sbjct  933   FTRFHIKKDGNLEIFTLAVDKVPKDWKLDPKWEAEERRPHQLSHHRKHPSKWRSSS-SPD  991

Query  262   PINTVRVVDHFVIEQTEKSDSES  194
             P+ +VRVVDHF I +T  SD  +
Sbjct  992   PVTSVRVVDHFTISRTRTSDPNT  1014



>ref|XP_004956163.1| PREDICTED: uncharacterized protein LOC101776542 [Setaria italica]
Length=1021

 Score =   318 bits (815),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 167/195 (86%), Gaps = 4/195 (2%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LYEWYR  E EHFPDPTGLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G+
Sbjct  815   LYEWYRKVEGEHFPDPTGLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGI  874

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SL RGGA+IYY  VFLYFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+
Sbjct  875   ESLPRGGAIIYYVCVFLYFWVLSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKA  934

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI   GDLEVFTLAVDKVPK+W LD +W+ EP+ P   SY R+FPSKWR+ S   D
Sbjct  935   FTRFHIKKNGDLEVFTLAVDKVPKDWMLDPDWDMEPKPPLQMSYTRRFPSKWRSAS-GPD  993

Query  262   PINTVRVVDHFVIEQ  218
             PI++VR++D FVI +
Sbjct  994   PISSVRIIDRFVIPR  1008



>gb|KCW86241.1| hypothetical protein EUGRSUZ_B02927 [Eucalyptus grandis]
Length=1051

 Score =   306 bits (784),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 173/210 (82%), Gaps = 3/210 (1%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E E+FPDPTGLR R+E+WTFGLYPACIKYLMSAFDVPEVMAV+R +IC+N M
Sbjct  818   LYQWYRTVECEYFPDPTGLRVRMEQWTFGLYPACIKYLMSAFDVPEVMAVSRTDICQNRM  877

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +SLSRG   IYY SVF+YFWVFSTPVVSLVFGSYLYIC+NWLH+H+DEAFSSLRIA+YK 
Sbjct  878   ESLSRGVVAIYYASVFVYFWVFSTPVVSLVFGSYLYICVNWLHLHYDEAFSSLRIADYKG  937

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQD  263
             FTRFHI+ KGDLEV+TLAVD+VPK+W  D +W  EP QP   S++RKFPS WR+    +D
Sbjct  938   FTRFHIDKKGDLEVYTLAVDEVPKDWNPDPDWRNEPHQPERSSHLRKFPSMWRSADPLKD  997

Query  262   PINTVRVVDHFVIEQTEKSDSESMNGSKTQ  173
             P+ TVR+ D+FVI +  ++  E+   ++ +
Sbjct  998   PVKTVRIEDYFVIHRNGENRQETPGPAQPE  1027



>ref|XP_010540555.1| PREDICTED: uncharacterized protein LOC104814278 isoform X2 [Tarenaya 
hassleriana]
Length=991

 Score =   305 bits (782),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GA IYY SVFL
Sbjct  809  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGMESLSRTGAAIYYASVFL  868

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  869  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIRRDGDIEVFTL  928

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPK+WKLD +W++EP+Q    S+ R++PSKW AT+ QQDP+NTV++VD FVI ++ 
Sbjct  929  AIDKVPKDWKLDRDWDSEPKQAGKMSHERRYPSKWCATTAQQDPVNTVKIVDRFVIRKSG  988

Query  211  K  209
            +
Sbjct  989  R  989



>ref|XP_010044199.1| PREDICTED: uncharacterized protein LOC104433215 [Eucalyptus grandis]
Length=1193

 Score =   305 bits (780),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 3/203 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+ YR  E+EHFPDP GL+AR+E+WT+GLYPACIKYLMSAFD+ EVMAV+R+NIC+ GM
Sbjct  783  LYQRYRAVESEHFPDPKGLQARMEQWTYGLYPACIKYLMSAFDILEVMAVSRRNICQEGM  842

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +SLSRG A IYY SVF+YFWVFSTPVVSLVFGSYLYIC+NW H+H+DEAFSSLRIANYK 
Sbjct  843  ESLSRGSAAIYYASVFVYFWVFSTPVVSLVFGSYLYICVNWFHLHYDEAFSSLRIANYKG  902

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW---ETEPQQPSYVRKFPSKWRATSLQQD  263
            FTRFHIN KGDLEV+TLAVD+VP+EWK D NW   +  P++ S++R FPS+W +    +D
Sbjct  903  FTRFHINKKGDLEVYTLAVDEVPEEWKRDPNWWKEQKRPERRSHLRNFPSQWSSADPSKD  962

Query  262  PINTVRVVDHFVIEQTEKSDSES  194
            P+ TVR+VD FVI +   S  E+
Sbjct  963  PVKTVRIVDRFVIHRNGASHQET  985



>ref|XP_004987249.1| PREDICTED: uncharacterized protein LOC101783935 isoform X1 [Setaria 
italica]
 ref|XP_004987250.1| PREDICTED: uncharacterized protein LOC101783935 isoform X2 [Setaria 
italica]
 ref|XP_004987251.1| PREDICTED: uncharacterized protein LOC101783935 isoform X3 [Setaria 
italica]
 ref|XP_004987252.1| PREDICTED: uncharacterized protein LOC101783935 isoform X4 [Setaria 
italica]
 ref|XP_004987253.1| PREDICTED: uncharacterized protein LOC101783935 isoform X5 [Setaria 
italica]
 ref|XP_004987254.1| PREDICTED: uncharacterized protein LOC101783935 isoform X6 [Setaria 
italica]
Length=702

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 3/174 (2%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM
Sbjct  495  LYEWYRSMESEHFPDPTGLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGM  554

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  555  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  614

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRA  281
            FTRFHI   GDLE+FTLAVDKVPK+WKLD  WE++   P Q S+ RK PSKWR 
Sbjct  615  FTRFHIKKDGDLEIFTLAVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRC  668



>ref|XP_002974647.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
 gb|EFJ24167.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
Length=999

 Score =   298 bits (762),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  ENEHFPDPTGLRAR+ERWT GLYPAC+KYLMSAFDVPEVMAVTR NIC+ G+
Sbjct  807  LYEWYRSVENEHFPDPTGLRARMERWTLGLYPACLKYLMSAFDVPEVMAVTRSNICRTGL  866

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DS+SRG  +IYY+SVFLYFWVFSTPVVS +FGSYLY CINWL++HFDEAFSSLRIANYKS
Sbjct  867  DSMSRGFKLIYYSSVFLYFWVFSTPVVSFIFGSYLYTCINWLNLHFDEAFSSLRIANYKS  926

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ-QPSYVRKFPSKWRATSLQQDPI  257
            F R H+   GDLEV+TLAVDKVPKEW LD  W+ E    PSY RK+PS+W      +D  
Sbjct  927  FLRCHVTKTGDLEVYTLAVDKVPKEWMLDPLWDEEQSVSPSYSRKYPSQWIPLPPYRDAN  986

Query  256  NTVRVVDHFVIEQ  218
              VRV+DHFV+ +
Sbjct  987  CNVRVIDHFVVSK  999



>ref|XP_002963358.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
 gb|EFJ35229.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
Length=999

 Score =   298 bits (762),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  ENEHFPDPTGLRAR+ERWT GLYPAC+KYLMSAFDVPEVMAVTR NIC+ G+
Sbjct  807  LYEWYRSVENEHFPDPTGLRARMERWTLGLYPACLKYLMSAFDVPEVMAVTRSNICRTGL  866

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DS+SRG  +IYY+SVFLYFWVFSTPVVS +FGSYLY CINWL++HFDEAFSSLRIANYKS
Sbjct  867  DSMSRGFKLIYYSSVFLYFWVFSTPVVSFIFGSYLYTCINWLNLHFDEAFSSLRIANYKS  926

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ-QPSYVRKFPSKWRATSLQQDPI  257
            F R H+   GDLEV+TLAVDKVPKEW LD  W+ E    PSY RK+PS+W      +D  
Sbjct  927  FLRCHVTKTGDLEVYTLAVDKVPKEWMLDPLWDEEQSVSPSYSRKYPSQWIPLPPYRDAN  986

Query  256  NTVRVVDHFVIEQ  218
              VRV+DHFV+ +
Sbjct  987  CNVRVIDHFVVSK  999



>ref|XP_001765009.1| predicted protein [Physcomitrella patens]
 gb|EDQ70225.1| predicted protein [Physcomitrella patens]
Length=1105

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 158/210 (75%), Gaps = 6/210 (3%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY +Y   E EHFPDPTGLRARIE WT G YPACIKYLM+AFDVPEVMAVTR NICK+GM
Sbjct  812   LYSFYHTKEGEHFPDPTGLRARIEYWTMGFYPACIKYLMAAFDVPEVMAVTRANICKSGM  871

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             DSL RG  + YY SVFLY+WVFSTPVVSLVFGSYLY CINW H+HFDEAFSSLRIANYKS
Sbjct  872   DSLPRGFVLAYYASVFLYYWVFSTPVVSLVFGSYLYACINWFHLHFDEAFSSLRIANYKS  931

Query  433   FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETE----PQQPSYVRKFPSKWRATSLQQ  266
             F RFHIN+ GDL V+TLA DKVPKEW LD  WE E    P  PS+ R  PS+W      +
Sbjct  932   FNRFHINSDGDLHVYTLAADKVPKEWALDPEWEAEQAEKPDLPSHKRSCPSQWTPVGHIR  991

Query  265   DPINTVRVVDHFVI--EQTEKSDSESMNGS  182
             D  + VRV+D FVI   ++  S+  S  G+
Sbjct  992   DRFSKVRVIDEFVIPKRRSPMSNGASEKGT  1021



>emb|CDX86747.1| BnaA09g21370D [Brassica napus]
Length=165

 Score =   265 bits (678),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = -2

Query  679  MSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYIC  500
            MSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYIC
Sbjct  1    MSAFDVPEVMAVTRNNICKEGMESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYIC  60

Query  499  INWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQ  320
            INWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q
Sbjct  61   INWLHIHFDEAFSSLRIANYKSFTRFHIKKNKDIEVFTLAVDKVPKDWKLDKDWDAEPKQ  120

Query  319  P---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKSDSE  197
                S+ RKFPSKW A+S QQDP+  V+VVDHFVI +++  + E
Sbjct  121  SGVMSHKRKFPSKWCASSAQQDPVAAVKVVDHFVIYRSQNQNGE  164



>gb|KDO84270.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=438

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM
Sbjct  249  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGM  308

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGAVIYY SVFLYFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+
Sbjct  309  QSLSRGGAVIYYASVFLYFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKA  368

Query  433  FTRFHINTKGDLEVFTLAVDKVPK  362
            FTRFHIN  GDLEV+TLAVDKV K
Sbjct  369  FTRFHINHDGDLEVYTLAVDKVRK  392



>gb|KJB58438.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=957

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDP+GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+
Sbjct  812  LYQWYRSVESEHFPDPSGLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGI  871

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             +LSRGGAVIYY S+FLYFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  872  QALSRGGAVIYYASIFLYFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKS  931

Query  433  FTRFHINTKGDLEVFTLAVDKV  368
            FTRFHIN  GDLEVFTLAVDKV
Sbjct  932  FTRFHINRDGDLEVFTLAVDKV  953



>gb|KEH40050.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=954

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG+
Sbjct  808  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGL  867

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            +S+SRGGA+IYY +VFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  868  ESVSRGGAIIYYAAVFLYFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKS  927

Query  433  FTRFHINTKGDLEVFTLAVDKV  368
            FTRFHI++ G+LEVFTLAVDKV
Sbjct  928  FTRFHISSDGNLEVFTLAVDKV  949



>gb|KHG27254.1| aat [Gossypium arboreum]
Length=1004

 Score =   268 bits (684),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WY+  E EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+
Sbjct  821  LYQWYQSVETEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGI  880

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSRGGA+IYY SVFLYFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKS
Sbjct  881  QSLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKS  940

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEW  356
            FTRFHIN  GDLEVFTLA+DKV  ++
Sbjct  941  FTRFHINRDGDLEVFTLAIDKVRSQY  966



>ref|XP_010062117.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010062119.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
Length=1058

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  793   LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
             LY+WYR  E+EHFPDPTGLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+
Sbjct  903   LYQWYREVESEHFPDPTGLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGL  962

Query  613   DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              SLSRGGA IYY SVFLYFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+
Sbjct  963   ASLSRGGAAIYYASVFLYFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKA  1022

Query  433   FTRFHINTKGDLEVFTLAVDK  371
             FTRFHIN+ GDLEV+TLAVDK
Sbjct  1023  FTRFHINSDGDLEVYTLAVDK  1043



>ref|XP_008651923.1| PREDICTED: uncharacterized protein LOC103631870 isoform X2 [Zea 
mays]
 ref|XP_008651924.1| PREDICTED: uncharacterized protein LOC103631870 isoform X3 [Zea 
mays]
Length=978

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LYEWYR  E+EHFPDPTGLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM
Sbjct  815  LYEWYRSMESEHFPDPTGLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGM  874

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  875  MSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKS  934

Query  433  FTRFHINTKGDLEVFTLAVDKVPKE  359
            FTRFH+   GDLE+FTLAVDKV  +
Sbjct  935  FTRFHVKKDGDLEIFTLAVDKVTDQ  959



>gb|EMT21375.1| hypothetical protein F775_01280 [Aegilops tauschii]
Length=661

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  739  LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
            L+ R + W F +    I +++     P+VMAVTR NICKNGM SLSR   ++YYTSVF+Y
Sbjct  476  LKFRKKNWQFDIIGGFIYFILVFSMFPQVMAVTRINICKNGMMSLSRSVLIMYYTSVFIY  535

Query  559  FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
            FW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTR HI   GDLE+FTLA
Sbjct  536  FWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRLHIKKDGDLEIFTLA  595

Query  379  VDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
            VDKVPK+WKLD  WE E   P Q S+ R++PSKWR+ S   DP+ +VRVVDHF I +T  
Sbjct  596  VDKVPKDWKLDPKWEAEERGPHQLSHHRRYPSKWRSAS-SPDPVRSVRVVDHFTITRTVA  654

Query  208  SDSES  194
             D E+
Sbjct  655  PDPET  659



>ref|XP_001772190.1| predicted protein [Physcomitrella patens]
 gb|EDQ63003.1| predicted protein, partial [Physcomitrella patens]
Length=945

 Score =   240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY WY   E EHFPDP GLR RIE WTFG+YPACIKYLM+AFDVPEVMAVTR NIC+ GM
Sbjct  799  LYAWYHSKEGEHFPDPMGLRGRIEHWTFGMYPACIKYLMAAFDVPEVMAVTRNNICEQGM  858

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              L RG  ++YY +VFLY+W+FS P+VSLVFGSYLYICINW H+HFDEAFSSLRIANYKS
Sbjct  859  SRLPRGLVLVYYATVFLYYWIFSCPIVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKS  918

Query  433  FTRFHINTKGDLEVFTLAVDKV  368
            FTR HI++KGDL ++TLA+DKV
Sbjct  919  FTRCHISSKGDLHIYTLAIDKV  940



>gb|KCW44765.1| hypothetical protein EUGRSUZ_L01670 [Eucalyptus grandis]
Length=679

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = -2

Query  748  PTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSV  569
            PT    R    T GLY AC +++ SAFD  EVMAV+R +IC+ GM+S+SRG A IYY SV
Sbjct  279  PTSGYDRSYEQTLGLYSACTEFIKSAFDCLEVMAVSRIDICRRGMESMSRGTAAIYYASV  338

Query  568  FLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVF  389
              YFWV S PVVSLVFGSYLY+C  WLH+H+DEAFSSLRIA+YK FTRFHIN +GDLE++
Sbjct  339  LHYFWVISNPVVSLVFGSYLYVCAKWLHLHYDEAFSSLRIADYKGFTRFHINKEGDLEIY  398

Query  388  TLAVDKVPKEWKLDSNWETEPQQ-----PSYVRKFPSKW-RATSLQQDPINTVRVVDHFV  227
            TL VDKVP++WK D  WE E +Q      S++RKFPSKW  A   + DP+ TVR+VD+FV
Sbjct  399  TLVVDKVPEKWKRDKRWEEEEKQREKTERSHLRKFPSKWISADPSKGDPVETVRIVDYFV  458

Query  226  IEQTEKSDSES  194
            I++  +S  ES
Sbjct  459  IQRNGESHQES  469



>ref|XP_010040937.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104429834 
[Eucalyptus grandis]
Length=1187

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = -2

Query  748  PTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSV  569
            PT    R    T GLY AC +++ SAFD  EVMAV+R +IC+ GM+S+SRG A IYY SV
Sbjct  787  PTSGYDRSYEQTLGLYSACTEFIKSAFDCLEVMAVSRIDICRRGMESMSRGTAAIYYASV  846

Query  568  FLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVF  389
              YFWV S PVVSLVFGSYLY+C  WLH+H+DEAFSSLRIA+YK FTRFHIN +GDLE++
Sbjct  847  LHYFWVISNPVVSLVFGSYLYVCAKWLHLHYDEAFSSLRIADYKGFTRFHINKEGDLEIY  906

Query  388  TLAVDKVPKEWKLDSNWETEPQQ-----PSYVRKFPSKW-RATSLQQDPINTVRVVDHFV  227
            TL VDKVP++WK D  WE E +Q      S++RKFPSKW  A   + DP+ TVR+VD+FV
Sbjct  907  TLVVDKVPEKWKRDKRWEEEEKQREKTERSHLRKFPSKWISADPSKGDPVETVRIVDYFV  966

Query  226  IEQTEKSDSES  194
            I++  +S  ES
Sbjct  967  IQRNGESHQES  977



>gb|KDD72728.1| hypothetical protein H632_c2969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=408

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 131/209 (63%), Gaps = 15/209 (7%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            +Y WYR  E E F DP GLRAR+ERWT GLYP  +++ M+ FDVP+++AV R  +C+   
Sbjct  202  MYRWYRAYEAEAFADPAGLRARLERWTLGLYPGVLRWGMTLFDVPDLIAVARAQLCQG--  259

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
             ++SR  A+ YY  V  Y+WV +TP V L+FG+YLY+ +NW+ VH+DEAFSSL+I +YK 
Sbjct  260  QAVSRAAALGYYAGVLAYYWVLATPSVGLLFGAYLYVAVNWMGVHYDEAFSSLQIPDYKG  319

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWET------EPQQPSYVRKFPSKWRA---  281
            F R H++  GDLE+F+LA+D+VP+ W+ D  W            PS+    PS+W A   
Sbjct  320  FLRLHVSPAGDLEIFSLALDRVPRTWREDPRWRGLRGGGGAGAAPSWRAALPSRWAAVRR  379

Query  280  ----TSLQQDPINTVRVVDHFVIEQTEKS  206
                T L   P   VRVVD+  + +   +
Sbjct  380  QGHHTLLADQPEEQVRVVDYLKVPRRRDA  408



>ref|XP_011397366.1| hypothetical protein F751_3196 [Auxenochlorella protothecoides]
 gb|KFM24478.1| hypothetical protein F751_3196 [Auxenochlorella protothecoides]
Length=728

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 124/204 (61%), Gaps = 14/204 (7%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E  HFPDP  +R   ERWT GLYP  IK+ M+AFD PE +AV+R  +C    
Sbjct  521  LYKWYRQYEAAHFPDPADMRGAAERWTLGLYPGAIKWAMAAFDAPEAIAVSRDLLCAG--  578

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              L+R  A+ YY  V  Y+W+ +TP V+LVFG+YLYIC+NW  VH+DEAFSSL++ ++K 
Sbjct  579  RELNRLQALGYYGGVLAYYWLLATPTVALVFGAYLYICVNWFGVHYDEAFSSLQVPDHKG  638

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQ  269
            F R HI   GDLE+F+L +D VP+ W+ D  W       +   P +  + PS+W    ++
Sbjct  639  FLRMHITPAGDLEIFSLGLDTVPRAWREDPAWRAPGGGGDAGVPGWRARHPSRWVPVEVR  698

Query  268  QD-------PINTVRVVDHFVIEQ  218
                     P   ++VVD+  + +
Sbjct  699  GGYTLRGTPPEAALKVVDYLHVPR  722



>ref|XP_002954875.1| hypothetical protein VOLCADRAFT_65342 [Volvox carteri f. nagariensis]
 gb|EFJ44074.1| hypothetical protein VOLCADRAFT_65342, partial [Volvox carteri 
f. nagariensis]
Length=572

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 122/196 (62%), Gaps = 9/196 (5%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNG-  617
            LY WYR  E +HFPDP GLR  ++R T GLYP  ++  M  +DVPE++AV R  +C+ G 
Sbjct  307  LYRWYREYEEQHFPDPMGLRQLLQRCTLGLYPGALQLAMGVYDVPELIAVARTTMCEAGG  366

Query  616  -MDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANY  440
             ++S+SR  A+ YY  +  Y+W+ +TP V  VFG YLYI + W HVH+DEAFSSLR  + 
Sbjct  367  SLESISRLQALSYYAGMLAYYWLLATPAVGFVFGLYLYISVCWFHVHYDEAFSSLREVSC  426

Query  439  KSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW-----ETEPQQPSYVRKFPSKWRATS  275
            KSF R HI   GDL+++TLA+D+VP  W+ D  W        P   ++   +PS+W  T 
Sbjct  427  KSFCRLHIGPSGDLQLYTLALDEVPTRWQEDPRWRGRGGGGNPGVVAHEAHYPSRWVPTR  486

Query  274  LQ--QDPINTVRVVDH  233
             +  +D  + +R+  H
Sbjct  487  AEAGRDAASPIRLPQH  502



>ref|XP_001695554.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01341.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=477

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNG-  617
            LY WYR  E EHFPDP GLR  +ERWT GLYP  ++  M  +DVPE++AV+R  +C  G 
Sbjct  330  LYRWYRAYEQEHFPDPMGLRESLERWTLGLYPRALQLAMWVYDVPELIAVSRTAMCAAGG  389

Query  616  -MDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANY  440
             +D++SR  AV YYT +  Y+W+ +TP +  VFG YLY+ + W HVHFDEAFSSLR   +
Sbjct  390  SLDAISRLQAVGYYTGMLAYYWLLATPAMGFVFGLYLYLSVCWCHVHFDEAFSSLREPGF  449

Query  439  KSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            KSF R H+   G LE+FTLA+D+VP  W
Sbjct  450  KSFVRLHLRPDGHLELFTLALDEVPSRW  477



>gb|EMS47321.1| hypothetical protein TRIUR3_13192 [Triticum urartu]
Length=725

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  658  EVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVH  479
            +VMAVTR NICKNGM SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+H
Sbjct  562  KVMAVTRINICKNGMMSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIH  621

Query  478  FDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKV  368
            FDEAFSSLRIANYKSFTRFHI   GDLE+FTLAVDK+
Sbjct  622  FDEAFSSLRIANYKSFTRFHIKKDGDLEIFTLAVDKI  658



>ref|XP_008877911.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 ref|XP_008877914.1| hypothetical protein, variant 5 [Aphanomyces invadans]
 gb|ETV93542.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 gb|ETV93543.1| hypothetical protein, variant 5 [Aphanomyces invadans]
Length=966

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  754  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  809

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  810  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  869

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW----ETEPQQPSYVRKFPSKWRATSLQQ  266
            F R HI + GDLE+F L VDK+P +W  D +W    + E   PSY  K PS W+    + 
Sbjct  870  FLRLHIKSNGDLEIFALGVDKMPTKWIRDPDWSGATQAEKVSPSYEWKVPSYWKPKMSRV  929

Query  265  DPI  257
            D I
Sbjct  930  DNI  932



>ref|XP_008877913.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETV93541.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=1011

 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  799  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  854

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  855  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  914

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW----ETEPQQPSYVRKFPSKWRATSLQQ  266
            F R HI + GDLE+F L VDK+P +W  D +W    + E   PSY  K PS W+    + 
Sbjct  915  FLRLHIKSNGDLEIFALGVDKMPTKWIRDPDWSGATQAEKVSPSYEWKVPSYWKPKMSRV  974

Query  265  DPI  257
            D I
Sbjct  975  DNI  977



>ref|XP_008877896.1| hypothetical protein H310_12570 [Aphanomyces invadans]
 ref|XP_008877910.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 ref|XP_008877912.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 gb|ETV93538.1| hypothetical protein H310_12570 [Aphanomyces invadans]
 gb|ETV93539.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETV93540.1| hypothetical protein, variant 2 [Aphanomyces invadans]
Length=1022

 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  810  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  865

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  866  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  925

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW----ETEPQQPSYVRKFPSKWRATSLQQ  266
            F R HI + GDLE+F L VDK+P +W  D +W    + E   PSY  K PS W+    + 
Sbjct  926  FLRLHIKSNGDLEIFALGVDKMPTKWIRDPDWSGATQAEKVSPSYEWKVPSYWKPKMSRV  985

Query  265  DPI  257
            D I
Sbjct  986  DNI  988



>ref|XP_005651351.1| hypothetical protein COCSUDRAFT_12255, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26807.1| hypothetical protein COCSUDRAFT_12255, partial [Coccomyxa subellipsoidea 
C-169]
Length=884

 Score =   157 bits (398),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 68/142 (48%), Positives = 93/142 (65%), Gaps = 0/142 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY WY+  E +HFPDP GLR  + R+T   YP  ++  M+ FDVPE +AVTR  +C    
Sbjct  718  LYRWYQRFEAQHFPDPAGLRDTVARYTLHAYPGVVQAAMALFDVPEAIAVTRTAMCSATT  777

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
              LSR     YY  +  Y+WV  TP V+ +FG YLY+ +N  HVH+DEAFSSL+I ++K 
Sbjct  778  APLSRFQGAAYYLGMLAYYWVLVTPSVAFIFGGYLYLSVNLFHVHYDEAFSSLQIPHHKG  837

Query  433  FTRFHINTKGDLEVFTLAVDKV  368
            F+R H+  +GDL V+ LA+D+V
Sbjct  838  FSRIHVTPEGDLHVYGLAIDQV  859



>ref|XP_009843915.1| hypothetical protein H257_16986 [Aphanomyces astaci]
 gb|ETV66544.1| hypothetical protein H257_16986 [Aphanomyces astaci]
Length=1012

 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 113/184 (61%), Gaps = 11/184 (6%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYP---ACIKYLMSAFDVPEVMAVTRQNICK  623
            LY++Y+     H PD   L    +   FGL P   AC+KY+++ FDVP+ +A+ R NIC+
Sbjct  802  LYQYYQL----HVPDMVQLLRPFDY--FGLIPLYSACVKYILTVFDVPQAVAIYRTNICQ  855

Query  622  NGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIAN  443
             G  SL+R   ++YY SVFLYFWV +TP+  ++ G YLY+ +N    H++EAFS+LR+A+
Sbjct  856  AGFHSLARSEVLVYYYSVFLYFWVAATPLSGIIVGVYLYLAVNVFKSHYNEAFSALRVAS  915

Query  442  YKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQ--PSYVRKFPSKWRATSLQ  269
            YK+  R HI   GDLE+F L VDK+P +W  D  W     +  PSY  K PS W+    +
Sbjct  916  YKNILRLHIKPNGDLEMFALGVDKMPTKWIRDPAWSGTGHKLAPSYEWKVPSYWKPKMSR  975

Query  268  QDPI  257
             D I
Sbjct  976  VDNI  979



>gb|KDO31855.1| hypothetical protein SPRG_03775 [Saprolegnia parasitica CBS 223.65]
Length=1017

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 110/185 (59%), Gaps = 7/185 (4%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY  Y Y  N H P+   L A        LY  C+KYL++ FD+PEV+AV R  IC  G 
Sbjct  784  LYSLYNYF-NAHVPNMLQLHAYDYFNVIPLYSTCVKYLLTFFDIPEVVAVHRMKICYEGF  842

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            D+LSR  A +YY SVF+YFWV +TP+  ++ G YLY  +N    H++EAFSSLR+A+YK+
Sbjct  843  DALSRIEASVYYYSVFMYFWVAATPICGVIVGLYLYTALNVFKSHYNEAFSSLRVASYKN  902

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ------QPSYVRKFPSKWRATSL  272
            F R     +G+LE++ L +DK+P++W  D  W    +       PSY  K+P+ W+    
Sbjct  903  FVRMRFTPEGNLEIYALGIDKMPQKWVRDPKWSGAAEARKLNPSPSYEWKYPNYWKPKIS  962

Query  271  QQDPI  257
            + D I
Sbjct  963  KVDNI  967



>ref|XP_008611391.1| hypothetical protein SDRG_07341 [Saprolegnia diclina VS20]
 gb|EQC35107.1| hypothetical protein SDRG_07341 [Saprolegnia diclina VS20]
Length=1015

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 109/185 (59%), Gaps = 7/185 (4%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY  Y Y  N H P+   L A        LY  C+KYL++ FD+PEV+AV R  IC  G 
Sbjct  784  LYSLYNYF-NAHVPNMLQLHAYDYFNVIPLYSTCVKYLLTFFDIPEVVAVHRMKICYEGF  842

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            D+LSR  A +YY SVF+YFWV +TP+  ++ G YLY  +N    H++EAFSSLR+A+YK+
Sbjct  843  DALSRIEASVYYYSVFMYFWVAATPICGVIVGLYLYTALNVFKSHYNEAFSSLRVASYKN  902

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQ------QPSYVRKFPSKWRATSL  272
            F R      G+LE++ L +DK+P++W  D  W    +       PSY  K+P+ W+    
Sbjct  903  FVRMRFTPDGNLEIYALGIDKMPQKWVRDPKWSGAAEARKLNPSPSYEWKYPNYWKPKIS  962

Query  271  QQDPI  257
            + D I
Sbjct  963  KVDNI  967



>ref|XP_008877903.1| hypothetical protein, variant 18 [Aphanomyces invadans]
 ref|XP_008877904.1| hypothetical protein, variant 19 [Aphanomyces invadans]
 gb|ETV93556.1| hypothetical protein, variant 18 [Aphanomyces invadans]
 gb|ETV93557.1| hypothetical protein, variant 19 [Aphanomyces invadans]
Length=904

 Score =   150 bits (379),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  754  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  809

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  810  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  869

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEW  356
            F R HI + GDLE+F L VDK+P +W
Sbjct  870  FLRLHIKSNGDLEIFALGVDKMPTKW  895



>ref|XP_008877892.1| hypothetical protein, variant 8 [Aphanomyces invadans]
 ref|XP_008877915.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 ref|XP_008877916.1| hypothetical protein, variant 7 [Aphanomyces invadans]
 gb|ETV93544.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 gb|ETV93545.1| hypothetical protein, variant 7 [Aphanomyces invadans]
 gb|ETV93546.1| hypothetical protein, variant 8 [Aphanomyces invadans]
Length=960

 Score =   150 bits (379),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  810  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  865

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  866  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  925

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEW  356
            F R HI + GDLE+F L VDK+P +W
Sbjct  926  FLRLHIKSNGDLEIFALGVDKMPTKW  951



>ref|XP_008877893.1| hypothetical protein, variant 9 [Aphanomyces invadans]
 gb|ETV93547.1| hypothetical protein, variant 9 [Aphanomyces invadans]
Length=949

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  799  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  854

Query  613  DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKS  434
            DSL+R   + YY SVFLYFWV +TP+  ++ G YLY+ +N  H H++EAFS+LR+A+YK+
Sbjct  855  DSLTRSEVLAYYCSVFLYFWVAATPLSGVIVGVYLYLAVNVFHSHYNEAFSALRVASYKN  914

Query  433  FTRFHINTKGDLEVFTLAVDKVPKEW  356
            F R HI + GDLE+F L VDK+P +W
Sbjct  915  FLRLHIKSNGDLEIFALGVDKMPTKW  940



>ref|XP_002909241.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY58055.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1041

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 105/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD +G+R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  832   LPDLSGVRKYDIFGLSSLYGDFMRLCMTLFDVPEVVALHRNKICTSGFESLGRTELWAYY  891

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  892   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  951

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  952   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1009



>gb|ETL46182.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETI52906.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK92766.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO81609.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP22715.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=990

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
            E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  901  EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETL46184.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETI52908.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK92768.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO81611.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
 gb|ETP22717.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=912

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETP50694.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=912

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETL99329.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETP50691.1| hypothetical protein F442_04046 [Phytophthora parasitica P10297]
Length=1043

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETL99327.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETL99326.1| hypothetical protein L917_03802 [Phytophthora parasitica]
Length=1043

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETI52905.1| hypothetical protein F443_04062 [Phytophthora parasitica P1569]
 gb|ETK92765.1| hypothetical protein L915_03944 [Phytophthora parasitica]
 gb|ETO81608.1| hypothetical protein F444_04117 [Phytophthora parasitica P1976]
 gb|ETP22714.1| hypothetical protein F441_04041 [Phytophthora parasitica CJ01A1]
Length=1043

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETP50692.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=990

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETL46181.1| hypothetical protein L916_03887 [Phytophthora parasitica]
Length=1043

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>ref|XP_008901276.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETN13201.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=912

 Score =   140 bits (354),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>ref|XP_008901274.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN13199.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=990

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
            E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  901  EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>ref|XP_008901271.1| hypothetical protein PPTG_08104 [Phytophthora parasitica INRA-310]
 gb|ETN13198.1| hypothetical protein PPTG_08104 [Phytophthora parasitica INRA-310]
Length=1043

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>emb|CCA25522.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=837

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 5/149 (3%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY + +++ MSAFD+PEV+A+ R  IC +G ++L+R     YY SVF YF+V + PVV  
Sbjct  632  LYFSFMRFCMSAFDIPEVVAIHRSKICSSGFEALTRFEMWTYYLSVFPYFFVLAAPVVGF  691

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG YLY+ +N   VH++EAFS+LRI++YK+F R HI   GDL V  + +DK+P++W  D
Sbjct  692  VFGLYLYLSLNLWGVHYNEAFSALRISSYKNFLRLHIQPNGDLIVHAIGIDKMPRKWGRD  751

Query  346  SNWET-----EPQQPSYVRKFPSKWRATS  275
              W       E  +PSY    PS W+  S
Sbjct  752  PAWSGGRNHPEQHKPSYEWSSPSYWKPVS  780



>ref|XP_009529340.1| hypothetical protein PHYSODRAFT_315827 [Phytophthora sojae]
 gb|EGZ15591.1| hypothetical protein PHYSODRAFT_315827 [Phytophthora sojae]
Length=1041

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 103/180 (57%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   +   M+ FDVPEV+A+ R  IC +G +SL R    +YY
Sbjct  832   LPDFSAIRQYDIFGLASLYDDFMLLSMTIFDVPEVVALHRNKICASGFESLGRMELWMYY  891

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N    H++EAFSSLRIA+YK+F R H + +G L
Sbjct  892   ASVFPYFWVLATPVVSFVFGTYLYLSLNIFGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  951

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+F   VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  952   EIFAFGVDKMPRRWCRDPKWSGGNGPRASLERDLPSFKWTRPSYWKPLVTKVD--NMLRL  1009



>gb|ETM52471.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 103/180 (57%), Gaps = 10/180 (6%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
            E+    VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  901  EISAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETM52473.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+    VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEISAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETM52470.1| hypothetical protein L914_03906 [Phytophthora parasitica]
Length=1043

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 103/180 (57%), Gaps = 10/180 (6%)
 Frame = -2

Query  757   FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
              PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  834   LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  893

Query  577   TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
              SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  894   ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  953

Query  397   EVFTLAVDKVPKEWKLDSNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
             E+    VDK+P+ W  D  W          E   PS+    PS W+    + D  N +R+
Sbjct  954   EISAFGVDKMPRRWCRDPKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETL46183.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+F   VDK+P+ W
Sbjct  901  EIFAFGVDKMPRRW  914



>gb|ETP50693.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=925

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+F   VDK+P+ W
Sbjct  901  EIFAFGVDKMPRRW  914



>gb|ETL99328.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+F   VDK+P+ W
Sbjct  901  EIFAFGVDKMPRRW  914



>gb|ETI52907.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETK92767.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETO81610.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETP22716.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=925

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+F   VDK+P+ W
Sbjct  901  EIFAFGVDKMPRRW  914



>ref|XP_008901275.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN13200.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=925

 Score =   135 bits (339),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+F   VDK+P+ W
Sbjct  901  EIFAFGVDKMPRRW  914



>gb|ETM52472.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   132 bits (332),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -2

Query  757  FPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYY  578
             PD + +R         LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY
Sbjct  781  LPDFSAVRKYDIFGLSSLYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYY  840

Query  577  TSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDL  398
             SVF YFWV +TPVVS VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G L
Sbjct  841  ASVFPYFWVLATPVVSFVFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRL  900

Query  397  EVFTLAVDKVPKEW  356
            E+    VDK+P+ W
Sbjct  901  EISAFGVDKMPRRW  914



>emb|CAB45564.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79255.1| hypothetical protein [Arabidopsis thaliana]
Length=932

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNIC--KN  620
            LY+WY+  ENEHFPDPTGLR RIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC  +N
Sbjct  839  LYQWYKSVENEHFPDPTGLRDRIEQWTFGLYPACIKYLMSAFDIPEVMAVTRTNICRERN  898

Query  619  GMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFG  518
            G   L    A IYY SVFLYFWV   P    +FG
Sbjct  899  GSHFLEAEQA-IYYASVFLYFWVLLNPCC--IFG  929



>gb|KHG25783.1| hypothetical protein F383_07510 [Gossypium arboreum]
Length=206

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -3

Query  786  NGIAMXRTSIFRTPLVLGHV*NDGHLAFIQHVSSI*CLLLMYPR*WQ*RGKTSARMGWIH  607
            +G    + SIF+  +V   V ++GHLA IQHVS I C  LM+ R W       ARM +  
Sbjct  48   SGTVQSKVSIFQILVVFVLVWSNGHLASIQHVSCISCPHLMFQRLWLSPEAIFARMEYRR  107

Query  606  SPEGVL*YIIHPFFFISGFSQLRWYLWSSEVICISVLIGSTYILMKPFLLSVLPTTSHLH  427
             PEGVL YI+    F SGFS+  W+LW SE  CIS L G  Y L +  LLS L  TSH H
Sbjct  108  CPEGVLSYIMLQSSFTSGFSRPLWFLWCSEATCISALTGFIYTLTRRSLLSELLITSHSH  167

Query  426  DST*TPKATLKFSHLQLIRFRKSGS*TQTGKRSHSS  319
            DST      LKFS LQ IRF+ +G     G  S SS
Sbjct  168  DSTSIVMVILKFSLLQSIRFQGTGCWILIGIWSRSS  203



>ref|XP_007017324.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY14549.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 2 [Theobroma cacao]
Length=831

 Score = 96.3 bits (238),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFDVPEV
Sbjct  694  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDVPEV  740


 Score = 46.2 bits (108),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -3

Query  627  ARMGWIHSPEGVL*YIIHPFFFISGFSQLRWYLWSSEVICISVLIGSTYILMKPFLL  457
            ARM +   PEGVL YI       SG SQ +W+ W  + I +S L G TY L +P LL
Sbjct  775  ARMVYSRYPEGVLSYITRQSSSTSGCSQPQWFHWCLDAIYMSALTGFTYTLTRPSLL  831



>gb|KJB58439.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=975

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 89/156 (57%), Gaps = 0/156 (0%)
 Frame = -3

Query  786  NGIAMXRTSIFRTPLVLGHV*NDGHLAFIQHVSSI*CLLLMYPR*WQ*RGKTSARMGWIH  607
            +G    + SIF+  +V   V ++GHLA IQHVSSI C  LM+ R W       ARM +  
Sbjct  817  SGTVQSKVSIFQILVVFVLVWSNGHLASIQHVSSISCPHLMFQRLWLSPEAIFARMEYRR  876

Query  606  SPEGVL*YIIHPFFFISGFSQLRWYLWSSEVICISVLIGSTYILMKPFLLSVLPTTSHLH  427
             PEGVL YI+    F SGFS+L W+LW SE  CIS L G  Y L +  LLS L  TSH H
Sbjct  877  CPEGVLSYIMLQSSFTSGFSRLLWFLWCSEATCISALTGFIYTLTRRSLLSELLITSHSH  936

Query  426  DST*TPKATLKFSHLQLIRFRKSGS*TQTGKRSHSS  319
            DST      LKFS L+ IRF+ +G     G  S SS
Sbjct  937  DSTSIVMVILKFSLLRSIRFQGNGCWILIGIWSRSS  972



>gb|EJK61150.1| hypothetical protein THAOC_18408 [Thalassiosira oceanica]
Length=525

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -2

Query  691  IKYLMSAFDVPEVMAVTRQN----ICKNGMDSLSRGGAVIYY-----------TSVFLYF  557
            +K  ++ FD+P  +A T       +C +G   L +   ++Y+            S+ LY+
Sbjct  353  LKMTLALFDLPGTIAATHVQMCAVLCADGAYCLYKNDHMLYHQLDRYTILKYGISIGLYY  412

Query  556  WVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAV  377
             VF  P+   +FG++L + +NWL   +D  FSSLR+ ++K+F R HI+ KGDLE+F +  
Sbjct  413  IVFVVPLAGSLFGTWLALSLNWLKCQYDAGFSSLRMEHWKNFLRLHIDDKGDLEIFAICS  472

Query  376  DKVPKEWKLD-SNWETEPQQPSYVRKFPSKW  287
             +VPK+W+ D  +  +   QPS+  + PSKW
Sbjct  473  HRVPKKWRRDPKSRPSTAAQPSWKWRHPSKW  503



>ref|XP_002288749.1| hypothetical protein THAPSDRAFT_261726 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94185.1| hypothetical protein THAPSDRAFT_261726 [Thalassiosira pseudonana 
CCMP1335]
Length=866

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 86/163 (53%), Gaps = 24/163 (15%)
 Frame = -2

Query  691  IKYLMSAFDVPEVMAVTR----QNICKNGMD-----------SLSRGGAVIYYTSVFLYF  557
            +K  +S FD+P V+  T     +++C  G D            L R   + Y  ++  YF
Sbjct  639  LKTTLSVFDLPGVIGSTHVKMCEHLCSGGNDCLYSNNFAMFQQLDRATIIKYLAAMSFYF  698

Query  556  WVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAV  377
             VF+ P+   VFGS+L + +N L   ++E FSSLR+ ++K+F + HI+ +G+LEVF + +
Sbjct  699  AVFAVPIAGNVFGSWLALTLNVLKCQYNEGFSSLRLEHWKNFLKLHIDGEGNLEVFAIGL  758

Query  376  DKVPKEWKLDSNWETE---------PQQPSYVRKFPSKWRATS  275
             +VPK W  D  W  +         P +PS+  K PSKW   S
Sbjct  759  HRVPKRWVKDPLWGGDIHGKKNGATPIKPSWSWKTPSKWMPLS  801



>ref|XP_002783413.1| hypothetical protein Pmar_PMAR006939 [Perkinsus marinus ATCC 
50983]
 gb|EER15209.1| hypothetical protein Pmar_PMAR006939, partial [Perkinsus marinus 
ATCC 50983]
Length=296

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 96/186 (52%), Gaps = 17/186 (9%)
 Frame = -2

Query  706  LYPACIKYL-MSAFDVPEVMAVTRQNICKNGM--DSLSRGGAVIYYTSVFLYFWVFSTPV  536
            L P+ +  L +S  D+P ++   R   C        L+R   +     +  Y W+  TP+
Sbjct  55   LLPSSLCTLALSISDLPRIIVTNRDAACATMATDQDLTRLDYIALIGPLVPYLWIIITPI  114

Query  535  VSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIN-TKGDLEVFTLAVDKVPKE  359
             S + G YL + +N L  H+ EAFSSL+I +YK+F R HI+   GDL+ F + VD VP  
Sbjct  115  ASFILGCYLLVSLNVLGQHWTEAFSSLKIRDYKNFVRMHISPITGDLQCFVIGVDHVPTR  174

Query  358  WKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQQDP-------INTVRVVDHFVIEQT  215
            W++D  W+        + PS+    PSK+R   ++++P        +  +VVD FV++ +
Sbjct  175  WEMDPYWDRTLMPKSARVPSWKWVTPSKYRP-RVKKNPNGKALKGGSQAKVVDFFVVKAS  233

Query  214  EKSDSE  197
            +K   E
Sbjct  234  KKRRPE  239



>gb|KDO84271.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=340

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY+WYR  E+EHFPDPTGLRARIE+WTFGLYPACIKYLMSAFD+PE      Q + +   
Sbjct  249  LYQWYRSVESEHFPDPTGLRARIEQWTFGLYPACIKYLMSAFDIPE------QYLQEWNA  302

Query  613  DSLSRGGAVIYYTSVFLYFWVFST  542
             ++SRG + I    + L+  + +T
Sbjct  303  VTISRGSSHILCFCLSLFLGLLNT  326



>ref|XP_012071695.1| PREDICTED: uncharacterized protein LOC105633674 isoform X2 [Jatropha 
curcas]
Length=865

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNI  629
            LY+WYR  E+EHFPDPTGLR+RIE+WTFGLYPACIKYLMSAFDVPE      +NI
Sbjct  810  LYQWYRSVESEHFPDPTGLRSRIEQWTFGLYPACIKYLMSAFDVPECTVFMAENI  864



>gb|ETO31334.1| hypothetical protein RFI_05786, partial [Reticulomyxa filosa]
Length=633

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 24/165 (15%)
 Frame = -2

Query  760  HFPDPTG-LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSL-------  605
            HFP     L++  E++T G     +  + S  D+       R+ IC   +  +       
Sbjct  365  HFPSIVSVLKSLDEQYTCGWILYLLSGIFSVVDITGFHVSLRKTICDAKVKQIEFLFQKL  424

Query  604  ----------------SRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFD  473
                            SR   ++Y+ +  L++W+  TP+ + V   YL++ +N+L +HF 
Sbjct  425  EFPLALENEWYETLLPSRAHRLLYHITAVLFYWILCTPLAAFVVALYLFVSVNFLGIHFT  484

Query  472  EAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNW  338
            EAFSS+R+ ++K+F R HI+  G L ++ + VDKVP+ W+ DS W
Sbjct  485  EAFSSMRMEDFKNFLRCHIDKDGSLSIYAIGVDKVPRRWQQDSEW  529



>pir||T05132 hypothetical protein F7H19.190 - Arabidopsis thaliana
Length=443

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            LY+WY+  ENEHFPDPTGLR RIE+WTFGLYPACIKYLMSAFD+PEV
Sbjct  336  LYQWYKSVENEHFPDPTGLRDRIEQWTFGLYPACIKYLMSAFDIPEV  382


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = -2

Query  379  VDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
            + +VPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQDP+NTV++VD FVI ++EK
Sbjct  379  IPEVPKEWKLDKDWDAEPRSTVKMSHHRRFPSKWCATTLQQDPVNTVKIVDKFVIHRSEK  438

Query  208  SDSES  194
                S
Sbjct  439  ETGGS  443



>gb|KCW86237.1| hypothetical protein EUGRSUZ_B02922 [Eucalyptus grandis]
Length=545

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            LY+WYR  E+EHFPDPTGLR+RIE+WT GLYPACIKYLMSAFDVPEV
Sbjct  496  LYQWYRTVESEHFPDPTGLRSRIEQWTLGLYPACIKYLMSAFDVPEV  542



>gb|KJB58440.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=859

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPE  656
            LY+WYR  E+EHFPDP+GLRAR+E+WTFGLYPACIKYLMSAFDVPE
Sbjct  812  LYQWYRSVESEHFPDPSGLRARMEQWTFGLYPACIKYLMSAFDVPE  857



>ref|XP_002778051.1| hypothetical protein Pmar_PMAR018488 [Perkinsus marinus ATCC 
50983]
 gb|EER09846.1| hypothetical protein Pmar_PMAR018488 [Perkinsus marinus ATCC 
50983]
Length=183

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 81/146 (55%), Gaps = 14/146 (10%)
 Frame = -2

Query  607  LSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFT  428
            L+R   +     +  Y W+  TP+ S + G YL + +N L  H+ EAFSSL+I +YK+F 
Sbjct  6    LTRLDYIALIGPLVPYLWIIITPIASFILGCYLLVSLNVLGQHWTEAFSSLKIRDYKNFV  65

Query  427  RFHIN-TKGDLEVFTLAVDKVPKEWKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQQ  266
            R HI+   GDL+ F + VD VP  W++D  W+        + PS+    PSK+R   +++
Sbjct  66   RMHISPITGDLQCFVIGVDHVPTHWEMDPYWDRTLMPKSARVPSWKWVTPSKYRP-RVKK  124

Query  265  DP-------INTVRVVDHFVIEQTEK  209
            +P        +  +VVD F+++ ++K
Sbjct  125  NPNGKALKGGSQAKVVDFFMVKASKK  150



>ref|XP_002778054.1| hypothetical protein Pmar_PMAR018491 [Perkinsus marinus ATCC 
50983]
 gb|EER09849.1| hypothetical protein Pmar_PMAR018491 [Perkinsus marinus ATCC 
50983]
Length=249

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 95/201 (47%), Gaps = 38/201 (19%)
 Frame = -2

Query  700  PACIKYL-MSAFDVPEVMAVTRQNIC---KNGMDSLSRGGAVIYYTSVFLYFWVFSTPVV  533
            PA +  L +S  D+P      R  +C   +N M  + R   + Y  SV  + ++  TP+ 
Sbjct  5    PASLNSLFISITDLPSHAFHNRAGVCAALQNNM-PIDRFQYLRYIASVSPFLYIIMTPIA  63

Query  532  SLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEW  356
            S +FG YL I +N+L  H  EAFSSLRI +YK F R  I+   GDL VF + +D V + W
Sbjct  64   SFIFGVYLLISLNYLGQHCTEAFSSLRINDYKHFLRMWISPDTGDLHVFVIGIDHVARHW  123

Query  355  KLDSNWETE-----PQQPSYVRKFPSKWRATSLQQ-------------------------  266
            + D  W+ +      Q PS+    PSK+R  S ++                         
Sbjct  124  EADPYWDGKLLPKGSQVPSWKWITPSKYRPKSERKAEEDDLTLLARRVEQGLGPSPSDYR  183

Query  265  --DPINTVRVVDHFVIEQTEK  209
               P    ++VD+FV+E +EK
Sbjct  184  KPQPDGQPKLVDYFVVESSEK  204



>emb|CCC89292.1| unnamed protein product, partial [Trypanosoma congolense IL3000]
Length=743

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 93/178 (52%), Gaps = 13/178 (7%)
 Frame = -2

Query  679  MSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVSLVFGSY  512
            +   D+ E +A     +  N   S+S    R   ++YY  + L +W+ + P++S +FG +
Sbjct  560  LQGLDITENLAYLSHQVGTNNTGSISHSADRIHVILYYLHILLIYWLLAAPLLSFIFGIF  619

Query  511  LYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWKLDSNWE  335
            L++ +++  + +D ++SS +I +YK F RF ++ K   L  + +A   VPK W LD  + 
Sbjct  620  LFVSVHYFDLAYDASYSSFQIEDYKHFVRFCVDAKTRVLHGYVIAETYVPKIWSLDGRYV  679

Query  334  TE------PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKSDSESMNGSK  179
             E         P ++RK PS+W     +  P +  RV+++FV+ +  +  S +  GS+
Sbjct  680  AECTDAEMQHLPPHLRKHPSRWIRRG-EAGPNSAPRVLENFVV-KPHRVTSRNPKGSR  735



>ref|XP_002783415.1| hypothetical protein Pmar_PMAR006941 [Perkinsus marinus ATCC 
50983]
 gb|EER15211.1| hypothetical protein Pmar_PMAR006941 [Perkinsus marinus ATCC 
50983]
Length=412

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 95/201 (47%), Gaps = 38/201 (19%)
 Frame = -2

Query  700  PACIKYL-MSAFDVPEVMAVTRQNIC---KNGMDSLSRGGAVIYYTSVFLYFWVFSTPVV  533
            PA +  L +S  D+P      R  +C   +N M  + R   + Y  SV  + ++  TP+ 
Sbjct  161  PASLNSLFISITDLPSHAFHNRAGVCAAIQNNM-PIDRFQYLRYIASVSPFLYIIMTPIA  219

Query  532  SLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIN-TKGDLEVFTLAVDKVPKEW  356
            S +FG YL I +N+L  H  EAFSSLRI +YK F R  I+   GDL VF + +D V + W
Sbjct  220  SFIFGVYLLISLNYLGQHCTEAFSSLRIHDYKHFLRMWISPDTGDLHVFVIGIDHVARHW  279

Query  355  KLDSNWETE-----PQQPSYVRKFPSKWRATSLQQ-------------------------  266
            + D  W+ +      Q PS+    PSK+R  S ++                         
Sbjct  280  EADPYWDGKLLPKGSQVPSWKWITPSKYRPKSERKAEEDDLTLLARRVEQGLGPSPSDYR  339

Query  265  --DPINTVRVVDHFVIEQTEK  209
               P    ++VD+FV+E +EK
Sbjct  340  KPQPDGQPKLVDYFVVESSEK  360



>ref|XP_002765607.1| hypothetical protein Pmar_PMAR013671 [Perkinsus marinus ATCC 
50983]
 gb|EEQ98324.1| hypothetical protein Pmar_PMAR013671 [Perkinsus marinus ATCC 
50983]
Length=1068

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 87/184 (47%), Gaps = 33/184 (18%)
 Frame = -2

Query  661   PEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHV  482
             P  + +   N C   +  + R   + Y  SV  + ++  TP+ S +FG YL I +N+L  
Sbjct  820   PPSIGINASNTCFPQLPPIDRFQYLGYLGSVSPFLYIIMTPIASFIFGVYLVISLNYLGQ  879

Query  481   HFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEWKLDSNWETE--PQQ---  320
             H++EAFSSLRI +YK F R  I+   GDL +F + +D V + W+ D  W+    PQ    
Sbjct  880   HWNEAFSSLRIQDYKHFLRMWISPDTGDLHIFVIGIDHVARHWEADPYWDGRLLPQGSHV  939

Query  319   PSYVRKFPSKWRATS---------------------------LQQDPINTVRVVDHFVIE  221
             PS+    PSK+R  S                            +  P    ++VD+FVIE
Sbjct  940   PSWKWITPSKYRPKSDSKSKEDDLSFWARKVEQGLGPSPSDYRKPQPDGQPKLVDYFVIE  999

Query  220   QTEK  209
              ++K
Sbjct  1000  ASKK  1003



>gb|KHG18087.1| hypothetical protein F383_21533 [Gossypium arboreum]
Length=80

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  727  IERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSR  599
            +E+WTFGL PACIKY MSAFDVPEVMAVTR NICKNG+ +LSR
Sbjct  1    MEQWTFGLSPACIKYRMSAFDVPEVMAVTRSNICKNGIQALSR  43



>gb|KHG23677.1| Phosphoenolpyruvate carboxylase [Gossypium arboreum]
Length=147

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 65/143 (45%), Gaps = 59/143 (41%)
 Frame = -2

Query  787  EWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDS  608
            +WYR  E+EHFP+ +GLRAR+E+WTFGLY ACIKYLMSAFDV E                
Sbjct  64   KWYRSVESEHFPNSSGLRARMEQWTFGLYLACIKYLMSAFDVLE----------------  107

Query  607  LSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFT  428
                     +   F  F + S            Y     LH++ D               
Sbjct  108  ---------FDEAFSSFRITS------------YKSFTRLHINHD---------------  131

Query  427  RFHINTKGDLEVFTLAVDKVPKE  359
                   G LEVFTLAVDKVP+E
Sbjct  132  -------GYLEVFTLAVDKVPRE  147



>ref|XP_002781370.1| hypothetical protein Pmar_PMAR020755 [Perkinsus marinus ATCC 
50983]
 gb|EER13165.1| hypothetical protein Pmar_PMAR020755 [Perkinsus marinus ATCC 
50983]
Length=1048

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 86/184 (47%), Gaps = 33/184 (18%)
 Frame = -2

Query  661   PEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHV  482
             P  + +   N C      + R   + Y  SV  + ++  TP+ S +FG YL I +N+L  
Sbjct  822   PLSIGINASNTCFPQFPPIDRFQYLGYLGSVSPFLYIIMTPIASFIFGVYLVISLNYLGQ  881

Query  481   HFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEWKLDSNWETE--PQQ---  320
             H++EAFSSLRI +YK F R  I+   GDL +F + +D V + W+ D  W+    PQ    
Sbjct  882   HWNEAFSSLRIQDYKHFLRMWISPDTGDLHIFVIGIDHVARHWEADPYWDGRLLPQGSHV  941

Query  319   PSYVRKFPSKWRATS---------------------------LQQDPINTVRVVDHFVIE  221
             PS+    PSK+R  S                            +  P    ++VD+FVIE
Sbjct  942   PSWKWITPSKYRPKSDSKSKEDDLSFWARKVEQGLGPSPSDYRKPQPDGQPKLVDYFVIE  1001

Query  220   QTEK  209
              ++K
Sbjct  1002  ASKK  1005



>emb|CCC46388.1| conserved hypothetical protein, fragment [Trypanosoma vivax Y486]
Length=909

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 75/134 (56%), Gaps = 7/134 (5%)
 Frame = -2

Query  715  TFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVF  548
            +F +   C+  L+ + DV E +A   +++  N   + S    R    +YY  V L+FW+ 
Sbjct  709  SFMVNGGCV--LLRSMDVIENLAYLSRHVSTNVTGTFSPATDRLHVTLYYLHVLLFFWLL  766

Query  547  STPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDK  371
            +TPVVS V G +L++ +++    +D A+SS +I +YK F RF ++ +   L  + +A  +
Sbjct  767  ATPVVSFVIGVFLFVSVHFFDFLYDAAYSSFQIEDYKQFVRFKLDGESRSLHGYVVARTR  826

Query  370  VPKEWKLDSNWETE  329
            VPK WK DSN   E
Sbjct  827  VPKAWKRDSNHVME  840



>ref|XP_003875104.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ26609.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=1213

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 82/177 (46%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAHLSEKVSSPEMGTFAEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I   K F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDSTYSAFQIEECKHFLRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKWRATS--------------LQQDPINTVRVVDHFV  227
             + E +       P ++R +PS+WR  S              L +D    V V++HFV
Sbjct  1144  QKELKSEMVRAAPPHLRAYPSRWRGKSFRTSARRDDGKHAGLDEDMEEGVEVLEHFV  1200



>ref|XP_010698662.1| hypothetical protein LPMP_204610 [Leishmania panamensis]
 gb|AIN97955.1| hypothetical protein LPMP_204610 [Leishmania panamensis]
Length=1212

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   ++YY     ++W   TP+VS V GS
Sbjct  1023  ILRCLDPFEMLAYLSEKVSSPEMGTFAGDASRVDELLYYLYFVFFYWTLVTPLVSFVIGS  1082

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      +D A+S+ +I  YK F RF ++    +L  + +A+  VPK W  DS +
Sbjct  1083  YLMCCVTLFDCLYDAAYSAFQIEEYKHFVRFRLDVATRELHAYVVALRHVPKSWTWDSTY  1142

Query  337   ETEPQ------QPSYVRKFPSKW-----RATSLQQDPINT---------VRVVDHFV  227
             + E +       P ++R  PS+W     RATS   D             V +++HFV
Sbjct  1143  QAELKGDAVRAAPPHLRAHPSRWHGKHFRATSRCDDGKRAAFDEGVEEGVEILEHFV  1199



>ref|XP_003723012.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14538.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=1212

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   ++YY     ++W   TP+VS V GS
Sbjct  1023  ILRCLDPFEMLAYLSEKVSSPEMGTFAGDASRVDELLYYLYFVFFYWTLVTPLVSFVIGS  1082

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      +D A+S+ +I  YK F RF ++    +L  + +A+  VPK W  DS +
Sbjct  1083  YLMCCVTLFDCLYDAAYSAFQIEEYKHFVRFRLDVATRELHAYVVALRHVPKSWTWDSTY  1142

Query  337   ETEPQ------QPSYVRKFPSKW-----RATSLQQDPINT---------VRVVDHFV  227
             + E +       P ++R  PS+W     RATS   D             V +++HFV
Sbjct  1143  QAELKGDAVRAAPPHLRAHPSRWHGKHFRATSRCDDGKRAAFDEGVEEGVEILEHFV  1199



>ref|XP_001682794.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CAJ03651.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=1213

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 82/177 (46%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAYLSEKVSSPEMGTFTEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I  YK+F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDATYSAFQIEEYKNFVRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKWRA--------------TSLQQDPINTVRVVDHFV  227
             + E +       P ++R +PS+W                T L +     V +++HFV
Sbjct  1144  QKELRSEKMQAAPPHLRAYPSRWHGKRFRTSARCDDGKHTELDEGMEEEVEILEHFV  1200



>ref|XP_001465175.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM67422.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=1213

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAYLSEKVSSPEMGTFTEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I  YK F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDATYSAFQIEEYKHFVRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKWRA----TSLQQDPIN----------TVRVVDHFV  227
             + E +       P ++R +PS+W      TS+++D              V +++HFV
Sbjct  1144  QKELKSEKVRTAPPHLRAYPSRWHGKNFRTSVRRDDGKHAGYDEGMEEGVEILEHFV  1200



>ref|XP_001218808.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 emb|CAJ16040.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=1118

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVS  530
             AC   L+ + D+ E +A    ++  N   +LS    R   V+YY  + L +W+ +TP++S
Sbjct  940   ACT--LLRSMDMIENLAYLSYHVGTNVTGTLSHTTNRVQVVLYYLHILLIYWLLATPLLS  997

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWK  353
              + G +L++ +++  + +D ++SS +I +YK F RF ++ +   L  + +A   VPK W 
Sbjct  998   FIIGVFLFVSVHYFDLTYDASYSSFQIEDYKHFLRFCLDGRTRCLHAYVVAEKFVPKVWI  1057

Query  352   LDSNWETEPQQ------PSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
              D    TE +       P +++K PS+W    +      T  V++HFV+ 
Sbjct  1058  CDGRHVTECRDERTKHLPPHLKKHPSRWVPHGVSGTDY-TPTVLEHFVVR  1106



>ref|XP_011771291.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
 emb|CBH08850.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=1118

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVS  530
             AC   L+ + D+ E +A    ++  N   +LS    R   V+YY  + L +W+ +TP++S
Sbjct  940   ACT--LLRSMDMIENLAYLSYHVGTNVTGTLSHTTNRVQVVLYYLHILLIYWLLATPLLS  997

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWK  353
              + G +L++ +++  + +D ++SS +I +YK F RF ++ +   L  + +A   VPK W 
Sbjct  998   FIIGVFLFVSVHYFDLTYDASYSSFQIEDYKHFLRFCLDGRTRCLHAYVVAEKFVPKVWI  1057

Query  352   LDSNWETEPQQ------PSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
              D    TE +       P +++K PS+W    +      T  V++HFV+ 
Sbjct  1058  CDGRHVTECRDERTKHLPPHLKKHPSRWVPHGVSGTDY-TPTVLEHFVVR  1106



>ref|XP_005846358.1| hypothetical protein CHLNCDRAFT_135803, partial [Chlorella variabilis]
 gb|EFN54256.1| hypothetical protein CHLNCDRAFT_135803, partial [Chlorella variabilis]
Length=247

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -2

Query  496  NWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWET  332
            +  HVH+DEAFSSL++ ++K F RFHI   GDLE+F L +++ P  W+ D  W T
Sbjct  139  SLFHVHYDEAFSSLQVPHFKGFLRFHITRAGDLEMFALGLERSPHAWREDPRWRT  193



>ref|XP_008877889.1| hypothetical protein, variant 34 [Aphanomyces invadans]
 ref|XP_008877890.1| hypothetical protein, variant 35 [Aphanomyces invadans]
 ref|XP_008877891.1| hypothetical protein, variant 36 [Aphanomyces invadans]
 gb|ETV93572.1| hypothetical protein, variant 34 [Aphanomyces invadans]
 gb|ETV93573.1| hypothetical protein, variant 35 [Aphanomyces invadans]
 gb|ETV93574.1| hypothetical protein, variant 36 [Aphanomyces invadans]
Length=847

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  754  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  809

Query  613  DSLSRGGAVIYYTSVFLYFWV  551
            DSL+R   + YY SVFLYFWV
Sbjct  810  DSLTRSEVLAYYCSVFLYFWV  830



>ref|XP_008877881.1| hypothetical protein, variant 26 [Aphanomyces invadans]
 gb|ETV93564.1| hypothetical protein, variant 26 [Aphanomyces invadans]
Length=892

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  799  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  854

Query  613  DSLSRGGAVIYYTSVFLYFWV  551
            DSL+R   + YY SVFLYFWV
Sbjct  855  DSLTRSEVLAYYCSVFLYFWV  875



>ref|XP_008877905.1| hypothetical protein, variant 21 [Aphanomyces invadans]
 ref|XP_008877906.1| hypothetical protein, variant 22 [Aphanomyces invadans]
 ref|XP_008877907.1| hypothetical protein, variant 23 [Aphanomyces invadans]
 ref|XP_008877909.1| hypothetical protein, variant 20 [Aphanomyces invadans]
 gb|ETV93558.1| hypothetical protein, variant 20 [Aphanomyces invadans]
 gb|ETV93559.1| hypothetical protein, variant 21 [Aphanomyces invadans]
 gb|ETV93560.1| hypothetical protein, variant 22 [Aphanomyces invadans]
 gb|ETV93561.1| hypothetical protein, variant 23 [Aphanomyces invadans]
Length=903

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  793  LYEWYRYXENEHFPDPTGLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGM  614
            LY++Y+     H P+   LR+        LY  C+KY+++ FDVP+ +AV R +IC+ G 
Sbjct  810  LYKYYQI----HVPNMVQLRSYDYFSLIPLYSTCVKYILTIFDVPQAVAVYRTDICQAGF  865

Query  613  DSLSRGGAVIYYTSVFLYFWV  551
            DSL+R   + YY SVFLYFWV
Sbjct  866  DSLTRSEVLAYYCSVFLYFWV  886



>ref|XP_009313637.1| hypothetical protein DQ04_07941000 [Trypanosoma grayi]
 gb|KEG08130.1| hypothetical protein DQ04_07941000 [Trypanosoma grayi]
Length=1079

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = -2

Query  544   TPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKV  368
             TP+VS + G +L++   +    +D AFSS +I +YK F RF I+ +  +L  + +A  +V
Sbjct  951   TPLVSFIIGVFLFVSFYFFGFMYDAAFSSFQIEDYKHFVRFRIDGQTRELHGYVVAEKRV  1010

Query  367   PKEWKLD-------SNWETEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
             PK W  D       +N ET+P  P ++RK+PS+W+   +     +   V++HFV++    
Sbjct  1011  PKVWLRDTRHVAEFTNAETKP-LPPHLRKWPSRWQPVQVSGSE-SVPEVLEHFVVKPHRM  1068

Query  208   SDSESMNGSKT  176
                 S N S T
Sbjct  1069  PSHVSRNNSST  1079



>ref|XP_003723013.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14539.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=1415

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVS  530
              C++ L+  FD  E ++     +    M     + SR   ++YYT V  ++WV  TP+VS
Sbjct  1228  GCLRVLLRCFDPFESLSFLSMTVSGGEMARFSATASRFQILLYYTYVLFFYWVLITPIVS  1287

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWK  353
             ++ G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K    ++
Sbjct  1288  VLIGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPATVYQ  1347

Query  352   LDSNW-------ETEPQQPSYVRKFPSKWRAT-SLQQDPINTVRVVDHFVI  224
             LD  +         E  +P +++  PS+W    S  Q   +   +++HF +
Sbjct  1348  LDRGYLWSLTGPGLEEHRPPHLKHHPSRWGPVPSDVQRKRHMTELLEHFTV  1398



>ref|XP_010698663.1| hypothetical protein LPMP_204620 [Leishmania panamensis]
 gb|AIN97956.1| hypothetical protein LPMP_204620 [Leishmania panamensis]
Length=1416

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVS  530
              C++ L+  FD  E ++     +    M     + SR   ++YYT V  ++WV  TP+VS
Sbjct  1229  GCLRVLLRCFDPFESLSFLSMTVSGGEMARFSATASRFQILLYYTYVLFFYWVLITPIVS  1288

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWK  353
             ++ G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K    ++
Sbjct  1289  VLIGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPATVYQ  1348

Query  352   LDSNW-------ETEPQQPSYVRKFPSKWRAT-SLQQDPINTVRVVDHFVI  224
             LD  +         E  +P +++  PS+W    S  Q   +   +++HF +
Sbjct  1349  LDRGYLWSLTGPGLEEHRPPHLKHHPSRWGPVPSDVQRKRHMTELLEHFTV  1399



>emb|CCW59812.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=1281

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 65/141 (46%), Gaps = 5/141 (4%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGA----VIYYTSVFLYFWVFSTPVVSLV  524
             I  ++ A D  E +A     I  + +     G        YY  +  ++W+F TP+VS +
Sbjct  1095  ICVMVRALDPLETLAHYMLKIQSSEIGKFKAGATHREIASYYMHILSFYWIFVTPIVSFI  1154

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G +L + +      +D  +S+ +I ++K F RF I+ +  +L  + LA  KVPK W+LD
Sbjct  1155  IGCFLLVSVTMFDYMYDSTYSAFQIEDFKHFVRFRIDAETRELHGYVLAKKKVPKVWELD  1214

Query  346   SNWETEPQQPSYVRKFPSKWR  284
                  +   P      P  W+
Sbjct  1215  PRHVDQFDDPKTKHTVPHLWQ  1235



>ref|WP_015353193.1| hypothetical protein [Myxococcus stipitatus]
 gb|AGC48940.1| hypothetical protein MYSTI_07668 [Myxococcus stipitatus DSM 14675]
Length=611

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -2

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            V G YL++ +N    H +EAF SL + ++K+F R HIN KG L V+ + +++VP++WK  
Sbjct  524  VMGLYLWLSVNLFGAHSNEAFISLALPDWKNFLRLHINAKGQLTVYPVGIERVPRKWK--  581

Query  346  SNWETEPQQPSY  311
                  PQ P+Y
Sbjct  582  -RTHAGPQAPAY  592



>ref|WP_044900946.1| hypothetical protein [Myxococcus stipitatus]
Length=561

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -2

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            V G YL++ +N    H +EAF SL + ++K+F R HIN KG L V+ + +++VP++WK  
Sbjct  474  VMGLYLWLSVNLFGAHSNEAFISLALPDWKNFLRLHINAKGQLTVYPVGIERVPRKWK--  531

Query  346  SNWETEPQQPSY  311
                  PQ P+Y
Sbjct  532  -RTHAGPQAPAY  542



>ref|XP_003875105.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ26610.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=1397

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVSLV  524
             ++ L+  FD  E ++     +    +     + SR   ++YY  V  ++WV  TP+VS++
Sbjct  1212  LRVLLRCFDPFESLSFLSMTVSGGEVARFSATASRLQILLYYVYVLFFYWVLITPIVSVL  1271

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K  K ++LD
Sbjct  1272  IGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPSKVYQLD  1331

Query  346   SNWE-------TEPQQPSYVRKFPSKWR---ATSLQQDPINTVRVVDHFVI--EQTEKSD  203
               +         E  +P ++++ PS+W    + +  + P+    V++HF +   +T +  
Sbjct  1332  RGYLWSLTSPCLEEHRPPHLKQHPSRWEPVLSDARCKRPMT--EVLEHFTVHPHRTPQRT  1389

Query  202   SESMNGSK  179
              + M  S+
Sbjct  1390  KQPMTDSE  1397



>ref|XP_001682795.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CAJ03655.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=1399

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 84/172 (49%), Gaps = 17/172 (10%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGA----VIYYTSVFLYFWVFSTPVVSLV  524
             ++ L+  FD  E ++     +    +   S   +    ++YY  V  ++WV  TP+VS++
Sbjct  1214  LRVLLRCFDPFESLSFLSMTVSGGEVACFSANASRLQILLYYVYVLFFYWVLITPIVSVL  1273

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K  K ++LD
Sbjct  1274  IGTFLLFSVTTFDYMYNATYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPSKVYQLD  1333

Query  346   SNW-------ETEPQQPSYVRKFPSKWR---ATSLQQDPINTVRVVDHFVIE  221
               +         E  +P ++++ PS+W    + + ++ P+    V++HF + 
Sbjct  1334  RGYLWSLTSPGLEEHRPPHLKQHPSRWGPVLSDARRKRPMT--EVLEHFTVH  1383



>gb|KFE61079.1| hypothetical protein DB31_4514 [Hyalangium minutum]
Length=570

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 68/142 (48%), Gaps = 21/142 (15%)
 Frame = -2

Query  721  RWTFGLYPACIKYLMSAF----DVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFW  554
            RW  G+    + +L +AF     V  +M  T         D LS   AV+ +   FL   
Sbjct  425  RWLAGVLHG-LAHLTAAFLLAWGVSHLMGSTELPFGSVERDLLS---AVLIFAGGFL---  477

Query  553  VFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVD  374
              + P V    G YL + +N   VH +EAFSSL I ++K+F R HI+  G L ++ + + 
Sbjct  478  --AGPTV---MGLYLLVSLNVFGVHANEAFSSLAIPDWKNFIRLHIDKAGHLRLYPIGLR  532

Query  373  KVPKEWK-----LDSNWETEPQ  323
            +VP+ WK      D  W  +P+
Sbjct  533  RVPRSWKPGELARDPAWVADPK  554



>ref|WP_044198433.1| hypothetical protein [Hyalangium minutum]
Length=544

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 68/142 (48%), Gaps = 21/142 (15%)
 Frame = -2

Query  721  RWTFGLYPACIKYLMSAF----DVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFW  554
            RW  G+    + +L +AF     V  +M  T         D LS   AV+ +   FL   
Sbjct  399  RWLAGVLHG-LAHLTAAFLLAWGVSHLMGSTELPFGSVERDLLS---AVLIFAGGFL---  451

Query  553  VFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVD  374
              + P V    G YL + +N   VH +EAFSSL I ++K+F R HI+  G L ++ + + 
Sbjct  452  --AGPTV---MGLYLLVSLNVFGVHANEAFSSLAIPDWKNFIRLHIDKAGHLRLYPIGLR  506

Query  373  KVPKEWK-----LDSNWETEPQ  323
            +VP+ WK      D  W  +P+
Sbjct  507  RVPRSWKPGELARDPAWVADPK  528



>emb|CAN92791.1| Calcineurin-like phosphoesterase family protein [Sorangium cellulosum 
So ce56]
Length=591

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = -2

Query  574  SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLE  395
             V L+       V S + G YL I +N    H +EAFS+LRI +YK+F R H++  G L 
Sbjct  442  GVTLFVGATGAVVGSTIMGVYLLISLNVARRHGNEAFSALRIQDYKNFLRIHVHRDG-LT  500

Query  394  VFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWR-ATSLQQDPIN  254
            ++ + + KVP+ WK+  +   +P +P ++   P++   A  L ++PI 
Sbjct  501  LYPVGLRKVPRAWKVADD--HKPGEPRFI---PARGALAPELIEEPIT  543



>ref|XP_001465174.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM67421.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=1398

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 72/139 (52%), Gaps = 13/139 (9%)
 Frame = -2

Query  604   SRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTR  425
             SR   ++YY  V  ++WV  TP+VS++ G++L   +      ++  +S+ ++  YK F R
Sbjct  1246  SRLQILLYYVYVLFFYWVLITPIVSVLIGTFLLFSVTTFDYMYNATYSAFQMEEYKHFVR  1305

Query  424   FHINTKG-DLEVFTLAVDKVPKEWKLDSNW-------ETEPQQPSYVRKFPSKWR---AT  278
             F ++    +L  + +AV K  K ++LD  +         E  +P ++++ PS+W    + 
Sbjct  1306  FRLDAATRELHAYVVAVQKPSKVYQLDRGYLWSLTSPGLEEHRPPHLKQHPSRWGPVLSD  1365

Query  277   SLQQDPINTVRVVDHFVIE  221
             +  + P+    V++HF + 
Sbjct  1366  ARCKRPMT--EVLEHFTVR  1382



>ref|WP_044968419.1| calcineurin, partial [Sorangium cellulosum]
Length=527

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = -2

Query  574  SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLE  395
             V L+       V S + G YL I +N    H +EAFS+LRI +YK+F R H++  G L 
Sbjct  425  GVTLFVGATGAVVGSTIMGVYLLISLNVARRHGNEAFSALRIQDYKNFLRIHVHRDG-LT  483

Query  394  VFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWR-ATSLQQDPIN  254
            ++ + + KVP+ WK+    + +P +P ++   P++   A  L ++PI 
Sbjct  484  LYPVGLRKVPRAWKVAD--DHKPGEPRFI---PARGALAPELIEEPIT  526



>ref|WP_044198580.1| hypothetical protein [Hyalangium minutum]
 gb|KFE60994.1| hypothetical protein DB31_4618 [Hyalangium minutum]
Length=561

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = -2

Query  607  LSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFT  428
            L + G  +  T +   F  F  P V+   G YL++ +N    H++EAF +L I ++K+F 
Sbjct  449  LHQAGKFLMDTVLTFAFGFFVGPFVT---GFYLWVSVNGFLAHYNEAFGALAIPDWKNFL  505

Query  427  RFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFP  296
            R  I+  G L VF + V++VP++WK        P  P+Y    P
Sbjct  506  RLRIDPDGSLTVFPVGVERVPRKWK---KTHAGPYAPAYESDDP  546



>ref|WP_020735096.1| hypothetical protein [Sorangium cellulosum]
 gb|AGP35827.1| hypothetical protein SCE1572_15735 [Sorangium cellulosum So0157-2]
Length=589

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  574  SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLE  395
             V L+  V    V S + G YL I +N    H +EAFS+L+I +YK+F R H++ +G L 
Sbjct  440  GVTLFVGVTGAVVGSTLMGIYLLISLNVARRHGNEAFSALQIEDYKNFLRIHVHREG-LT  498

Query  394  VFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWR-ATSLQQDPINTVRVV  239
            ++ + +  VP+ WK+      E ++P   R  P     A  L ++P+ T+R+ 
Sbjct  499  IYPVGLRNVPRAWKV-----AEDRRPGEPRLVPQDGALAPELIEEPV-TIRIA  545



>ref|WP_043410718.1| hypothetical protein [Cystobacter violaceus]
 gb|KFA87891.1| hypothetical protein Q664_44715 [Cystobacter violaceus Cb vi76]
Length=571

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 8/95 (8%)
 Frame = -2

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YL + +N    H +EAF SL IA++K+F R  I+  G+L VF + +++VP++WK  
Sbjct  477  IMGLYLMVSVNGFRAHSNEAFISLAIADFKNFLRLRIDKDGELTVFPVGLERVPRQWK--  534

Query  346  SNWETEPQQPSYVRKFPSKWRAT--SLQQDPINTV  248
                  P  P+Y    P   RAT   L + PI   
Sbjct  535  -ETHAGPYAPAYE---PDDPRATPPELIEPPIRVT  565



>ref|WP_028446622.1| hypothetical protein [Chitinimonas koreensis]
Length=627

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = -2

Query  565  LYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFT  386
            L    F T V  L+FG+Y + C++WL    + AFS +    YK F RF I+  G+L  + 
Sbjct  525  LVLTAFGTLVGGLLFGTY-FACMSWLGCLGNNAFSPVAYQGYKGFLRFRIDRDGNLHGYM  583

Query  385  LAVDKVPKEWKLDSNWETEPQQPSYVRK  302
            L  D VP+ W+L  N +   ++P +V +
Sbjct  584  LGTDSVPRRWRL--NPDPRARRPVWVER  609



>gb|AFE05765.1| hypothetical protein COCOR_04316 [Corallococcus coralloides DSM 
2259]
Length=606

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -2

Query  529  LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKL  350
            LV G YL + +N    H +EAFSSL I ++K+F R H +  G+L V+ +   +VP+ WK 
Sbjct  486  LVVGVYLLLSLNVFSCHPNEAFSSLSIPDWKNFLRLHFDEDGELTVYPVGFRRVPRRWKR  545

Query  349  DSNWETEPQQPSYVRKFPSKWRAT  278
                   P++P +V   P+  RAT
Sbjct  546  GRG----PEEPVWVPD-PTDTRAT  564



>ref|WP_043323473.1| hypothetical protein, partial [Corallococcus coralloides]
Length=546

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -2

Query  529  LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKL  350
            LV G YL + +N    H +EAFSSL I ++K+F R H +  G+L V+ +   +VP+ WK 
Sbjct  457  LVVGVYLLLSLNVFSCHPNEAFSSLSIPDWKNFLRLHFDEDGELTVYPVGFRRVPRRWKR  516

Query  349  DSNWETEPQQPSYVRKFPSKWRAT  278
                   P++P +V   P+  RAT
Sbjct  517  GRG----PEEPVWVPD-PTDTRAT  535



>ref|WP_006609975.1| hypothetical protein [Bradyrhizobium sp. ORS 285]
 emb|CCD84635.1| conserved membrane hypothetical protein [Bradyrhizobium sp. ORS 
285]
Length=612

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -2

Query  523  FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPK--EWKL  350
            FG  + I   WL ++ ++AFS+LRI +Y +F R  I    D++V  + +D+VP+  EW+ 
Sbjct  513  FGLNMLITCRWLRMNRNDAFSALRIGHYNNFLRLRIEGD-DVKVHAIGLDRVPERHEWRD  571

Query  349  DSNW-ETEPQQPSYVRKFP  296
            +S + E +PQQP +V   P
Sbjct  572  NSQYREGQPQQPRFVPAAP  590



>ref|WP_009027423.1| hypothetical protein [Bradyrhizobium sp. ORS 375]
 emb|CCD92439.1| conserved membrane hypothetical protein [Bradyrhizobium sp. ORS 
375]
Length=615

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = -2

Query  523  FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPK--EWKL  350
            FG  + I   WL ++ ++AFS+LRI +Y +F R  I    D++V  + +DKVP+  EW+ 
Sbjct  513  FGLNMLITCRWLRMNRNDAFSALRIGHYNNFLRLRIEGD-DVQVHAIGLDKVPQRHEWQE  571

Query  349  DSNW-ETEPQQPSYVRKFP  296
            +  + E +PQQP +V   P
Sbjct  572  NPKYREGQPQQPRFVPAAP  590



>gb|AHG91819.1| hypothetical protein J421_4282 [Gemmatimonadetes bacterium KBS708]
Length=585

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 7/112 (6%)
 Frame = -2

Query  586  IYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTK  407
            + + +V  +  V    V S++ G YL I +N  H H  EAFSS+RI +YKS+ R  +   
Sbjct  455  LQWLTVGGFLLVGGYVVGSVIMGLYLLISLNLFHRHNTEAFSSMRIEDYKSWLRLQVTPD  514

Query  406  GDLEVFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWRATS--LQQDPI  257
            G L ++ + + +V ++W+       EP+  +     P    AT+  L + PI
Sbjct  515  GALRIYPIKLHRVARKWR-----PAEPRDATPSLLVPDDPHATAPELIESPI  561



>ref|WP_035319266.1| hypothetical protein [Brevibacillus laterosporus]
Length=610

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 6/115 (5%)
 Frame = -2

Query  598  GGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFH  419
            G   +Y   + +  WV  + ++ L    YLYI +N    H +EAFSSL++ ++K+F R H
Sbjct  492  GTLALYMLFMAIGGWVIGSSIMGL----YLYISLNVFGRHSNEAFSSLKVEDWKNFLRIH  547

Query  418  INTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWRAT-SLQQDPI  257
            I+ +G+L ++ + ++K+   W      +T P     V K+P   +A   L + PI
Sbjct  548  IDKEGNLTIYPIGLEKIVTHWNPAPLTDTGPLLEPDV-KYPEIRKAVPKLIESPI  601



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876