BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4247

Length=821
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN66846.1|  hypothetical protein VITISV_002367                     345   6e-112   Vitis vinifera
emb|CBI40977.3|  unnamed protein product                                345   7e-112   Vitis vinifera
ref|XP_007047111.1|  Cytochrome P450                                    341   2e-110   
gb|KHN36186.1|  Cytochrome P450 82A3                                    339   1e-109   Glycine soja [wild soybean]
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    339   1e-109   Glycine max [soybeans]
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    343   7e-109   
gb|KHN42045.1|  Cytochrome P450 82C4                                    333   5e-108   Glycine soja [wild soybean]
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           334   1e-107   Populus euphratica
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            332   5e-107   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    331   1e-106   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               331   2e-106   Glycine max [soybeans]
gb|KHN42044.1|  Cytochrome P450 82A3                                    330   3e-106   Glycine soja [wild soybean]
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             330   3e-106   Phaseolus vulgaris [French bean]
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    329   1e-105   Glycine max [soybeans]
gb|KHN36187.1|  Cytochrome P450 82A3                                    328   1e-105   Glycine soja [wild soybean]
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           328   3e-105   Eucalyptus grandis [rose gum]
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     325   2e-104   Eucalyptus grandis [rose gum]
ref|XP_007047112.1|  Cytochrome P450                                    330   2e-104   
ref|XP_010026403.1|  PREDICTED: cytochrome P450 82C4-like               320   4e-103   
ref|XP_010089020.1|  Cytochrome P450 82A3                               322   5e-103   Morus notabilis
ref|XP_007033359.1|  Cytochrome P450                                    321   6e-103   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                320   3e-102   Vitis vinifera
gb|KJB43594.1|  hypothetical protein B456_007G208800                    321   5e-102   Gossypium raimondii
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             318   1e-101   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           317   3e-101   Eucalyptus grandis [rose gum]
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           317   4e-101   Eucalyptus grandis [rose gum]
gb|KJB58365.1|  hypothetical protein B456_009G207000                    317   5e-101   Gossypium raimondii
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           317   5e-101   Eucalyptus grandis [rose gum]
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             317   6e-101   Populus trichocarpa [western balsam poplar]
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             316   7e-101   Prunus persica
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             317   8e-101   
gb|KJB43593.1|  hypothetical protein B456_007G208700                    315   1e-100   Gossypium raimondii
ref|XP_002522370.1|  cytochrome P450, putative                          315   1e-100   Ricinus communis
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             315   4e-100   Populus trichocarpa [western balsam poplar]
gb|KDP34891.1|  hypothetical protein JCGZ_09179                         311   4e-100   Jatropha curcas
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   4e-100   Pyrus x bretschneideri [bai li]
gb|KJB58366.1|  hypothetical protein B456_009G207100                    314   4e-100   Gossypium raimondii
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   6e-100   Nelumbo nucifera [Indian lotus]
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             313   8e-100   Prunus persica
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   9e-100   Populus euphratica
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             313   9e-100   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               313   1e-99    Populus euphratica
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   312   1e-99    Citrus sinensis [apfelsine]
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     311   2e-99    Eucalyptus grandis [rose gum]
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           313   2e-99    
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     312   2e-99    Eucalyptus grandis [rose gum]
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           312   3e-99    Eucalyptus grandis [rose gum]
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             312   3e-99    
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               312   3e-99    Citrus sinensis [apfelsine]
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           312   4e-99    
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             311   4e-99    Prunus persica
ref|XP_010106082.1|  Cytochrome P450 82A3                               311   5e-99    
ref|XP_007017413.1|  Cytochrome P450                                    311   8e-99    
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               312   8e-99    Citrus sinensis [apfelsine]
ref|XP_006428103.1|  hypothetical protein CICLE_v10026027mg             305   9e-99    
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           310   2e-98    Populus euphratica
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   310   2e-98    Citrus sinensis [apfelsine]
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             310   2e-98    Citrus clementina [clementine]
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     309   3e-98    Eucalyptus grandis [rose gum]
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           310   4e-98    Eucalyptus grandis [rose gum]
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           309   4e-98    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP07593.1|  unnamed protein product                                307   4e-98    Coffea canephora [robusta coffee]
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           310   4e-98    Pyrus x bretschneideri [bai li]
emb|CDP07595.1|  unnamed protein product                                318   5e-98    Coffea canephora [robusta coffee]
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           309   5e-98    
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           309   5e-98    Vitis vinifera
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             307   7e-98    
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               320   1e-97    
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    308   2e-97    
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           307   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           306   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_006366436.1|  PREDICTED: cytochrome P450 82A3-like               298   6e-97    Solanum tuberosum [potatoes]
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    306   7e-97    
emb|CBI32517.3|  unnamed protein product                                298   7e-97    Vitis vinifera
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           313   9e-97    
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               306   9e-97    Glycine max [soybeans]
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             305   1e-96    
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               305   1e-96    
gb|AAP49697.1|  cytochrome P-450-like protein                           296   1e-96    Vitis vinifera
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           305   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               305   2e-96    Citrus sinensis [apfelsine]
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           305   2e-96    Eucalyptus grandis [rose gum]
ref|XP_006428104.1|  hypothetical protein CICLE_v10027210mg             300   2e-96    
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         305   2e-96    Jatropha curcas
emb|CAN72749.1|  hypothetical protein VITISV_004418                     296   3e-96    Vitis vinifera
gb|KHN22284.1|  Cytochrome P450 82A3                                    302   3e-96    Glycine soja [wild soybean]
gb|KJB63760.1|  hypothetical protein B456_010G014600                    304   3e-96    Gossypium raimondii
ref|XP_006428105.1|  hypothetical protein CICLE_v10027089mg             299   3e-96    
emb|CBI32508.3|  unnamed protein product                                298   4e-96    Vitis vinifera
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   302   4e-96    Citrus sinensis [apfelsine]
gb|AII31758.1|  cytochrome P450 monooxygenase                           304   4e-96    Gossypium hirsutum [American cotton]
ref|XP_004293232.2|  PREDICTED: cytochrome P450 CYP82D47-like           304   4e-96    Fragaria vesca subsp. vesca
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             301   4e-96    
gb|KDO37196.1|  hypothetical protein CISIN_1g019564mg                   298   5e-96    Citrus sinensis [apfelsine]
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             304   5e-96    Citrus clementina [clementine]
gb|KHG29694.1|  Cytochrome P450                                         304   5e-96    Gossypium arboreum [tree cotton]
ref|XP_010106088.1|  Cytochrome P450 82A4                               304   5e-96    
ref|XP_006384482.1|  hypothetical protein POPTR_0004s15470g             298   5e-96    
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             304   5e-96    Citrus clementina [clementine]
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               303   5e-96    Solanum tuberosum [potatoes]
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             303   6e-96    Citrus clementina [clementine]
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             304   6e-96    Phaseolus vulgaris [French bean]
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               303   6e-96    Pyrus x bretschneideri [bai li]
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           304   6e-96    Eucalyptus grandis [rose gum]
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   303   7e-96    Citrus sinensis [apfelsine]
gb|KJB58361.1|  hypothetical protein B456_009G206600                    303   8e-96    Gossypium raimondii
gb|AII31759.1|  cytochrome P450 monooxygenase                           303   8e-96    Gossypium hirsutum [American cotton]
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    303   8e-96    
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           303   9e-96    Vitis vinifera
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               301   1e-95    Solanum tuberosum [potatoes]
ref|XP_002510313.1|  cytochrome P450, putative                          303   1e-95    Ricinus communis
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             303   1e-95    Citrus clementina [clementine]
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           303   1e-95    Eucalyptus grandis [rose gum]
ref|XP_008388074.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    295   2e-95    
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             300   2e-95    
gb|AII31760.1|  cytochrome P450 monooxygenase                           302   2e-95    Gossypium hirsutum [American cotton]
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               302   2e-95    Solanum tuberosum [potatoes]
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   302   2e-95    Citrus sinensis [apfelsine]
gb|KJB60932.1|  hypothetical protein B456_009G331600                    302   3e-95    Gossypium raimondii
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             301   3e-95    
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           302   3e-95    Solanum lycopersicum
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           302   3e-95    
gb|KHG24650.1|  Cytochrome P450 protein                                 301   4e-95    Gossypium arboreum [tree cotton]
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    301   4e-95    
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               301   5e-95    Glycine max [soybeans]
ref|XP_007158552.1|  hypothetical protein PHAVU_002G161900g             295   5e-95    Phaseolus vulgaris [French bean]
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             301   5e-95    Phaseolus vulgaris [French bean]
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     304   6e-95    
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               301   6e-95    Citrus sinensis [apfelsine]
ref|XP_010106089.1|  Cytochrome P450 82C4                               301   6e-95    Morus notabilis
gb|AJZ68877.1|  gossypol pathway P450 hydroxylase                       301   7e-95    Gossypium hirsutum [American cotton]
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           300   7e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG29695.1|  Cytochrome P450                                         301   7e-95    Gossypium arboreum [tree cotton]
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           301   8e-95    Prunus mume [ume]
gb|AJD25201.1|  cytochrome P450 CYP82D71                                300   8e-95    Salvia miltiorrhiza [Chinese salvia]
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     301   9e-95    Eucalyptus grandis [rose gum]
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           300   1e-94    Nicotiana sylvestris
gb|KHG01290.1|  Cytochrome P450                                         300   1e-94    Gossypium arboreum [tree cotton]
emb|CBI32515.3|  unnamed protein product                                292   1e-94    Vitis vinifera
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               300   1e-94    Citrus sinensis [apfelsine]
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     306   2e-94    
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   300   2e-94    Citrus sinensis [apfelsine]
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           300   2e-94    Pyrus x bretschneideri [bai li]
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               299   2e-94    Citrus sinensis [apfelsine]
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               300   2e-94    Citrus sinensis [apfelsine]
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               299   2e-94    Fragaria vesca subsp. vesca
emb|CBI19610.3|  unnamed protein product                                309   3e-94    Vitis vinifera
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               299   3e-94    
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           299   3e-94    
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               299   3e-94    Citrus sinensis [apfelsine]
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           299   4e-94    
ref|XP_010686299.1|  PREDICTED: cytochrome P450 CYP82D47-like           299   4e-94    
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           299   4e-94    Cucumis melo [Oriental melon]
gb|KJB58364.1|  hypothetical protein B456_009G206900                    299   4e-94    Gossypium raimondii
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    299   5e-94    Populus euphratica
dbj|BAF98469.1|  cytochrome P450                                        298   5e-94    Coptis japonica var. dissecta
emb|CDP16080.1|  unnamed protein product                                299   5e-94    Coffea canephora [robusta coffee]
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               298   5e-94    Citrus sinensis [apfelsine]
emb|CBI36493.3|  unnamed protein product                                292   6e-94    Vitis vinifera
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               298   7e-94    Pyrus x bretschneideri [bai li]
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             298   7e-94    Citrus clementina [clementine]
ref|XP_002313829.2|  hypothetical protein POPTR_0009s11180g             295   7e-94    
ref|XP_010106083.1|  Cytochrome P450 82A3                               298   8e-94    Morus notabilis
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           298   9e-94    Solanum lycopersicum
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           298   9e-94    Populus euphratica
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                297   1e-93    Vitis vinifera
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    297   1e-93    Vitis vinifera
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           297   1e-93    Mentha x piperita
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             298   1e-93    Citrus clementina [clementine]
ref|XP_007226806.1|  hypothetical protein PRUPE_ppa017795mg             295   1e-93    
ref|XP_007017411.1|  Cytochrome P450, putative                          297   2e-93    
ref|XP_010092357.1|  Cytochrome P450 82A3                               298   2e-93    Morus notabilis
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                297   2e-93    Vitis vinifera
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               297   2e-93    
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           297   2e-93    
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               297   2e-93    
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    297   2e-93    Populus euphratica
ref|XP_012071743.1|  PREDICTED: cytochrome P450 CYP82D47-like           296   3e-93    
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   296   3e-93    Citrus sinensis [apfelsine]
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               295   3e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             296   3e-93    Citrus clementina [clementine]
ref|XP_007017415.1|  Cytochrome P450, putative                          296   4e-93    
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               307   4e-93    
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               296   5e-93    Glycine max [soybeans]
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               296   5e-93    Cicer arietinum [garbanzo]
ref|XP_004147803.2|  PREDICTED: cytochrome P450 CYP82D47-like           296   5e-93    Cucumis sativus [cucumbers]
ref|XP_006375028.1|  hypothetical protein POPTR_0014s03730g             290   6e-93    
emb|CAN64371.1|  hypothetical protein VITISV_016844                     296   6e-93    Vitis vinifera
ref|XP_009365936.1|  PREDICTED: cytochrome P450 82A3-like               290   7e-93    
ref|XP_010686309.1|  PREDICTED: cytochrome P450 CYP82D47-like           295   7e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               295   8e-93    Elaeis guineensis
ref|XP_006375024.1|  hypothetical protein POPTR_0014s03690g             292   9e-93    
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             295   1e-92    
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           295   1e-92    Eucalyptus grandis [rose gum]
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    295   1e-92    Vitis vinifera
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             295   1e-92    
ref|XP_003618354.1|  Cytochrome P450                                    295   1e-92    Medicago truncatula
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           295   1e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               295   1e-92    Solanum tuberosum [potatoes]
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             295   1e-92    Citrus clementina [clementine]
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     295   2e-92    Eucalyptus grandis [rose gum]
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           295   2e-92    Ocimum basilicum [basil]
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             293   2e-92    
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    295   2e-92    Populus euphratica
emb|CAN64501.1|  hypothetical protein VITISV_020341                     293   2e-92    Vitis vinifera
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               294   2e-92    
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           295   2e-92    Eucalyptus grandis [rose gum]
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               294   2e-92    
emb|CBI19611.3|  unnamed protein product                                303   3e-92    Vitis vinifera
gb|KJB47835.1|  hypothetical protein B456_008G044400                    294   3e-92    Gossypium raimondii
ref|XP_006375029.1|  putative cytochrome P450 family protein            294   3e-92    Populus trichocarpa [western balsam poplar]
gb|KHN04536.1|  Cytochrome P450 82A1                                    293   4e-92    Glycine soja [wild soybean]
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               293   6e-92    Glycine max [soybeans]
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             293   6e-92    
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                293   8e-92    Vitis vinifera
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               293   8e-92    
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             293   9e-92    Citrus clementina [clementine]
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           292   1e-91    Populus euphratica
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                295   1e-91    Vitis vinifera
ref|XP_010686300.1|  PREDICTED: cytochrome P450 CYP82D47-like           290   1e-91    
ref|XP_002510298.1|  cytochrome P450, putative                          292   1e-91    Ricinus communis
ref|XP_003604789.1|  Cytochrome P450                                    293   1e-91    Medicago truncatula
emb|CBI25922.3|  unnamed protein product                                284   1e-91    Vitis vinifera
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               291   1e-91    
emb|CBI32510.3|  unnamed protein product                                295   2e-91    Vitis vinifera
emb|CBI36489.3|  unnamed protein product                                285   2e-91    Vitis vinifera
emb|CDY53704.1|  BnaC03g67210D                                          292   2e-91    Brassica napus [oilseed rape]
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               292   2e-91    
ref|XP_012072001.1|  PREDICTED: cytochrome P450 82A3-like               292   2e-91    Jatropha curcas
emb|CDY23316.1|  BnaA08g12300D                                          292   2e-91    Brassica napus [oilseed rape]
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             291   2e-91    Citrus clementina [clementine]
gb|KEH37856.1|  cytochrome P450 family protein                          291   2e-91    Medicago truncatula
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               292   2e-91    Prunus mume [ume]
ref|XP_004306669.1|  PREDICTED: cytochrome P450 CYP82D47-like           292   2e-91    Fragaria vesca subsp. vesca
gb|KHG07801.1|  Cytochrome P450                                         291   3e-91    Gossypium arboreum [tree cotton]
gb|KHN08850.1|  Cytochrome P450 82C4                                    288   3e-91    Glycine soja [wild soybean]
ref|XP_012085047.1|  PREDICTED: cytochrome P450 CYP82D47-like           291   4e-91    Jatropha curcas
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               291   5e-91    Populus euphratica
gb|KHN44000.1|  Cytochrome P450 82A4                                    291   5e-91    Glycine soja [wild soybean]
ref|XP_012071999.1|  PREDICTED: cytochrome P450 CYP82D47-like           291   5e-91    Jatropha curcas
emb|CBI29742.3|  unnamed protein product                                281   5e-91    Vitis vinifera
gb|KCW55291.1|  hypothetical protein EUGRSUZ_I01217                     283   6e-91    Eucalyptus grandis [rose gum]
ref|XP_007049681.1|  Cytochrome P450                                    290   7e-91    
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               290   7e-91    Nicotiana tomentosiformis
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           290   8e-91    Cucumis melo [Oriental melon]
ref|XP_003611843.1|  Cytochrome P450 82A3                               280   8e-91    
ref|XP_010064545.1|  PREDICTED: cytochrome P450 82A3-like               282   9e-91    Eucalyptus grandis [rose gum]
gb|KJB10202.1|  hypothetical protein B456_001G188600                    290   1e-90    Gossypium raimondii
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               290   1e-90    
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    290   1e-90    
gb|KJB63757.1|  hypothetical protein B456_010G014300                    290   1e-90    Gossypium raimondii
gb|KCW55290.1|  hypothetical protein EUGRSUZ_I01217                     285   1e-90    Eucalyptus grandis [rose gum]
ref|XP_002510301.1|  cytochrome P450, putative                          289   1e-90    
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     290   2e-90    
gb|KHN22283.1|  Cytochrome P450 82C4                                    287   2e-90    Glycine soja [wild soybean]
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           289   2e-90    Sesamum indicum [beniseed]
gb|KJB63767.1|  hypothetical protein B456_010G015400                    289   2e-90    Gossypium raimondii
ref|XP_003618361.1|  Cytochrome P450                                    289   2e-90    Medicago truncatula
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               289   2e-90    Glycine max [soybeans]
gb|KHN34164.1|  Cytochrome P450 82A4                                    289   2e-90    Glycine soja [wild soybean]
ref|NP_001240972.1|  cytochrome P450 82A3                               289   3e-90    Glycine max [soybeans]
emb|CAN65652.1|  hypothetical protein VITISV_016780                     287   3e-90    Vitis vinifera
gb|AAS90126.1|  cytochrome P450                                         289   3e-90    Ammi majus [ameo mayor]
ref|XP_011465960.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    289   4e-90    Fragaria vesca subsp. vesca
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               288   4e-90    Pyrus x bretschneideri [bai li]
ref|XP_010104162.1|  Cytochrome P450 82C4                               287   4e-90    
gb|KHG01223.1|  Cytochrome P450 protein                                 288   5e-90    Gossypium arboreum [tree cotton]
gb|KDO36736.1|  hypothetical protein CISIN_1g026655mg                   279   5e-90    Citrus sinensis [apfelsine]
gb|KJB63765.1|  hypothetical protein B456_010G015200                    288   6e-90    Gossypium raimondii
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     288   7e-90    
gb|ABB20912.1|  P450 mono-oxygenase                                     288   7e-90    Stevia rebaudiana
ref|XP_007041358.1|  Cytochrome P450, putative                          287   8e-90    
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                288   8e-90    Erythranthe guttata [common monkey flower]
ref|XP_002531093.1|  cytochrome P450, putative                          288   9e-90    
ref|XP_002510305.1|  cytochrome P450, putative                          288   1e-89    
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               288   1e-89    Malus domestica [apple tree]
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    288   1e-89    Pisum sativum [garden pea]
emb|CAN75482.1|  hypothetical protein VITISV_020998                     286   1e-89    Vitis vinifera
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   287   2e-89    Citrus sinensis [apfelsine]
gb|KJB78289.1|  hypothetical protein B456_012G164400                    286   2e-89    
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               286   2e-89    
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               287   2e-89    
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           287   2e-89    
gb|AES74584.2|  cytochrome P450 family protein                          287   2e-89    
ref|XP_002510297.1|  cytochrome P450, putative                          286   2e-89    
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               286   3e-89    
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             288   3e-89    
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               286   3e-89    
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                286   3e-89    
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               286   4e-89    
ref|XP_011652397.1|  PREDICTED: cytochrome P450 CYP82D47-like           286   4e-89    
ref|XP_004147804.1|  PREDICTED: cytochrome P450 CYP82D47-like           286   4e-89    
gb|KCW67760.1|  hypothetical protein EUGRSUZ_F01497                     283   5e-89    
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               286   5e-89    
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    286   5e-89    
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                285   5e-89    
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             286   5e-89    
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               285   5e-89    
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               285   6e-89    
gb|KHN16362.1|  Cytochrome P450 82A3                                    285   7e-89    
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           286   7e-89    
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                285   7e-89    
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               285   8e-89    
ref|XP_002510312.1|  cytochrome P450, putative                          285   9e-89    
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           285   1e-88    
gb|AGO03797.1|  cytochrome P450-like protein                            285   1e-88    
ref|XP_009365916.1|  PREDICTED: cytochrome P450 82A4-like               281   1e-88    
emb|CAN77159.1|  hypothetical protein VITISV_019026                     287   1e-88    
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         283   1e-88    
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             285   1e-88    
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   2e-88    
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    284   2e-88    
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               283   2e-88    
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   2e-88    
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           284   2e-88    
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    284   2e-88    
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   2e-88    
ref|XP_004147820.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   2e-88    
gb|KDP20667.1|  hypothetical protein JCGZ_03867                         281   2e-88    
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              284   3e-88    
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   3e-88    
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             283   3e-88    
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               284   3e-88    
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    283   4e-88    
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               283   4e-88    
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           285   4e-88    
gb|KDP20666.1|  hypothetical protein JCGZ_03866                         279   4e-88    
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               283   4e-88    
ref|XP_006431673.1|  hypothetical protein CICLE_v10003405mg             278   5e-88    
gb|EYU23761.1|  hypothetical protein MIMGU_mgv1a004606mg                283   5e-88    
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           283   5e-88    
emb|CBI32505.3|  unnamed protein product                                293   5e-88    
gb|KEH33015.1|  cytochrome P450 family 82 protein                       283   6e-88    
gb|KFK29807.1|  hypothetical protein AALP_AA7G181700                    277   7e-88    
ref|XP_006431671.1|  hypothetical protein CICLE_v10002486mg             271   1e-87    
gb|KJB77900.1|  hypothetical protein B456_012G164300                    283   1e-87    
ref|XP_003618363.1|  Cytochrome P450                                    282   2e-87    
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         283   2e-87    
emb|CAN74205.1|  hypothetical protein VITISV_031127                     281   2e-87    
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           282   2e-87    
ref|XP_012071747.1|  PREDICTED: cytochrome P450 CYP82D47-like           281   2e-87    
ref|XP_006376421.1|  cytochrome P450 family protein                     281   2e-87    
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               281   2e-87    
gb|KHN00733.1|  Cytochrome P450 82A4                                    281   2e-87    
ref|XP_003618345.1|  Cytochrome P450                                    281   2e-87    
ref|XP_004147824.1|  PREDICTED: cytochrome P450 CYP82D47                281   2e-87    
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           281   3e-87    
gb|KHN03067.1|  Cytochrome P450 82G1                                    277   3e-87    
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             281   3e-87    
ref|XP_012092500.1|  PREDICTED: methyltetrahydroprotoberberine 14...    279   3e-87    
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           281   3e-87    
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         281   3e-87    
ref|XP_002869302.1|  CYP82C4                                            281   3e-87    
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           281   4e-87    
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               281   4e-87    
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               280   4e-87    
ref|XP_012092501.1|  PREDICTED: cytochrome P450 CYP82D47-like           281   5e-87    
ref|XP_002510308.1|  cytochrome P450, putative                          280   6e-87    
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             280   6e-87    
gb|KFK29810.1|  hypothetical protein AALP_AA7G181800                    275   6e-87    
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               280   7e-87    
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             280   8e-87    
ref|XP_012071738.1|  PREDICTED: cytochrome P450 82C4-like               280   9e-87    
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               280   1e-86    
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               279   1e-86    
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 279   2e-86    
ref|XP_012071746.1|  PREDICTED: cytochrome P450 82C4-like               278   2e-86    
ref|XP_011652396.1|  PREDICTED: cytochrome P450 CYP82D47-like           279   2e-86    
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               279   2e-86    
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           279   2e-86    
ref|XP_002531094.1|  cytochrome P450, putative                          279   2e-86    
ref|XP_008219200.1|  PREDICTED: cytochrome P450 82A1-like               275   3e-86    
ref|XP_012071739.1|  PREDICTED: cytochrome P450 82C4-like               278   3e-86    
gb|AES94801.2|  cytochrome P450 family protein                          268   3e-86    
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               279   4e-86    
gb|KHG07864.1|  Cytochrome P450 protein                                 278   4e-86    
ref|XP_012081502.1|  PREDICTED: cytochrome P450 CYP82D47-like           278   6e-86    
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         279   6e-86    
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               278   6e-86    
ref|XP_002869304.1|  CYP82C4                                            278   6e-86    
ref|XP_002510311.1|  cytochrome P450, putative                          278   6e-86    
ref|XP_008464762.1|  PREDICTED: cytochrome P450 CYP82D47-like           278   6e-86    
ref|XP_004308852.2|  PREDICTED: cytochrome P450 CYP82D47-like           278   7e-86    
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           277   7e-86    
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             277   7e-86    
ref|XP_007226237.1|  hypothetical protein PRUPE_ppa017476mg             273   1e-85    
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     287   1e-85    
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               277   1e-85    
ref|XP_004147801.1|  PREDICTED: cytochrome P450 CYP82D47-like           276   2e-85    
ref|XP_010026987.1|  PREDICTED: cytochrome P450 CYP82D47-like           274   3e-85    
ref|XP_010106080.1|  Cytochrome P450 82A3                               279   3e-85    
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             276   3e-85    
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    276   3e-85    
gb|KHN13272.1|  Cytochrome P450 82A4                                    276   3e-85    
gb|KJB08798.1|  hypothetical protein B456_001G104500                    276   3e-85    
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               276   4e-85    
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             275   4e-85    
ref|XP_012071740.1|  PREDICTED: cytochrome P450 82C4-like               276   4e-85    
gb|AGC29951.1|  CYP82D61                                                273   4e-85    
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           273   4e-85    
gb|KHN22285.1|  Cytochrome P450 82A4                                    276   4e-85    
ref|XP_003618365.1|  Cytochrome P450                                    276   4e-85    
gb|AES74583.2|  cytochrome P450 family 82 protein                       275   5e-85    
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           275   5e-85    
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               276   5e-85    
ref|XP_007222289.1|  hypothetical protein PRUPE_ppa005918mg             273   5e-85    
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               275   6e-85    
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               275   6e-85    
ref|XP_010106079.1|  Cytochrome P450 82A3                               275   6e-85    
ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               275   7e-85    
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               275   7e-85    
ref|XP_010060879.1|  PREDICTED: cytochrome P450 CYP82D47-like           275   7e-85    
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               275   8e-85    
sp|F2Z9C1.1|P6H_ESCCA  RecName: Full=Protopine 6-monooxygenase; A...    275   1e-84    
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             274   1e-84    
gb|KHN19614.1|  Cytochrome P450 82A4                                    274   1e-84    
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           275   1e-84    
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    275   1e-84    
ref|XP_003619141.1|  Cytochrome P450                                    274   1e-84    
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    274   1e-84    
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     274   1e-84    
ref|XP_012092498.1|  PREDICTED: cytochrome P450 CYP82D47-like           272   1e-84    
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             274   1e-84    
ref|XP_007136642.1|  hypothetical protein PHAVU_009G061400g             273   2e-84    
gb|AFK38862.1|  unknown                                                 274   2e-84    
ref|XP_003619137.1|  Cytochrome P450                                    274   2e-84    
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             274   2e-84    
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           274   2e-84    
ref|XP_006479335.1|  PREDICTED: cytochrome P450 82G1-like               269   2e-84    
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           273   3e-84    
ref|XP_011458158.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    273   3e-84    
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     273   3e-84    
gb|KDO38290.1|  hypothetical protein CISIN_1g0485651mg                  266   4e-84    
gb|KJB08751.1|  hypothetical protein B456_001G104400                    273   4e-84    
prf||2209439B  cytochrome P450 monooxygenase                            273   4e-84 
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               273   4e-84    
ref|XP_006856219.2|  PREDICTED: cytochrome P450 82C4                    264   5e-84    
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               273   5e-84    
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 273   5e-84    
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    273   5e-84    
gb|AGN54072.1|  cytochrome P450 monooxygenase                           273   5e-84    
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               272   6e-84    
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    274   6e-84    
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             273   7e-84    
gb|KJB59837.1|  hypothetical protein B456_009G274900                    272   8e-84    
ref|XP_010091295.1|  Cytochrome P450 82G1                               273   8e-84    
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               273   9e-84    
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 272   9e-84    
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             272   1e-83    
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           273   1e-83    
gb|KHG26594.1|  Cytochrome P450                                         272   1e-83    
gb|KEH30997.1|  cytochrome P450 family protein                          271   1e-83    
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    272   1e-83    
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               271   1e-83    
ref|XP_008349629.1|  PREDICTED: cytochrome P450 82A3-like               261   1e-83    
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               272   2e-83    
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    272   2e-83    
emb|CAN61061.1|  hypothetical protein VITISV_018742                     272   2e-83    
gb|KDO44149.1|  hypothetical protein CISIN_1g037793mg                   261   2e-83    
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               271   2e-83    
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             271   2e-83    
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    271   2e-83    
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             271   2e-83    
gb|KEH25406.1|  cytochrome P450 family protein                          271   2e-83    
emb|CAN63328.1|  hypothetical protein VITISV_012723                     261   3e-83    
emb|CDY46698.1|  BnaC07g42030D                                          271   3e-83    
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             270   3e-83    
emb|CBI36491.3|  unnamed protein product                                271   4e-83    
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             270   4e-83    
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           271   4e-83    
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           271   5e-83    
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               270   5e-83    
ref|XP_008464763.1|  PREDICTED: cytochrome P450 82A3-like               270   6e-83    
ref|XP_003618351.1|  Cytochrome P450 82A1                               270   6e-83    
ref|XP_012071745.1|  PREDICTED: cytochrome P450 CYP82D47-like           270   7e-83    
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             270   8e-83    
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   271   8e-83    
ref|XP_004291926.1|  PREDICTED: cytochrome P450 CYP82D47-like           270   8e-83    
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    270   8e-83    
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             270   9e-83    
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             270   9e-83    
emb|CDY46700.1|  BnaC07g42050D                                          268   1e-82    
ref|XP_009137862.1|  PREDICTED: cytochrome P450 CYP82D47-like           270   1e-82    
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             270   1e-82    
emb|CDY30201.1|  BnaA03g49690D                                          270   1e-82    
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    269   1e-82    
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               269   1e-82    
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           269   1e-82    
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           269   1e-82    
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    268   1e-82    
ref|XP_002880657.1|  CYP82F1                                            269   1e-82    
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             269   1e-82    
gb|KHN39915.1|  Cytochrome P450 82A2                                    266   1e-82    
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               269   2e-82    
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             269   2e-82    
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               273   2e-82    
gb|AJD25200.1|  cytochrome P450 CYP82D70                                268   2e-82    
gb|KCW67755.1|  hypothetical protein EUGRSUZ_F01490                     267   3e-82    
dbj|BAF98472.1|  cytochrome P450                                        268   3e-82    
ref|XP_008454675.1|  PREDICTED: cytochrome P450 CYP82D47-like           264   3e-82    



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR +  EGK  +DFMDVML ++ED    SGFDADT+ KATCLN+++AGSD   VTLTWAL
Sbjct  279  KRLLGGEGKDDQDFMDVMLTVLED-VNFSGFDADTVNKATCLNLILAGSDTTKVTLTWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L K Q ELD Q+G+ R V+ESD+KNLV+LQA+IKETLRLYP  P+  L ++
Sbjct  338  SLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLHAA  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCTL+ GY++ AGT++M+N WKIHRDE +W  P EFQPERF+T+HKD DVRGQHFELI
Sbjct  398  MEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFELI  457

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPGI L+LQ +H  LA+LLH ++   PS+  +DM+ES GL N+KATPL+V L
Sbjct  458  PFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEVLL  517

Query  101  TPRLPATVF  75
            +PRL A ++
Sbjct  518  SPRLKAELY  526



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR +  EGK  +DFMDVML ++ED    SGFDADT+ KATCLN+++AGSD   VTLTWAL
Sbjct  294  KRLLGGEGKDDQDFMDVMLTVLED-VNFSGFDADTVNKATCLNLILAGSDTTKVTLTWAL  352

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L K Q ELD Q+G+ R V+ESD+KNLV+LQA+IKETLRLYP  P+  L ++
Sbjct  353  SLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLHAA  412

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCTL+ GY++ AGT++M+N WKIHRDE +W  P EFQPERF+T+HKD DVRGQHFELI
Sbjct  413  MEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFELI  472

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPGI L+LQ +H  LA+LLH ++   PS+  +DM+ES GL N+KATPL+V L
Sbjct  473  PFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEVLL  532

Query  101  TPRLPATVF  75
            +PRL A ++
Sbjct  533  SPRLKAELY  541



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 196/239 (82%), Gaps = 2/239 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVML I+ED  +I+GFDADTI KATCLN+++AGSD   VTLTWALSLLLNN  +L 
Sbjct  290  QDFMDVMLNILED-GKITGFDADTINKATCLNLILAGSDTTMVTLTWALSLLLNNPRVLK  348

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            + Q+ELD  +G+ R + ESDI NLV+LQ+++KETLRLYPP P+ GLR++LEDCTLS GYH
Sbjct  349  RAQDELDMHVGKDRPLEESDISNLVYLQSIVKETLRLYPPSPIIGLRAALEDCTLSTGYH  408

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +P+GTRLM+N WKI RDE +WP+P++FQPERFLT+HKD+D RGQ FELIPFGSGRRSCPG
Sbjct  409  IPSGTRLMVNAWKIQRDERVWPDPHDFQPERFLTSHKDMDFRGQTFELIPFGSGRRSCPG  468

Query  248  IQLSLQTLHICLATLLHCFDFALPSN-EKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
              L+L+ +H  L   LH FD A PS  E +DM+ESAGL N+KATPL+V +TPRL + ++
Sbjct  469  TSLALKMVHFILGRFLHSFDVAKPSKLEDVDMTESAGLTNLKATPLEVLVTPRLNSQLY  527



>gb|KHN36186.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 200/249 (80%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR  S  GK  +D M VML +++D  ++SG+D+DTIIKATCLN+++AG D+I V LTWAL
Sbjct  281  KRATSTNGKEEQDVMGVMLNVLQD-LKVSGYDSDTIIKATCLNLILAGGDSIMVALTWAL  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L K Q+ELDTQIG+ R V ESDIK L +LQA++KET+RLYPP PV  LR++
Sbjct  340  SLLLNNEIELKKAQDELDTQIGKDRKVEESDIKKLAYLQAIVKETMRLYPPSPVITLRAA  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT S GYH+PAGT L++N WKIHRD  +WP+P++F+PERFLT+HKD+DV+GQ++ELI
Sbjct  400  MEECTFSCGYHIPAGTHLIVNTWKIHRDGCVWPDPHDFKPERFLTSHKDVDVKGQNYELI  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG  L+L+ +H+ LA LLH F+ A PSN+ +DM+ES GL N+KATPL+V L
Sbjct  460  PFGSGRRVCPGSSLALRVVHMALARLLHSFNVASPSNQAVDMTESIGLTNLKATPLEVLL  519

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  520  TPRLDTKLY  528



>ref|XP_006573615.1| PREDICTED: cytochrome P450 82A3-like isoform X2 [Glycine max]
Length=530

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 200/249 (80%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR  S  GK  +D M VML +++D  ++SG+D+DTIIKATCLN+++AG D+I V LTWAL
Sbjct  281  KRATSTNGKEEQDVMGVMLNVLQD-LKVSGYDSDTIIKATCLNLILAGGDSIMVALTWAL  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L K Q+ELDTQIG+ R V ESDIK L +LQA++KET+RLYPP PV  LR++
Sbjct  340  SLLLNNEIELKKAQDELDTQIGKDRKVEESDIKKLAYLQAIVKETMRLYPPSPVITLRAA  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT S GYH+PAGT L++N WKIHRD  +WP+P++F+PERFLT+HKD+DV+GQ++ELI
Sbjct  400  MEECTFSCGYHIPAGTHLIVNTWKIHRDGCVWPDPHDFKPERFLTSHKDVDVKGQNYELI  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG  L+L+ +H+ LA LLH F+ A PSN+ +DM+ES GL N+KATPL+V L
Sbjct  460  PFGSGRRVCPGSSLALRVVHMVLARLLHSFNVASPSNQAVDMTESIGLTNLKATPLEVLL  519

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  520  TPRLDTKLY  528



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   343 bits (880),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR +  EGK  +DFMDVML ++ED    SGFDADT+ KATCLN+++AGSD   VTLTWAL
Sbjct  495  KRLLGGEGKDDQDFMDVMLTVLED-VNFSGFDADTVNKATCLNLILAGSDTTKVTLTWAL  553

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L K Q ELD Q+G+ R V+ESD+KNLV+LQA+IKETLRLYP  P+  L ++
Sbjct  554  SLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLHAA  613

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCTL+ GY++ AGT++M+N WKIHRDE +W  P EFQPERF+T+HKD DVRGQHFELI
Sbjct  614  MEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFELI  673

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPGI L+LQ +H  LA+LLH ++   PS+  +DM+ES GL N+KATPL+V L
Sbjct  674  PFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEVLL  733

Query  101  TPRLPATVF  75
            +PRL A ++
Sbjct  734  SPRLKAELY  742



>gb|KHN42045.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 203/250 (81%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARD-FMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR  + + K  +D FMDVML +++D A+ISG+D+DTIIKATCLN+++AGSD   ++LTW 
Sbjct  212  KRAFNMDAKEEQDNFMDVMLNVLKD-AEISGYDSDTIIKATCLNLILAGSDTTMISLTWV  270

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLN++  L KVQ+ELDT IG+ R V ESDI  LV+LQA++KET+RLYPP P+  LR+
Sbjct  271  LSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPSPLITLRA  330

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT S GYH+PAGTRLM+N WKIHRD  +W +P++F+P RFLT+HKD+DV+GQ++EL
Sbjct  331  AMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDVKGQNYEL  390

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR+CPG  L+L+ +H+ +A LLH F+ A PSN+ +DM+ES GL N+KATPL++ 
Sbjct  391  VPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLKATPLEIL  450

Query  104  LTPRLPATVF  75
            LTPRL   ++
Sbjct  451  LTPRLDTKLY  460



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 195/250 (78%), Gaps = 1/250 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R +  + K  +DFMDVML I+E  A I GFDADTI KATCLN+++AGSD   VTLTWAL
Sbjct  280  RRLLGGKEKQEQDFMDVMLNILEK-ANIGGFDADTINKATCLNVILAGSDTTMVTLTWAL  338

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L K ++ELD  +G+ R V+ESDI NLV+LQA+IKETLRLYPP P+   RS+
Sbjct  339  SLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRLYPPSPLIAHRSA  398

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTLS GYHVP+GTRLM N WKI RDE +WP P+EF PERFLT+ K+ID++GQ+FELI
Sbjct  399  KEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTSQKEIDLKGQNFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPGI L+L+ +H  LA LLH F+   PS E +DM+ES GL N+KATPL++ L
Sbjct  459  PFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGLTNLKATPLEILL  518

Query  101  TPRLPATVFG  72
             PRL   ++G
Sbjct  519  IPRLNPRLYG  528



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   332 bits (852),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 203/250 (81%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARD-FMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR  + + K  +D FMDVML +++D A+ISG+D+DTIIKATCLN+++AGSD   ++LTW 
Sbjct  282  KRAFNMDAKEEQDNFMDVMLNVLKD-AEISGYDSDTIIKATCLNLILAGSDTTMISLTWV  340

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLN++  L KVQ+ELDT IG+ R V ESDI  LV+LQA++KET+RLYPP P+  LR+
Sbjct  341  LSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPSPLITLRA  400

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT S GYH+PAGTRLM+N WKIHRD  +W +P++F+P RFLT+HKD+DV+GQ++EL
Sbjct  401  AMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDVKGQNYEL  460

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR+CPG  L+L+ +H+ +A LLH F+ A PSN+ +DM+ES GL N+KATPL++ 
Sbjct  461  VPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLKATPLEIL  520

Query  104  LTPRLPATVF  75
            LTPRL   ++
Sbjct  521  LTPRLDTKLY  530



>ref|XP_006573616.1| PREDICTED: cytochrome P450 82A3-like isoform X3 [Glycine max]
Length=530

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 198/243 (81%), Gaps = 1/243 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR  S  GK  +D M VML +++D  ++SG+D+DTIIKATCLN+++AG+D   VTLTWAL
Sbjct  281  KRATSTNGKEEQDVMGVMLNVLQD-LKVSGYDSDTIIKATCLNLILAGTDPTMVTLTWAL  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+++ L + Q EL T +G+ R V+ESDIK LV+LQAV+KETLRLYPP P+  LR++
Sbjct  340  SLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSPIITLRAA  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT S GYH+PAGT+LM+N WKIHRD  +W +PN+F+PERFLT+HKD+DV+GQ++EL+
Sbjct  400  MEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHKDVDVKGQNYELV  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRR+CPG  L+L+ +H+ LA LLH F+ A PSN+ +DM+ES GL N+KATPL+V L
Sbjct  460  PFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKATPLEVLL  519

Query  101  TPR  93
            TPR
Sbjct  520  TPR  522



>ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=538

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 193/237 (81%), Gaps = 1/237 (0%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            DFMDVML +++   +ISG+D+DTIIKATCLN+++AG+D   VTLTWALSLLLN++  L +
Sbjct  296  DFMDVMLNVLQG-TEISGYDSDTIIKATCLNLILAGTDPTMVTLTWALSLLLNHQMELKR  354

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             + ELDT IG+ R V ESDIK LV+LQAV+KETLRLYPP P+  LR+++EDCT S GYH+
Sbjct  355  ARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRLYPPSPIITLRAAMEDCTFSCGYHI  414

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            PAGT+LM+N WKIHRD  +W EPN+F+PERFLT HKD+DV+GQ++EL+PF SGRR+CPG 
Sbjct  415  PAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHKDVDVKGQNYELVPFSSGRRACPGA  474

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
             L+L+ +H+ LA LLH FD A PSN+ +DM+ES GL N+KATPL+V LTPRL    +
Sbjct  475  SLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGLTNLKATPLEVLLTPRLDTKFY  531



>gb|KHN42044.1| Cytochrome P450 82A3 [Glycine soja]
Length=538

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 193/237 (81%), Gaps = 1/237 (0%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            DFMDVML +++   +ISG+D+DTIIKATCLN+++AG+D   VTLTWALSLLLN++  L +
Sbjct  296  DFMDVMLNVLQG-TEISGYDSDTIIKATCLNLILAGTDPTMVTLTWALSLLLNHQMELKR  354

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             + ELDT IG+ R V ESDIK LV+LQAV+KETLRLYPP P+  LR+++EDCT S GYH+
Sbjct  355  ARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRLYPPSPIITLRAAMEDCTFSCGYHI  414

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            PAGT+LM+N WKIHRD  +W EPN+F+PERFLT HKD+DV+GQ++EL+PF SGRR+CPG 
Sbjct  415  PAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHKDVDVKGQNYELVPFSSGRRACPGA  474

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
             L+L+ +H+ LA LLH FD A PSN+ +DM+ES GL N+KATPL+V LTPRL    +
Sbjct  475  SLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGLTNLKATPLEVLLTPRLDTKFY  531



>ref|XP_007156852.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
 gb|ESW28846.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
Length=527

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 202/252 (80%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARD-FMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR +S  GK  RD FMDV+L +++   +ISG+D+DTIIKATCLN+++AG+D   VTLTWA
Sbjct  277  KRALSVNGKEERDDFMDVLLNVLQG-TEISGYDSDTIIKATCLNLVLAGTDPTMVTLTWA  335

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLN+ + L + Q ELDT IG+ R V ESDI  LV+LQAV+KETLRLYPP P+  LR+
Sbjct  336  LSLLLNHPTELKRTQHELDTLIGKDRKVEESDIDQLVYLQAVVKETLRLYPPSPIITLRA  395

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT S GYH+PAGT+LM+N WKIHRD  +W +P++F+PERFLT+HKD+DV+GQ++EL
Sbjct  396  AMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPHDFKPERFLTSHKDVDVKGQNYEL  455

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PF SGRR+CPG  L+L+ +H+ L+ LLH F  A PSN+ +DM+ES GL N+KATPL+V 
Sbjct  456  VPFSSGRRACPGASLALRVVHLTLSRLLHSFTVACPSNQVVDMTESFGLTNLKATPLEVL  515

Query  104  LTPRLPATVFGH  69
            LTPRL + ++ H
Sbjct  516  LTPRLESKLYEH  527



>ref|XP_003516592.1| PREDICTED: cytochrome P450 82A3-like isoform X1 [Glycine max]
Length=530

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 200/244 (82%), Gaps = 2/244 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARD-FMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR +S  GK  +D FMDVML +++   +ISG+D+DTIIKATCLN+++AG+D   VTLTWA
Sbjct  280  KRGLSVNGKEEQDDFMDVMLNVLQG-TEISGYDSDTIIKATCLNLILAGTDPTMVTLTWA  338

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLN+++ L + Q EL T +G+ R V+ESDIK LV+LQAV+KETLRLYPP P+  LR+
Sbjct  339  LSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSPIITLRA  398

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT S GYH+PAGT+LM+N WKIHRD  +W +PN+F+PERFLT+HKD+DV+GQ++EL
Sbjct  399  AMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHKDVDVKGQNYEL  458

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PF SGRR+CPG  L+L+ +H+ LA LLH F+ A PSN+ +DM+ES GL N+KATPL+V 
Sbjct  459  VPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKATPLEVL  518

Query  104  LTPR  93
            LTPR
Sbjct  519  LTPR  522



>gb|KHN36187.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 200/244 (82%), Gaps = 2/244 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARD-FMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR +S  GK  +D FMDVML +++   +ISG+D+DTIIKATCLN+++AG+D   VTLTWA
Sbjct  280  KRGLSVNGKEEQDDFMDVMLNVLQG-TEISGYDSDTIIKATCLNLILAGTDPTMVTLTWA  338

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLN+++ L + Q EL T +G+ R V+ESDIK LV+LQAV+KETLRLYPP P+  LR+
Sbjct  339  LSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSPIITLRA  398

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT S GYH+PAGT+LM+N WKIHRD  +W +PN+F+PERFLT+HKD+DV+GQ++EL
Sbjct  399  AMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHKDVDVKGQNYEL  458

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PF SGRR+CPG  L+L+ +H+ LA LLH F+ A PSN+ +DM+ES GL N+KATPL+V 
Sbjct  459  VPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKATPLEVL  518

Query  104  LTPR  93
            LTPR
Sbjct  519  LTPR  522



>ref|XP_010070486.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59284.1| hypothetical protein EUGRSUZ_H01963 [Eucalyptus grandis]
Length=525

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 196/250 (78%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEG-KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R+S  G  G +DFMD+ML+++E   + S FDADT++KATCLNM++AG+D + V LTWA
Sbjct  273  RKRLSHPGGDGEQDFMDLMLKVIEG-VKFSDFDADTVVKATCLNMIIAGTDTLIVGLTWA  331

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NNR  L K Q+ELDT +G+ R V ESD+KNL +LQA++KET+R YPP P+NGLRS
Sbjct  332  LSLLVNNRHALKKAQQELDTHVGKNRRVEESDVKNLTYLQAIVKETMRFYPPVPINGLRS  391

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S E+CT S GY +PAGTRL++N WKI RDE +W  P+ F+PERFLTTH+++DVRGQ+FEL
Sbjct  392  STEECTFSSGYRIPAGTRLLLNYWKIQRDERVWSNPDRFEPERFLTTHENVDVRGQNFEL  451

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRRSC G  L+L T+H+ LA+LL  F+    S + +DM+ES GL N+KA+PL+V 
Sbjct  452  IPFGAGRRSCAGTSLALHTMHLTLASLLQSFEIDTVSGKPVDMTESPGLTNLKASPLEVV  511

Query  104  LTPRLPATVF  75
            L PRL   V+
Sbjct  512  LIPRLDQKVY  521



>gb|KCW44328.1| hypothetical protein EUGRSUZ_L02217 [Eucalyptus grandis]
Length=499

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 196/250 (78%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEG-KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R+S  G  G +DFMD+ML+++E   + S FDADT++KATCLNM++AG+D + V LTWA
Sbjct  247  RKRLSHPGGDGEQDFMDLMLKVIEG-VKFSDFDADTVVKATCLNMIIAGTDTLIVVLTWA  305

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NNR  L K Q+ELDT +G+ R V ESD+KNL +LQA++KET+R YPP P+ G+RS
Sbjct  306  LSLLVNNRHALKKAQQELDTHVGKSRRVEESDVKNLTYLQAIVKETMRFYPPVPIVGIRS  365

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+CT S GY +PAGTRL++N WKI RDE +W  P+ F+PERFLTTH+++DVRGQ+FEL
Sbjct  366  SMEECTFSSGYRIPAGTRLLLNAWKIQRDERVWSNPDRFEPERFLTTHENVDVRGQNFEL  425

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRRSC G  L+L T+H+ LA+LL  F+    S + +DM+ES GL N+KA+PL+V 
Sbjct  426  IPFGAGRRSCAGTSLALYTMHLTLASLLQSFEIDTVSGKPVDMTESPGLTNLKASPLEVV  485

Query  104  LTPRLPATVF  75
            L PRL   V+
Sbjct  486  LIPRLDQKVY  495



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 198/251 (79%), Gaps = 3/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K+ +    K  +DFMDVML I+ED A+I+ FDADTI KATCLN+++AGSD   +TLTWAL
Sbjct  437  KKHLGGGLKKEQDFMDVMLNILED-AKITSFDADTINKATCLNLVLAGSDTTMITLTWAL  495

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L + Q+ELD  +G+ R + ESDI+NLV+L A++KETLRLYPP P+   R+S
Sbjct  496  SLLLNNPRVLKRAQDELDMHVGKDRLLEESDIRNLVYLHAIVKETLRLYPPSPII-FRAS  554

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCTLS GYH+PAGTRLM+N WKI RDE +WP+P+ F+PERFLT+HKD++ RGQ FELI
Sbjct  555  MEDCTLSTGYHIPAGTRLMVNAWKIQRDERVWPDPHVFKPERFLTSHKDMEFRGQTFELI  614

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSN-EKIDMSESAGLINVKATPLKVC  105
            PFGSGRRSCPG+ L+LQ +H  LA+ L  F+ + PS  E IDM+ES GL N+KATPL+V 
Sbjct  615  PFGSGRRSCPGVSLALQVVHSALASFLQSFEVSKPSKLEDIDMTESTGLTNLKATPLEVL  674

Query  104  LTPRLPATVFG  72
             TPRL + ++G
Sbjct  675  FTPRLDSKLYG  685



>ref|XP_010026403.1| PREDICTED: cytochrome P450 82C4-like [Eucalyptus grandis]
Length=470

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 195/249 (78%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR     G   +DFMD+ML ++E   + S FDADT+IKATCLN+++AG+D + V +TWAL
Sbjct  219  KRLSCPGGDREQDFMDLMLNVIEG-VKCSDFDADTVIKATCLNIIIAGTDTLIVAITWAL  277

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN   L+K Q+ELD  +G+ R+V ESD+KNL++LQA++KETLRLYPP PVNGL+SS
Sbjct  278  SLLMNNPHALEKAQQELDAHVGKRRHVEESDVKNLIYLQAIVKETLRLYPPVPVNGLKSS  337

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT S G+ +PAGTRL++N WKI RDE +W +P+ F+PERFLTTH+ +DVRGQ+FELI
Sbjct  338  MEECTFSVGFRIPAGTRLLLNAWKIQRDERVWSDPDRFEPERFLTTHEKVDVRGQNFELI  397

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRRSC G  L+L T+H+ LA+LL  F+    S E +DM+ES GL+N+KA+PL+V L
Sbjct  398  PFGAGRRSCAGTSLALHTMHLTLASLLQSFEIDTVSGEPVDMTESPGLLNLKASPLEVVL  457

Query  101  TPRLPATVF  75
             PRL   V+
Sbjct  458  VPRLDQKVY  466



>ref|XP_010089020.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB37247.1| Cytochrome P450 82A3 [Morus notabilis]
Length=515

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 187/232 (81%), Gaps = 1/232 (0%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            DFMDVML I+ DDA I  FDADTIIKATCL + +AG+++  V++TWALSLLLNN   L+K
Sbjct  284  DFMDVMLNIL-DDAGIGDFDADTIIKATCLALTLAGTESTMVSITWALSLLLNNIHKLEK  342

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             QEELD  +GR R V+ESD+  L++LQA++KETLR+YPP P+   R++ EDC LS GY V
Sbjct  343  AQEELDNVVGRDRQVDESDVPKLLYLQAIVKETLRMYPPSPLLIFRAAREDCALSSGYKV  402

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            P GTRL++N  KIHRDE +WP P+EFQPERFLT+HK IDV+GQ+FELIPFGSGRRSCPGI
Sbjct  403  PVGTRLIVNASKIHRDERVWPNPDEFQPERFLTSHKGIDVKGQNFELIPFGSGRRSCPGI  462

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
             L+L  +H+ LA+LLH F+   PSNE +DM+ES GL N+KATPL+V LTPRL
Sbjct  463  WLALNVVHLTLASLLHNFEVTKPSNEDVDMTESPGLNNLKATPLEVFLTPRL  514



>ref|XP_007033359.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY04285.1| Cytochrome P450 [Theobroma cacao]
Length=505

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 193/250 (77%), Gaps = 3/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR++    K  +DFMDV+L I+E+ A+I+GFDADTI KATCLN+++AGSD   VTL WAL
Sbjct  251  KRQLGGGSKEEQDFMDVLLNILEN-AKITGFDADTINKATCLNLILAGSDTTMVTLIWAL  309

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLL N  +L K Q ELD  +G  R V ESDI NLV+LQA++KETLRLYPPGP+   R++
Sbjct  310  SLLLKNPRVLQKAQCELDMHVGNDRRVEESDITNLVYLQAIVKETLRLYPPGPII-FRAA  368

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCTLS GYHVPAGTR+MIN WKI RDE +W +P+ FQPERFLT+HKD+D RG  FELI
Sbjct  369  MEDCTLSTGYHVPAGTRVMINAWKIQRDERVWADPHAFQPERFLTSHKDMDFRGHTFELI  428

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSN-EKIDMSESAGLINVKATPLKVC  105
            PFG GRR CP + L+++ LH+ LAT LH F+ A PSN E +DM+ES GL N+KA PL++ 
Sbjct  429  PFGFGRRLCPAVSLAIKMLHLTLATFLHSFEVAKPSNLEDVDMTESIGLTNLKARPLEIL  488

Query  104  LTPRLPATVF  75
            ++PRL   ++
Sbjct  489  VSPRLEFKLY  498



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 188/251 (75%), Gaps = 4/251 (2%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMED---DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            +R SE+  G +DFMDVML +++D   D  + GFDADTI KATCL +L  G+D + V+L W
Sbjct  284  KRSSEQADGNQDFMDVMLSMLDDMATDEDLKGFDADTINKATCLTILAGGTDTVTVSLIW  343

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLLLN   +L   +EELD+ +GR R V E D+KNL +L A++KETLRLYP GP+    
Sbjct  344  ALSLLLNKPQVLKTAREELDSHVGRERQVEERDMKNLAYLNAIVKETLRLYPAGPLTAPH  403

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             S EDC L  GYH+PAGTRL+ N+WKIHRD SIW +P+EF+PERFLTTHKD+DV+GQHFE
Sbjct  404  ESTEDCLLG-GYHIPAGTRLLANLWKIHRDPSIWSDPDEFRPERFLTTHKDVDVKGQHFE  462

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            LIPFGSGRR CPGI   LQ +   LA+L+  F+FA  S+E +DM+ES GL N+KATPL+V
Sbjct  463  LIPFGSGRRICPGISFGLQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNLKATPLEV  522

Query  107  CLTPRLPATVF  75
             + PRL + ++
Sbjct  523  LVAPRLSSDLY  533



>gb|KJB43594.1| hypothetical protein B456_007G208800 [Gossypium raimondii]
Length=585

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 193/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR M       +DFMDVML I+ED A I+ +DADTI KATCLN+++AGSD   VTLTWAL
Sbjct  335  KRLMCGGVIKEQDFMDVMLNILED-ANITCYDADTINKATCLNLVLAGSDTTMVTLTWAL  393

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L + Q+ELD  +G+ R + ESD++N+V+LQA++KETLRLYPP PV  LR++
Sbjct  394  SLLLNNPHVLKRAQDELDMHVGKHRLLEESDVRNMVYLQAIVKETLRLYPPEPVISLRAA  453

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTLS GY +P+GTRLM+N WKI RDE +WPEP++FQPERFLTT+KD+D +GQ FELI
Sbjct  454  SEDCTLSTGYRIPSGTRLMVNAWKIQRDERVWPEPHDFQPERFLTTNKDMDFQGQTFELI  513

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFA-LPSNEKIDMSESAGLINVKATPLKVC  105
            PFGSGRRSCPG+ L+L+ LH  L + LH F  A L   E +DM+ES GL N KATPL+V 
Sbjct  514  PFGSGRRSCPGVSLALKMLHFILGSFLHSFKVAKLSELEDVDMTESPGLTNPKATPLEVL  573

Query  104  LTPRLPATVF  75
            +TPRL +  F
Sbjct  574  ITPRLDSKFF  583



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 198/255 (78%), Gaps = 6/255 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   + +G +DF+DVML + E+  Q+S F  DA+T IK+TCL +++ GSD  A TL
Sbjct  267  QRRVSAGIKDEGEQDFIDVMLSLKEE-GQLSNFQYDANTSIKSTCLALILGGSDTTAGTL  325

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNNR +L K QEELD  +G+ R V +SD+KNLV+LQA+IKETLRLYP GP+ G
Sbjct  326  TWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLG  385

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++EDC ++ GYHVPAGTRL++N+WKI RD  +W  P+ F PERFLT+H D+DVRGQ 
Sbjct  386  PREAMEDCKVA-GYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQ  444

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG+  +LQ LH+ LA LLH F+ A P ++ +D++ES+GL   KATPL
Sbjct  445  FELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPL  504

Query  113  KVCLTPRLPATVFGH  69
            +V LTPRLP  ++G+
Sbjct  505  EVILTPRLPPKLYGY  519



>ref|XP_010070483.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59279.1| hypothetical protein EUGRSUZ_H01954 [Eucalyptus grandis]
Length=517

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMD M+  +E       FDADT+IKATCLNM++AG+D   V +TWALSLL+NNR  L 
Sbjct  282  QDFMDWMINALEG-RNFPDFDADTVIKATCLNMIIAGTDTSTVAITWALSLLMNNRRALK  340

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K Q+ELDT +GR R V ESD+KNL +LQA++KE LRLYPP PVNGLRSS+E+CT S G+ 
Sbjct  341  KAQQELDTHVGRSRPVEESDVKNLTYLQAIVKEALRLYPPVPVNGLRSSMEECTFSTGFR  400

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PAGTRL++NIWKI RDE +W  P+EF+PERFLTTH+++D+ GQ+FELIPFG+GRRSC G
Sbjct  401  IPAGTRLLLNIWKIQRDERVWSNPDEFRPERFLTTHENVDLIGQNFELIPFGAGRRSCVG  460

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
              L+L  LH+ LA+LL  F+ +  S+E +DM+ES GL N+KATPL+V L PRL
Sbjct  461  TSLALHMLHLVLASLLQSFEISTVSDEAVDMTESPGLANMKATPLEVMLIPRL  513



>ref|XP_010070484.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59281.1| hypothetical protein EUGRSUZ_H01958 [Eucalyptus grandis]
Length=529

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 189/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR    +  G +DFMD+M+  ++       FDADT+IKATCLNM++AG+D + V +TWAL
Sbjct  274  KRLSCPKDDGEQDFMDLMISALKG-RNFPDFDADTVIKATCLNMIIAGTDTLTVAITWAL  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+N+R  L K Q+ELDT +G+ R V ESD+KNL +LQA++KE LRLYPP  VNGLR S
Sbjct  333  SLLMNSRRALKKAQQELDTHVGKSRPVEESDVKNLTYLQAIVKEALRLYPPARVNGLRRS  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT S G+ +PAGTRL++N+WKI RDE +W  P+EF+PERFLTTH+++D+RGQ+FELI
Sbjct  393  MEECTFSSGFRIPAGTRLLLNVWKIQRDERVWSNPDEFRPERFLTTHENVDLRGQNFELI  452

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRRSC G  L+L  LH+ LA LL  F+ +  S+E +DM+ES GL N+KATPL+V L
Sbjct  453  PFGAGRRSCAGTSLALHMLHLVLARLLQSFEISTVSDEAVDMTESPGLTNMKATPLEVML  512

Query  101  TPRLPATVF  75
             PRL    +
Sbjct  513  IPRLDQKAY  521



>gb|KJB58365.1| hypothetical protein B456_009G207000 [Gossypium raimondii]
Length=526

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K  + EE KG +DF+DV+L +++    +SG+D DT+ KAT L +LV G+D + VT+TW L
Sbjct  280  KESVGEEDKGDQDFIDVLLSVLQG-LDLSGYDVDTVTKATALTLLVGGTDTVTVTITWTL  338

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR  L+K QEELDTQIG+GR VNESDI  LV+LQA++KE+LRLYP GP+ G R  
Sbjct  339  ALLLNNRHALEKAQEELDTQIGKGRLVNESDINKLVYLQAIVKESLRLYPAGPLAGAREF  398

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+   Y VP GTRL++NIWK+ RD  +W +P EF+PERFLT+H+DIDV+GQHFELI
Sbjct  399  DEDCTVGS-YFVPKGTRLIVNIWKLQRDPGVWSDPLEFKPERFLTSHQDIDVKGQHFELI  457

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR CPGI   LQ   + LAT LH F  + PSNE +DM+ S GL N+KATPL++ L
Sbjct  458  PFGAGRRLCPGISFGLQMTQLVLATFLHGFHISTPSNEPVDMTGSPGLTNIKATPLEILL  517

Query  101  TPRLPATVF  75
             PRL  +++
Sbjct  518  KPRLSPSLY  526



>ref|XP_010070481.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59276.1| hypothetical protein EUGRSUZ_H01952 [Eucalyptus grandis]
Length=525

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 191/249 (77%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR    EG   +DFMD+M+  +E     S FD DT IKATCLNM++ G+D + V +TWAL
Sbjct  274  KRLSCPEGDREQDFMDLMINALEG-RNFSDFDEDTDIKATCLNMIIGGTDTLTVAMTWAL  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NNR+ L K Q+ELDT +G+ R V ESD+KNL +LQA++KE +RLYPP P++GLR S
Sbjct  333  SLLMNNRAALKKAQQELDTHVGKSRPVEESDVKNLTYLQAIVKEAMRLYPPAPISGLRRS  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CTLS G+ VPAGTRLM+N+ KI RD  IW  P+EFQPERFLTTH+++D+RGQ+FE I
Sbjct  393  MEECTLSTGFRVPAGTRLMLNVSKIQRDGRIWSNPDEFQPERFLTTHENVDLRGQNFEFI  452

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF +GRRSC GI L+LQT+H+ LA+LL  F+ +  S+E +DM+ES GL+N KA+PL+V L
Sbjct  453  PFSAGRRSCAGISLALQTVHLTLASLLQSFEISTVSDEAVDMTESPGLLNEKASPLEVML  512

Query  101  TPRLPATVF  75
             PRL   V+
Sbjct  513  IPRLDQKVY  521



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 194/252 (77%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R +   KG  DFMD+ML++ ++DA+ + G D+DT IKAT L +++A S+  AVTL WA
Sbjct  288  RKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTTIKATSLALILAASNTTAVTLIWA  347

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN ++L K Q ELDT +G+ R V ESD++NLV+L+AV+KETLRLYP GP+     
Sbjct  348  LSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLVPHE  407

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT+  GYHVP GTRL+IN+ KIHRDE +W  PNEF PERFLTTH+  DVRG++FE 
Sbjct  408  AIEDCTI-DGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEF  466

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
             PFGSGRR CPG+  +L  + + LATLLH FDFA PS E +DM ES+GL N++ATPL+V 
Sbjct  467  FPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVL  526

Query  104  LTPRLPATVFGH  69
            L+PRLP+ ++GH
Sbjct  527  LSPRLPSRLYGH  538



>ref|XP_007222593.1| hypothetical protein PRUPE_ppa004169mg [Prunus persica]
 gb|EMJ23792.1| hypothetical protein PRUPE_ppa004169mg [Prunus persica]
Length=525

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 186/249 (75%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D ML ++ D A + GFDADT+ KAT LNM+  GSD   VTLTWA+
Sbjct  278  RRRARGDAKGEQDFIDAMLSVL-DGADLGGFDADTVNKATSLNMIAGGSDTTMVTLTWAI  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L + Q ELDT+IGR R V+ESDI  LV+LQA++KETLRLYP  P++  R  
Sbjct  337  SLLLNNPHVLKRAQNELDTEIGRQRVVSESDIGKLVYLQAIVKETLRLYPAAPLSAPREF  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+  GYHV  GTRL+ N+WKI  D  IWP P EF+PERFLTTH+D+DV+G HFELI
Sbjct  397  TEDCTIG-GYHVSKGTRLITNLWKIQTDPRIWPAPLEFKPERFLTTHRDVDVKGLHFELI  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPG+   LQ +   LA+ +H F+ + PS+  IDM+ES GLINVKATPL+V +
Sbjct  456  PFGSGRRSCPGLAFGLQMVQFTLASFVHAFEISNPSSAPIDMTESFGLINVKATPLQVLI  515

Query  101  TPRLPATVF  75
             PRLP+ ++
Sbjct  516  KPRLPSQLY  524



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R +   KG  DFMDVML++ ++DA+ + G D+DT IKAT L +++A SD  AVTL WA
Sbjct  288  RKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAASDTTAVTLIWA  347

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN ++L K Q ELDT +G+ R V ESD++NLV+L+AV+KETLRLYP GP+     
Sbjct  348  LSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLVPHE  407

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT+  GYHVP GTRL++N+ KIHRDE +W  PNEF PERFLTTH+  DVRG++FE 
Sbjct  408  AIEDCTI-DGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEF  466

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
             PFGSGRR CPG+  +L  + + LATLLH  DFA PS E +DM ES+GL N++ATPL+V 
Sbjct  467  FPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSGLTNLRATPLEVL  526

Query  104  LTPRLPATVFGH  69
            L+PRLP+ ++GH
Sbjct  527  LSPRLPSRLYGH  538



>gb|KJB43593.1| hypothetical protein B456_007G208700 [Gossypium raimondii]
Length=525

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 192/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR M       +DFMDVML I+ED A I+ +DADTI KATCLN+++AGSD   VTLTWAL
Sbjct  276  KRLMGGGVIKEQDFMDVMLNILED-ANITCYDADTINKATCLNLVLAGSDTTMVTLTWAL  334

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L + Q+ELD  +G+ R + ESD++N+V+LQA++KETLRLYPP PV  LR++
Sbjct  335  SLLLNNPHVLKRAQDELDMHVGKHRLLEESDVRNMVYLQAIVKETLRLYPPEPVISLRAA  394

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC LS GY +P+GT+LM+N WKI RDE +WPEP++FQPERFLTT+KD+D +GQ FELI
Sbjct  395  SEDCNLSTGYRIPSGTQLMVNAWKIQRDERVWPEPHDFQPERFLTTNKDMDFQGQTFELI  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSN-EKIDMSESAGLINVKATPLKVC  105
            PFGSGRRSCPG+ L+L+ LH  L + LH F     S  E +DM+ES GL N KATPL+V 
Sbjct  455  PFGSGRRSCPGVSLALKMLHFILGSFLHSFKVVTLSELEDVDMTESPGLTNPKATPLEVL  514

Query  104  LTPRLPATVF  75
            +TPRL + ++
Sbjct  515  ITPRLDSKLY  524



>ref|XP_002522370.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40054.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 201/249 (81%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R++S + K  +DFMDVML I+ED A+ISGFDADTI KATCLN+++AGSD   VTLTW L
Sbjct  273  RRKLSGKEKEEKDFMDVMLNILED-AKISGFDADTINKATCLNLILAGSDTTMVTLTWTL  331

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN ++L K Q+ELD  IGR R+V E+DIK+L++LQA++KETLRLYPP P+  LR++
Sbjct  332  SLLLNNYNVLKKAQDELDIHIGRDRHVEETDIKHLIYLQAIVKETLRLYPPSPML-LRAA  390

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTLS G +VPAGTRLM+N+WKI RD  IW  P+EFQPERFL++HK+ID+RGQ+FE I
Sbjct  391  KEDCTLSSGCYVPAGTRLMVNVWKIQRDGRIWSNPDEFQPERFLSSHKEIDLRGQNFEFI  450

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPG+ L LQ +H  LA+ LH F+ A  S E +DM+ES GL N+KAT L+V L
Sbjct  451  PFGSGRRSCPGMALGLQVVHFILASFLHGFEVAKASGENVDMTESTGLTNLKATSLEVHL  510

Query  101  TPRLPATVF  75
             PRL +T++
Sbjct  511  VPRLNSTLY  519



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R +   KG  DFMDVML++ ++DA+ + G D+DT IKAT L +++A SD  AVTL WA
Sbjct  288  RKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAASDTTAVTLIWA  347

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN ++L K Q ELDT +G+ R V ESD++NLV+L+AV+KETLRLYP  P++    
Sbjct  348  LSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAAPLSLPHE  407

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT+  GYHVP GTRL++N+ KIHRDE +W  PNEF PERFLTTH+  DVRG++FE 
Sbjct  408  AIEDCTI-DGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEF  466

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
             PFGSGRR CPG+  +L  + + LATLLH FDFA PS E +DM ES+GL N++ATPL+V 
Sbjct  467  SPFGSGRRMCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVL  526

Query  104  LTPRLPATVFGH  69
            L+PRL + ++GH
Sbjct  527  LSPRLSSRLYGH  538



>gb|KDP34891.1| hypothetical protein JCGZ_09179 [Jatropha curcas]
Length=429

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 186/249 (75%), Gaps = 3/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR +SEE KG  DFMD+ML  + DD  + GFDADT+ KATCL+ L+AG++ + V LTWA+
Sbjct  183  KRDLSEEDKGEEDFMDIMLSDV-DDKSLEGFDADTVNKATCLS-LIAGNETVTVALTWAM  240

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN+  L K  EELD  +GR R VN +DI NLV+LQA+ KETLRLYPP  + G R  
Sbjct  241  SLLLNNKQALQKALEELDIHVGRKRLVNATDIGNLVYLQAIFKETLRLYPPALIPGPRQF  300

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+  GYHVP GT LM+N+WKI RD ++WP+P EF+PERFLTTHK++DVRG++FEL+
Sbjct  301  TEDCTIG-GYHVPKGTWLMLNLWKIQRDPNVWPDPLEFRPERFLTTHKNVDVRGKNFELL  359

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG GRR CP +   LQ  H+ LA+LL  F+ ++P NE +DMS   GL N+K +PL++ L
Sbjct  360  PFGGGRRGCPAVSFGLQMAHLTLASLLQAFEISVPGNEPVDMSPGVGLTNMKISPLEIVL  419

Query  101  TPRLPATVF  75
            +PRLP + F
Sbjct  420  SPRLPPSCF  428



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 187/250 (75%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D ML ++ D A++ GFDADTI KAT LNM+ AGSD I VTLTWA+
Sbjct  277  QRRAKGDAKGEQDFIDAMLSVL-DGAELGGFDADTINKATSLNMIAAGSDTIMVTLTWAI  335

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L++   ELDT+IGR R V+E DI NLV++QA+IKETLRLYPP P++G R  
Sbjct  336  SLLLNNSHVLERALNELDTKIGRQRVVSEQDISNLVYIQAIIKETLRLYPPAPLSGPREF  395

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTRL +N+WK+  D   WP+P EF+PERFLTTHK +DV+GQHFELI
Sbjct  396  TEDCTIA-GYHIRKGTRLTMNLWKLQTDPKNWPKPFEFKPERFLTTHKKVDVKGQHFELI  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPG+   LQ +   LA+ LH F+   PS+  IDM+ES GL N K TPLKV +
Sbjct  455  PFGSGRRACPGLAFGLQMVQFTLASFLHAFEILNPSSTPIDMTESFGLTNNKRTPLKVLI  514

Query  101  TPRLPATVFG  72
             PRL   ++G
Sbjct  515  KPRLSFELYG  524



>gb|KJB58366.1| hypothetical protein B456_009G207100 [Gossypium raimondii]
Length=525

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 194/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   + +G +DF+DVML  ++++ ++S F  DADT IK+TCL +++ GSD  A TL
Sbjct  273  QRRISGGIKAEGDQDFIDVML-FLQEEGRLSNFQYDADTSIKSTCLALILGGSDTTAGTL  331

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNNR +L K Q+ELD  +G+ R V+ESDIKNLV+LQA+IKETLRLYP GP+ G
Sbjct  332  TWAISLLLNNREMLRKAQDELDLHVGKERPVDESDIKNLVYLQAIIKETLRLYPAGPLLG  391

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++ DCT++ GYHVPAGTRL++N+WKI RD  +WP P+ F PERFL +H DIDVRGQ 
Sbjct  392  PREAMNDCTVA-GYHVPAGTRLVVNVWKIQRDPRVWPNPSAFSPERFLKSHADIDVRGQQ  450

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG   +LQ LH+ LA  LH F+ + P ++ +DM+ES GL   KATPL
Sbjct  451  FELIPFGSGRRSCPGASFALQVLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKATPL  510

Query  113  KVCLTPRLPATVFG  72
             V L PRLPA V+ 
Sbjct  511  DVLLKPRLPAKVYA  524



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 196/252 (78%), Gaps = 3/252 (1%)
 Frame = -1

Query  821  KRRMS-EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            K R+S +E  G +DFMDVML I++D +++SG+DADTI KATC+N+++ G+D I V LTWA
Sbjct  280  KMRLSNDEANGEQDFMDVMLSILKD-SKLSGYDADTINKATCMNLILGGNDTIKVCLTWA  338

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN+ +L +VQ+ELD  +G+ RNV ESD+K L +LQAV+KE LRLYPP P++G   
Sbjct  339  LSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALRLYPPAPLSGPHE  398

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++E+CT++ GYHVP GTR+++N+ KI RD  +W +P EF+PERFLT+H  +DV GQHFEL
Sbjct  399  AMEECTVA-GYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPERFLTSHVGVDVLGQHFEL  457

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR+CPG  L L+ +H+ LA LLH F    PS   +DM+ES GL N+KATPL+V 
Sbjct  458  IPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGLTNLKATPLEVL  517

Query  104  LTPRLPATVFGH  69
            L PRLP+ ++ +
Sbjct  518  LLPRLPSHLYQY  529



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 186/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG  DF+D ML ++ D A + GFDADT+ KAT LNM+  GSD   VTL WA+
Sbjct  278  RRRARGDAKGEPDFIDAMLSVL-DGADLGGFDADTVNKATSLNMIAGGSDTTMVTLIWAI  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L   Q ELDT+IGR R V+ESDI  LV++QA++KETLRLYP  P++G R  
Sbjct  337  SLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPAAPLSGPREF  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             +DCT+  GYHV  GTRL+ N+WKI  D  IWP+P EF+PERFLT+H+D+DV+G HFELI
Sbjct  397  TKDCTIG-GYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHRDVDVKGLHFELI  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPG+  +LQ +   LA+ +H FD + PSN  IDM+ES GL N+KATPL+V +
Sbjct  456  PFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPSNSPIDMTESFGLTNIKATPLQVLI  515

Query  101  TPRLPATVFG  72
             PRLP+ ++G
Sbjct  516  KPRLPSQLYG  525



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R +   KG  DFMD+ML++ ++DA+ + G D+DTI KAT L +++A SD  AVTL WA
Sbjct  288  RKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATSLTLILAASDTTAVTLIWA  347

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN + L K Q ELDT + + R V ESD++NLV+L+AV+KETLRLYPPGP+     
Sbjct  348  LSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLKAVLKETLRLYPPGPLLIPHE  407

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT+  GYHVP GTRL++N+ KIHRDE +W  PNEF PERFLTTH+  DVRG++FE 
Sbjct  408  AIEDCTI-DGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEF  466

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPG+  +L  + + LATLLH FDFA PS E +DM E++GL N++ATPL+V 
Sbjct  467  LPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHENSGLTNLRATPLEVL  526

Query  104  LTPRLPATVFGH  69
            L PRLP+ ++GH
Sbjct  527  LCPRLPSRLYGH  538



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   313 bits (802),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 193/255 (76%), Gaps = 8/255 (3%)
 Frame = -1

Query  821  KRRMSEEGKGA----RDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAV  660
            +RR+    KG      DF+DVML + E+  Q+S F   +DT IK+TCL +++ GSD  A 
Sbjct  265  QRRVLSHEKGKTEADEDFIDVMLSLQEE-GQLSNFQHSSDTSIKSTCLAIILGGSDTTAG  323

Query  659  TLTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPV  480
            TLTWA+SLLLNN  ++ K QEEL+ Q+G  R V+ESDIKNLV+LQA+IKETLRLYP GP+
Sbjct  324  TLTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLRLYPAGPL  383

Query  479  NGLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRG  300
             G R +LEDCT++ GYHVPAGTRL++N+WKI RD S+W  P+ F+PERFLT+H  +DVRG
Sbjct  384  LGPREALEDCTVA-GYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERFLTSHGHVDVRG  442

Query  299  QHFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKAT  120
            Q FEL+PFGSGRRSCPG+  ++Q LH+ LA LLH F+F  P  ++IDM+ES GL   KAT
Sbjct  443  QQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGLTIPKAT  502

Query  119  PLKVCLTPRLPATVF  75
            PL+V LTPRLP  ++
Sbjct  503  PLEVLLTPRLPGNLY  517



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 196/255 (77%), Gaps = 6/255 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   + +  +DF+DVML + E+  Q+S F  DA+T IK+TCL +++ GSD  A TL
Sbjct  274  QRRVSAGIKDEDEQDFIDVMLSLKEE-GQLSNFQYDANTSIKSTCLALILGGSDTTAGTL  332

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNNR +L K QEELD  +G+ R V +SD+KNLV+LQA+IKETLRLYP GP+ G
Sbjct  333  TWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLG  392

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++EDC ++ GYHVPAGTRL++N+WKI RD  +W  P+ F PERFLT+H D+DVRGQ 
Sbjct  393  PREAMEDCKVA-GYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQ  451

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG+  +LQ LH+ LA LLH F  A P ++ +D++ES+GL   KATPL
Sbjct  452  FELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKATPL  511

Query  113  KVCLTPRLPATVFGH  69
            +V LTPRLP  ++G+
Sbjct  512  EVILTPRLPPKLYGY  526



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 193/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGFD--ADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   E +  +DF+DVML + E+   +S F   AD  IK+TCL +++ GSD  + TL
Sbjct  247  QRRVSGGIESESEQDFIDVMLSLQEE-GHLSQFQHSADISIKSTCLALILGGSDTTSGTL  305

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNN ++L K QEELD QIG  R V++SDIKNLV+LQA+IKETLRLYP GP+ G
Sbjct  306  TWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLG  365

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++EDCT++ GYH+PAGTRL++N+WKI RD  +W  P+ FQPERFLT+H D+D RGQ 
Sbjct  366  PREAMEDCTVA-GYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQ  424

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG   +LQ LH+ LA LLH F+ A PS++ +DM+ES GL   KATPL
Sbjct  425  FELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPL  484

Query  113  KVCLTPRLPATVFG  72
            +V L+PRLP   +G
Sbjct  485  EVVLSPRLPPNPYG  498



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 191/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     RDFMDVML I++   +I G+DADT IKATC+ +++AGSD  +VTLTWALS
Sbjct  240  KRRGDNKDSDRDFMDVMLSIVDAAEEIPGYDADTFIKATCMALILAGSDTTSVTLTWALS  299

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD+ NLV++QA+IKET+RLYP  P+     S+
Sbjct  300  LLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESM  359

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL+ N WKIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FELIP
Sbjct  360  EDCTVD-GYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIP  418

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E +DM+++ G+ N+KATPL+V +T
Sbjct  419  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNLKATPLEVLVT  478

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  479  PRLPEHAY  486



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R S   +   DFM +ML ++ D A++  +DADTI KATCL++++A SD   VTLTWAL
Sbjct  281  QKRNSGNAESEHDFMGMMLSLLNDAAELPSYDADTINKATCLSLILAASDTTMVTLTWAL  340

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR+ L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP  P++    S
Sbjct  341  SLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAPLSVPHES  400

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC +S GYH+PAGTRL+IN++KIHRD   W +P EFQPERFLTT+KD DVRGQ+FELI
Sbjct  401  MEDCVVS-GYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDVRGQNFELI  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+ L+LQ L + LA LL  F+   P +E +DM E+ G+ N+K +PL+V +
Sbjct  460  PFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVSPLEVLI  519

Query  101  TPRLPATVF  75
            TPRLPA  +
Sbjct  520  TPRLPAVCY  528



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R   E +G RDFMDVML I+    ++  +DADTI KATCL ++  G+D  AVTLTWAL
Sbjct  278  RKRACGEAEGDRDFMDVMLSILGTADELPSYDADTINKATCLALISGGTDTTAVTLTWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD+QIGR R V ESD+KNLV+LQA+IKETLRLYP  P++    S
Sbjct  338  SLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETLRLYPAAPLSVPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+  GY VPAGTRL++NI K+H++  +WP P EF+PERFLTTHKD+DVRGQ+FE +
Sbjct  398  VEDCTIG-GYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHKDLDVRGQNFEYL  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +  +LQ LHI LAT+LH F+    S+  +DM+   G+ + + TPL+V L
Sbjct  457  PFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGMGVTSPRVTPLEVIL  516

Query  101  TPRLPATVF  75
            TPRLP  ++
Sbjct  517  TPRLPLHLY  525



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R   E +G RDFMDVML I+    ++  +DADTI KATCL ++  G+D  AVTLTWAL
Sbjct  278  RKRACGEAEGDRDFMDVMLSILGTADELPSYDADTINKATCLALISGGTDTTAVTLTWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD+QIGR R V ESD+KNLV+LQA+IKETLRLYP  P++    S
Sbjct  338  SLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETLRLYPAAPLSVPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+  GY VPAGTRL++NI K+H++  +WP P EF+PERFLTTHKD+DVRGQ+FE +
Sbjct  398  VEDCTIG-GYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPERFLTTHKDLDVRGQNFEYL  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +  +LQ LHI LAT+LH F+    S+  +DM+   G+ + + TPL+V L
Sbjct  457  PFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGMGVTSPRVTPLEVIL  516

Query  101  TPRLPATVF  75
            TPRLP  ++
Sbjct  517  TPRLPLHLY  525



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 193/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGFD--ADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   E +  +DF+DVML + E+   +S F   AD  IK+TCL +++ GSD  + TL
Sbjct  269  QRRVSGGIESESEQDFIDVMLSLQEE-GHLSQFQHSADISIKSTCLALILGGSDTTSGTL  327

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNN ++L K QEELD QIG  R V++SDIKNLV+LQA+IKETLRLYP GP+ G
Sbjct  328  TWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLG  387

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++EDCT++ GYH+PAGTRL++N+WKI RD  +W  P+ FQPERFLT+H D+D RGQ 
Sbjct  388  PREAMEDCTVA-GYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQ  446

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG   +LQ LH+ LA LLH F+ A PS++ +DM+ES GL   KATPL
Sbjct  447  FELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPL  506

Query  113  KVCLTPRLPATVFG  72
            +V L+PRLP   +G
Sbjct  507  EVVLSPRLPPNPYG  520



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 193/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGFD--ADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   E +  +DF+DVML + E+   +S F   AD  IK+TCL +++ GSD  + TL
Sbjct  276  QRRVSGGIESESEQDFIDVMLSLQEE-GHLSQFQHSADISIKSTCLALILGGSDTTSGTL  334

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNN ++L K QEELD QIG  R V++SDIKNLV+LQA+IKETLRLYP GP+ G
Sbjct  335  TWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLG  394

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++EDCT++ GYH+PAGTRL++N+WKI RD  +W  P+ FQPERFLT+H D+D RGQ 
Sbjct  395  PREAMEDCTVA-GYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQ  453

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG   +LQ LH+ LA LLH F+ A PS++ +DM+ES GL   KATPL
Sbjct  454  FELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPL  513

Query  113  KVCLTPRLPATVFG  72
            +V L+PRLP   +G
Sbjct  514  EVVLSPRLPPNPYG  527



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 191/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     RDFMDVML I++   +I G+DADT IKATC+ +++AGSD  +VTLTWALS
Sbjct  285  KRRGDNKDSDRDFMDVMLSIVDAAEEIPGYDADTFIKATCMALILAGSDTTSVTLTWALS  344

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD+ NLV++QA+IKET+RLYP  P+     S+
Sbjct  345  LLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESM  404

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL+ N WKIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FELIP
Sbjct  405  EDCTVD-GYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIP  463

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E +DM+++ G+ N+KATPL+V +T
Sbjct  464  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNLKATPLEVLVT  523

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  524  PRLPEHAY  531



>ref|XP_007222623.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
 gb|EMJ23822.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
Length=525

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 186/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR S   KG +DF+D ML ++ D A + GFDADT+ KAT L M+   SD   VTLTWA+
Sbjct  278  QRRASGYAKGEQDFIDAMLSVL-DGADLGGFDADTVNKATILTMISGASDTTMVTLTWAI  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L + Q ELDT+IGR R V+ESDI  LV++QA++KETLRLYP  P++G R  
Sbjct  337  SLLLNNPHVLKRAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPAAPLSGPREF  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+  GYHV  GTRL+ N+WKI  D  IWP+P EF+PERFLT+H+D+DV+G HFELI
Sbjct  397  TEDCTIG-GYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHRDVDVKGLHFELI  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPG+   LQ +   LA+ +H F+ + PS+  IDM+ES GL NVKATPL+V +
Sbjct  456  PFGSGRRACPGLAFGLQMVQFTLASFVHAFEISNPSSAPIDMTESFGLTNVKATPLQVLI  515

Query  101  TPRLPATVFG  72
             PRLP+ ++G
Sbjct  516  NPRLPSQLYG  525



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 183/250 (73%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +  M+ E K  +DFMDVML ++   +   GFDADTIIKAT LNM+  GSD  A+TLTWA+
Sbjct  285  RAEMNNEEKKEQDFMDVMLSVLHG-SDFGGFDADTIIKATILNMIAGGSDTTALTLTWAV  343

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L K QEEL+  +G+ R VNESDI  L ++ A++KETLRLYP  P++  R  
Sbjct  344  SLLLNNHHVLKKAQEELENNVGKNRTVNESDIGKLTYIFAIVKETLRLYPVAPLSAPRVF  403

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            LEDCT+  GYHV  GTRL+ NIWKI  D  +WP+P EF+PERFLTT+KD+DVRGQHFELI
Sbjct  404  LEDCTIG-GYHVAKGTRLITNIWKIQTDPILWPDPFEFKPERFLTTNKDVDVRGQHFELI  462

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPG   +LQ +   LA+ L  FD + P N  +DM+ES GL N KATPL+V +
Sbjct  463  PFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNALVDMTESFGLTNTKATPLEVLI  522

Query  101  TPRLPATVFG  72
            TPRLPA ++ 
Sbjct  523  TPRLPAELYA  532



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 187/250 (75%), Gaps = 6/250 (2%)
 Frame = -1

Query  818  RRMSEEG--KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +RM   G  +  +DFMDVM  I+ D   +   DADTI KATCL M++A SD   VTLTWA
Sbjct  277  KRMKASGNQESDQDFMDVMFSILSD---VGKHDADTINKATCLAMILAASDTTMVTLTWA  333

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L K QEELD  +GR + V ESDIK LV+L+A++KETLRLYP GP++    
Sbjct  334  LSLLLNNRGALKKAQEELDIHVGRDKLVEESDIKKLVYLRAILKETLRLYPAGPLSLPHE  393

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +S GYH+PAGTRL+IN++KIHRD  +W +P EFQPERFLTT+KD DVRGQ+FEL
Sbjct  394  SMEDCIVS-GYHIPAGTRLLINVYKIHRDPRVWSDPCEFQPERFLTTYKDFDVRGQNFEL  452

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPG+  +LQ L + LA LL  F+   P +E +DMSE+ GL N+KA+PL+V 
Sbjct  453  IPFGSGRRMCPGVSFALQVLELTLANLLQGFELGTPLDEPVDMSEAMGLTNLKASPLEVL  512

Query  104  LTPRLPATVF  75
            +TPRLPA  +
Sbjct  513  ITPRLPAVCY  522



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 191/242 (79%), Gaps = 2/242 (1%)
 Frame = -1

Query  797  KGARDFMDVMLEIM-EDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNR  621
            K   DFMDVM+ ++ E D +I  FDADTI KATCL +++ G+D   VTLTWAL+L+LN+ 
Sbjct  317  KDENDFMDVMISVLTEADEEIPSFDADTITKATCLALILGGTDTTMVTLTWALTLVLNHG  376

Query  620  SILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLS  441
             +L KVQ+ELDT IGR R VNESD K LV+LQAV+KETLRLYP  P++    S+EDCT++
Sbjct  377  DVLKKVQDELDTHIGRERQVNESDTKKLVYLQAVVKETLRLYPATPLSVPHESIEDCTIA  436

Query  440  QGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRR  261
             GYHVPAGTRL +NI KI RD ++W +PNEF+PERFLTTHKDIDVRGQ+FELIPFGSGRR
Sbjct  437  -GYHVPAGTRLFVNIPKIQRDPNVWEKPNEFRPERFLTTHKDIDVRGQNFELIPFGSGRR  495

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPAT  81
             CPGI  +LQ L + LA+LLH F+FA P +E +DMSE  GL N+KATPL+V LTPRL A 
Sbjct  496  GCPGISFALQVLLLTLASLLHGFEFATPGDEPLDMSEGVGLTNLKATPLQVLLTPRLHAP  555

Query  80   VF  75
            +F
Sbjct  556  LF  557



>ref|XP_006428103.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
 gb|ESR41343.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
Length=335

 Score =   305 bits (780),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 185/250 (74%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D A+    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  86   KRGSSEVKGDEDFMYVMLSLFDDKAKQLPDGDDTDTVIKAICLSLILAASDTTAVTLTWA  145

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L K Q ELD Q+G  R VNESD+KNL +LQ ++KETLRLYP GP+     
Sbjct  146  IALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHE  205

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDCT+ +GYHVPAGT+L++N WK+ RD  +W EP +F PERFL  +KD+D++GQ+FE 
Sbjct  206  SIEDCTI-RGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKGQNFEF  264

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  265  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVL  324

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  325  LTPRLSASLY  334



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 190/252 (75%), Gaps = 2/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R +   KG  DFMD+ML++ ++DA+ + G D+DTI KAT L +++A SD  AVTL WA
Sbjct  288  RKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATSLALILAASDTTAVTLIWA  347

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLL+NN ++L K Q ELDT +G+ R V ESD++NLVFL+AVI+ETLRLYP  P+     
Sbjct  348  LSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVFLKAVIRETLRLYPAAPLLLPHE  407

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            + EDCT+  GYHVP GTRL++++ KIHRDE +W  PNEF PERFLTTH+  D RG++FE 
Sbjct  408  ATEDCTI-DGYHVPRGTRLLVDVSKIHRDERVWSNPNEFDPERFLTTHRGFDARGKNFEF  466

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
             PFGSGRR CPG+  +L  + + LATLLH FDFA PS E +DM ES+GL N++ATPL+V 
Sbjct  467  FPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVL  526

Query  104  LTPRLPATVFGH  69
            L PRLP+ ++GH
Sbjct  527  LCPRLPSGLYGH  538



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 186/255 (73%), Gaps = 7/255 (3%)
 Frame = -1

Query  818  RRMSEEGK-----GARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVT  657
            +R  E G+     G  DFMDVML I+ DDAQ + G DADTI KATCL +++A SD   +T
Sbjct  284  KRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKIT  343

Query  656  LTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVN  477
            LTW LSLLLN+R +L K Q ELD  IG+ R VNE DIKNLV+LQA+IKE +RLYP GP+ 
Sbjct  344  LTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLA  403

Query  476  GLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQ  297
               +S EDCT++  Y VPAGT L +N+WKIHRD  +WPEP +F+PERFLTTHK IDVRGQ
Sbjct  404  APHASTEDCTVND-YFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQ  462

Query  296  HFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATP  117
            +FEL+PF SGRR CPG   ++   H+ LATLLH FDF  P +E +DMSE   L  VK TP
Sbjct  463  NFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTP  522

Query  116  LKVCLTPRLPATVFG  72
            +KV +TPRL A+++G
Sbjct  523  VKVLITPRLSASLYG  537



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 186/255 (73%), Gaps = 7/255 (3%)
 Frame = -1

Query  818  RRMSEEGK-----GARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVT  657
            +R  E G+     G  DFMDVML I+ DDAQ + G DADTI KATCL +++A SD   +T
Sbjct  284  KRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKIT  343

Query  656  LTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVN  477
            LTW LSLLLN+R +L K Q ELD  IG+ R VNE DIKNLV+LQA+IKE +RLYP GP+ 
Sbjct  344  LTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLA  403

Query  476  GLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQ  297
               +S EDCT++  Y VPAGT L +N+WKIHRD  +WPEP +F+PERFLTTHK IDVRGQ
Sbjct  404  APHASTEDCTVND-YFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQ  462

Query  296  HFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATP  117
            +FEL+PF SGRR CPG   ++   H+ LATLLH FDF  P +E +DMSE   L  VK TP
Sbjct  463  NFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTP  522

Query  116  LKVCLTPRLPATVFG  72
            +KV +TPRL A+++G
Sbjct  523  VKVLITPRLSASLYG  537



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 192/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     +DFMDVML I++   ++ G+DADT IKATC+ +++AGSD  +V+LTWALS
Sbjct  255  KRRGDNKDSDQDFMDVMLSIVDAAEELPGYDADTFIKATCMALVLAGSDTTSVSLTWALS  314

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD+ NLV++QA+IKET+RLYP  P+     S+
Sbjct  315  LLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESM  374

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL++N WKIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FELIP
Sbjct  375  EDCTVD-GYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIP  433

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E +DM+E+ G+ N+KATPL+V +T
Sbjct  434  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPLEVLVT  493

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  494  PRLPEHAY  501



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 192/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     +DFMDVML I++   ++ G+DADT IKATC+ +++AGSD  +V+LTWALS
Sbjct  285  KRRGDNKDSDQDFMDVMLSIVDAAEELPGYDADTFIKATCMALVLAGSDTTSVSLTWALS  344

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD+ NLV++QA+IKET+RLYP  P+     S+
Sbjct  345  LLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESM  404

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL++N WKIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FELIP
Sbjct  405  EDCTVD-GYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIP  463

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E +DM+E+ G+ N+KATPL+V +T
Sbjct  464  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPLEVLVT  523

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  524  PRLPEHAY  531



>ref|XP_010696627.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=512

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 192/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-ISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +RR S+E +  R FMD ML+IME+  + +S F+ADTIIKATC+ M++ G+D+ A TLTWA
Sbjct  263  RRRRSKETQEKRYFMDAMLDIMENTQENVSKFEADTIIKATCMAMILGGADSTAATLTWA  322

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ IL K Q ELD Q+G+ R V ESD+KNLV+LQAV+KET+RLYP  P++  R 
Sbjct  323  LSLLLNNKDILKKTQAELDIQVGKNRQVEESDLKNLVYLQAVLKETMRLYPAAPLSVPRE  382

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ +CT++ GYH+ AGTRL +N++K+HRD  +W +P EF+PERFLTT+K+ DVRGQ FE 
Sbjct  383  AIINCTVN-GYHISAGTRLFVNLYKVHRDPKVWEDPLEFRPERFLTTYKEYDVRGQQFEY  441

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L+ +   LA LLH F+  + S+E +DM+E  GL N+KATPL+V 
Sbjct  442  MPFGSGRRICPGISSALRFMQFTLAKLLHAFEITILSDEAVDMTEGFGLTNLKATPLEVI  501

Query  104  LTPRLPATVF  75
            LT RLP  ++
Sbjct  502  LTHRLPHNIY  511



>emb|CDP07593.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 185/256 (72%), Gaps = 7/256 (3%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ-----ISGFDADTIIKATCLNMLVAGSDAIAVT  657
            +R+ S +G G +DFMDVML + +           G+DADTI+KATCLN++  GSD  AV 
Sbjct  206  RRKESGKGDGQQDFMDVMLSVTQGGQGEIMNLAGGYDADTIVKATCLNLMSGGSDTTAVM  265

Query  656  LTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVN  477
            LTWALSLLLNN  +L K +EELD  +G+ R V ESDI NLV+LQA++KET RLYP  P+ 
Sbjct  266  LTWALSLLLNNPQVLRKAREELDLHVGKDRRVTESDINNLVYLQAIVKETFRLYPSSPLG  325

Query  476  GLRSSLEDCTLSQG-YHVPAGTRLMINIWKIHRDESIWP-EPNEFQPERFLTTHKDIDVR  303
              R   EDCT   G YHVP GTRL+ N+WK+ RD +IWP +P+E++PERFL+THKD+++ 
Sbjct  326  VTRDFNEDCTFGGGNYHVPKGTRLIFNLWKLQRDPNIWPDDPSEYRPERFLSTHKDVEIN  385

Query  302  GQHFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKA  123
            G+ FEL+PFG+GRR CPG+   +Q +H+ LA LLH FD + PS+E +DM+ESAGL N KA
Sbjct  386  GKQFELVPFGAGRRICPGLHFGIQMIHLVLADLLHAFDISKPSDEPVDMTESAGLTNAKA  445

Query  122  TPLKVCLTPRLPATVF  75
            TPL V + PRL   ++
Sbjct  446  TPLDVLIAPRLSPNLY  461



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = -1

Query  797  KGARDFMDVMLEIMEDDAQISGFD----ADTIIKATCLNMLVAGSDAIAVTLTWALSLLL  630
            K  RDFMD ML ++  D    GF     ADT IKATCL  ++ G+D     LTW LSLLL
Sbjct  289  KDERDFMDTMLSVL-GDVSAEGFPSTTIADTTIKATCLAAILGGTDPTTAVLTWVLSLLL  347

Query  629  NNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDC  450
            NNR  L K QEELD Q+GR R V ESD+KNLV+LQA++KETLRLYPP P++     +EDC
Sbjct  348  NNREALKKAQEELDNQVGRERQVKESDVKNLVYLQAIVKETLRLYPPSPLSIPHECIEDC  407

Query  449  TLSQG--YHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
             +  G  YHV  GTRL++NIWKIHR+ ++W +P  FQPERFLTTHKD DVRGQ+FE IPF
Sbjct  408  NVGNGTNYHVKTGTRLLVNIWKIHRNPNVWLDPFRFQPERFLTTHKDFDVRGQNFEFIPF  467

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
            GSGRR CPG+ L LQ + + LA LLH F+ A PS+E +DM+ES G+ N+KATPL+V LTP
Sbjct  468  GSGRRMCPGVSLGLQVVQLTLAQLLHGFEIATPSDEPVDMTESTGVTNMKATPLEVLLTP  527

Query  95   RLPATVF  75
            RLPA ++
Sbjct  528  RLPAKLY  534



>emb|CDP07595.1| unnamed protein product [Coffea canephora]
Length=880

 Score =   318 bits (815),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 185/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K+   E     +DFMDVML + E     +G+DADTI KATC+ ++  GSD   V LTW L
Sbjct  631  KKHSGEATSDHQDFMDVMLSLTEGADFSAGYDADTITKATCVGLISGGSDTTVVMLTWTL  690

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SL++NN  +L K QEELD  +G+ R V ESDI NLV+LQA+IKETLRLYPPGP+ G R  
Sbjct  691  SLIMNNPRVLKKAQEELDLHVGKERRVTESDISNLVYLQAIIKETLRLYPPGPLGGTREL  750

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPE-PNEFQPERFLTTHKDIDVRGQHFEL  285
             EDC +  GYH+P GTR+++N+WKI RD ++W + P EF+PERFLTTHK IDV+G HFEL
Sbjct  751  SEDCIIG-GYHIPKGTRVILNMWKIQRDPNVWHDGPLEFRPERFLTTHKHIDVKGYHFEL  809

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRR CPGI L LQ LH+ LA LLH FD + PSNE +DM+ESAGL N+KATPL++ 
Sbjct  810  IPFGAGRRICPGINLGLQMLHLVLANLLHAFDLSTPSNEPVDMTESAGLTNIKATPLQLL  869

Query  104  LTPRLPATVF  75
            + PRLP  ++
Sbjct  870  VAPRLPPHLY  879



>ref|XP_008378426.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=523

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 180/239 (75%), Gaps = 2/239 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVML ++ + A + GFDADT+ KATCL ++  GSD   VT+TWALSLLLNNR  L 
Sbjct  287  QDFMDVMLSVL-NGADVVGFDADTVNKATCLAVIAGGSDTPMVTMTWALSLLLNNRHTLV  345

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K QEELD  +GRGR VNESDI NL +LQA+ KETLR+YPP P++G+R   EDCT+  GYH
Sbjct  346  KAQEELDKHVGRGRLVNESDISNLEYLQAIFKETLRMYPPAPLSGIRKFSEDCTIG-GYH  404

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            VP  T LM+N+WKIH D  +W +P EF+PERFLTTHKDIDV+G +FELIPFG GRR CPG
Sbjct  405  VPKDTWLMMNLWKIHSDPRVWVDPMEFKPERFLTTHKDIDVKGHNFELIPFGGGRRICPG  464

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVFG  72
            +  +LQ + + LA+ LH +D + P N  +DM+ S GL NVK+TPL+V + PRL   ++G
Sbjct  465  MGFALQVIQLTLASFLHAYDISTPENAAVDMTGSLGLSNVKSTPLRVLVKPRLSENIYG  523



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+   E  G  DFMDV+L +++  A +  +DADTI KAT + ++  G+D + VTLTWAL
Sbjct  281  RRKDWGEDNGMHDFMDVLLSVLDGKA-LPEYDADTINKATSMALISGGTDTMTVTLTWAL  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SL+LNNR  L K +EELDT +G+ R VN SDI  LV+LQA++KETLRL PPGP++G R  
Sbjct  340  SLILNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGPLSGPRQF  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC +  GYHVP GTRL++N+ K+HRD S+W +P EFQPERFLTTH+D+D RGQHF+L+
Sbjct  400  TEDCIIG-GYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPERFLTTHRDVDARGQHFQLL  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRRSCPGI  +LQ LH+ LA+ LH F+ + PSN  +DMSE  GL N+K+TPL++ +
Sbjct  459  PFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKSTPLEILI  518

Query  101  TPRLPATVF  75
             PRLP   +
Sbjct  519  APRLPYNSY  527



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 185/251 (74%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S E KG   DFM VML I+ D  + SG D DTI KA CL +++AG D   VTLTW 
Sbjct  224  RKRDSREMKGEELDFMSVMLSILGDTEKYSGRDVDTINKAVCLGLIIAGLDTTTVTLTWV  283

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R ILDKVQ ELD Q+G  R VNESD+KNLV+LQA +KE +RLYP  P+     
Sbjct  284  ISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHE  343

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++E+CT++ GYHVPAGT+L+IN+WK+ RD  +W EP +FQPERFLT HKDIDVRGQH EL
Sbjct  344  AIEECTVN-GYHVPAGTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLEL  402

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPG+  +LQ +   +A+LL  FDFA PSNE +DM E  GL   K+ PL+V 
Sbjct  403  LPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVL  462

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  463  IAPRLSASLYG  473



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   320 bits (821),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 187/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+ S +    +DFMDVM  ++ D   + G+DADTI KATCL ++  GSD   V+LTWAL
Sbjct  278  RRKDSGDDNSTQDFMDVMQSVL-DGKNLGGYDADTINKATCLTLISGGSDTTVVSLTWAL  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SL+LNNR  L K QEELD Q+G+ R VNE DI  LV+LQA++KETLRLYPPGP+ GLR  
Sbjct  337  SLVLNNRDTLKKAQEELDIQVGKERLVNEQDISKLVYLQAIVKETLRLYPPGPLGGLRQF  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTL  GYHV  GTRL++N+ KI +D  IW +P EFQPERFLTTHKD+D RG+HFE I
Sbjct  397  TEDCTLG-GYHVSKGTRLIMNLSKIQKDPRIWSDPTEFQPERFLTTHKDVDPRGKHFEFI  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR+CPGI   LQ LH+ LA+ LH F+F+ PSNE+++M ES GL N+K+TPL+V +
Sbjct  456  PFGAGRRACPGITFGLQVLHLTLASFLHAFEFSTPSNEQVNMRESLGLTNMKSTPLEVLI  515

Query  101  TPRLPA  84
            +PRL +
Sbjct  516  SPRLSS  521


 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = -1

Query  821   KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
             +R+ S E  G +DFMDVML I+      +G+DADTI KAT L ++  G+D  +VTLTWA+
Sbjct  805   RRKDSGEADGDQDFMDVMLSIL-GATDPNGYDADTINKATSLILIAGGTDTTSVTLTWAI  863

Query  641   SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
             SLLLNN  +L K QEELDT +G+ R VNE DI  LV+LQA++KETLRLYP  P++G R  
Sbjct  864   SLLLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQF  923

Query  461   LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             ++D  L  GYH+P GTRL++N+ KI RD  +W  P +FQP RFLTT+KD+DV+G+HF L 
Sbjct  924   IQDSVLG-GYHIPKGTRLLLNLTKIQRDPRVWLNPTKFQPSRFLTTYKDVDVKGKHFVLT  982

Query  281   PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
             PFG GRR CPG   +LQ L + LA  LH F  + PSN  IDMSES G+ N+K+TPL+V +
Sbjct  983   PFGGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLI  1042

Query  101   TPRLPA  84
             +PRL +
Sbjct  1043  SPRLAS  1048



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/254 (58%), Positives = 195/254 (77%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   + +G +DF+DVML + E+  ++SGF  D++T IK+TCL +++ GSD  A TL
Sbjct  275  QRRVSSLIKAEGEQDFIDVMLSLQEE-GRLSGFQYDSETSIKSTCLALILGGSDTTAGTL  333

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNNR  L K QEELD  +G  R V ESD+KNLV+LQA+IKETLRLYP GP+ G
Sbjct  334  TWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLLG  393

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R +L+DCT++ GY+VPAGTRL++NIWK+ RD S+W  P  FQPERFL  H D+DV+GQ 
Sbjct  394  PREALDDCTVA-GYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHADVDVKGQQ  452

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FEL+PFGSGRRSCPG+  +LQ LH+ LA LLH F+ + P ++ +DM+ES+GL   KATPL
Sbjct  453  FELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPL  512

Query  113  KVCLTPRLPATVFG  72
            +V LTPRL + ++ 
Sbjct  513  EVLLTPRLNSKLYA  526



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 191/255 (75%), Gaps = 6/255 (2%)
 Frame = -1

Query  821  KRRMSEEGKGA--RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            K+R SE    A  RDFMDV+L I+ DD Q  G+  DT++KATCL +++ GSD  +VTLTW
Sbjct  277  KKRASEGIATADERDFMDVLLSIL-DDHQCIGYGTDTVVKATCLGLILGGSDTTSVTLTW  335

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLLLNNR  L K Q+ELDT++GR   V ESDI+NLV+LQA++KETLRLYP   V+  R
Sbjct  336  ALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRLYPAAAVSAPR  395

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTH-KDIDVRGQHF  291
             ++EDCT++ G+H+PAGT+L++NIWK+ RD SIWP P EF PERFLT+H  DIDVRGQHF
Sbjct  396  EAMEDCTVA-GFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAADIDVRGQHF  454

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALP-SNEKIDMSESAGLINVKATPL  114
            EL+PFGSGRR+CPGI  ++Q LH+ LA L+  FD   P  +  +DM++  GL N K TPL
Sbjct  455  ELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIGLTNHKKTPL  514

Query  113  KVCLTPRLPATVFGH  69
             V LTPRL   ++G+
Sbjct  515  DVLLTPRLHPLLYGY  529



>ref|XP_009364154.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=523

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 179/239 (75%), Gaps = 2/239 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVML I+ + A + GFDADT+ KATCL ++  GSD   VT+TWALSLLLNNR  L 
Sbjct  287  QDFMDVMLSIL-NGADVVGFDADTVNKATCLAVIAGGSDTPMVTMTWALSLLLNNRHTLV  345

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K QEELD  +GRGR VNESDI NL +LQA+ KETLR+YPP P++G+R   EDCT+  GYH
Sbjct  346  KAQEELDKHVGRGRLVNESDISNLEYLQAIFKETLRMYPPAPLSGIRKFSEDCTIG-GYH  404

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            VP  T LM+N+WKI  D  +W +P EF+PERFLTTHKDIDV+G +FELIPFG GRR CPG
Sbjct  405  VPKDTWLMMNLWKIQSDPRVWVDPMEFKPERFLTTHKDIDVKGHNFELIPFGGGRRICPG  464

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVFG  72
            +  +LQ + + LA+ LH +D + P N  +DM+ S GL NVK+TPL+V + PRL   V+G
Sbjct  465  MGFALQVIQLTLASFLHAYDISTPENAVVDMTGSLGLSNVKSTPLRVLVKPRLSENVYG  523



>ref|XP_006366436.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=270

 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 181/240 (75%), Gaps = 6/240 (3%)
 Frame = -1

Query  788  RDFMDVMLEIMED--DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSI  615
            +DFMD+ML + ED  D  ++GFDADTIIK+TCL+ML  GSD I V LTW LSLLLNN  +
Sbjct  34   KDFMDIMLSLFEDAMDEDLAGFDADTIIKSTCLSMLAGGSDTIIVALTWTLSLLLNNPHV  93

Query  614  LDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQG  435
            + K QEELD Q+G+ + V+ES I +LV+LQA+ KE+LRLYPPGP++    S+EDC +  G
Sbjct  94   MQKAQEELDIQVGKYKLVDESHINSLVYLQAIAKESLRLYPPGPLSAPHESIEDCIVG-G  152

Query  434  YHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSC  255
            Y++P GTR++ N+WKI RD ++WPEP+ F+PERFLTTHKDIDV+G HFELIPFG+GRR C
Sbjct  153  YNIPKGTRVLFNLWKIQRDPTVWPEPDLFKPERFLTTHKDIDVKGNHFELIPFGAGRRIC  212

Query  254  PGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            PGI  +L  LH+ LA +LH F+   PS+E IDM+ S G    K TPL+V + PRL   ++
Sbjct  213  PGISSTLVLLHLTLANVLHAFEITRPSDEPIDMTASFG---TKTTPLEVLIAPRLSPDLY  269



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 192/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE--EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S   + +G +DF+DVML + E+   ++ F  DAD  IK+TCL +++ G+D  A TL
Sbjct  275  QRRISGGIKAEGEQDFIDVMLSLQEE-GHLANFQYDADISIKSTCLALILGGTDTTAGTL  333

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
            TWA+SLLLNN  +L K QEELD Q+GR R V+ESDI+NLV+LQA+IKETLRLYP GP+ G
Sbjct  334  TWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLYPAGPLLG  393

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R ++ DCT++ GYHVPAGTRL++N+WKI RD  +W  P+ F PERFLT+H ++DVRGQ 
Sbjct  394  PREAMNDCTVA-GYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHANVDVRGQQ  452

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FELIPFGSGRRSCPG   +LQ LH+ LA  LH F+ + P ++ +DM+ES GL   KATPL
Sbjct  453  FELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKATPL  512

Query  113  KVCLTPRLPATVFG  72
            +V L PR+PA V+ 
Sbjct  513  EVLLKPRVPANVYA  526



>emb|CBI32517.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   298 bits (764),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 186/251 (74%), Gaps = 4/251 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDAD--TIIKATCLNMLVAGSDAIAVTLTW  648
            KR         +DF+  ML ++ DDAQ+SG D D  T+IKATCL +++AG+D IAVTLTW
Sbjct  47   KRLSGSINDAEQDFIHAMLSVI-DDAQLSGHDHDHDTVIKATCLTVMLAGNDTIAVTLTW  105

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+    
Sbjct  106  ALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPH  165

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             ++EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DV GQHFE
Sbjct  166  EAMEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVGGQHFE  224

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFGSGRR CPGI L+L+ L + LA LLH F+  + S+  +DM+E  GL   KATPL+V
Sbjct  225  LLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPLEV  284

Query  107  CLTPRLPATVF  75
             L PRLP+ ++
Sbjct  285  TLVPRLPSELY  295



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R S   +   DFM +ML ++ D A++  +DADTI KATCL++++A SD   VTLTWAL
Sbjct  551  QKRNSGNAESEHDFMGMMLSLLNDAAELPSYDADTINKATCLSLILAASDTTMVTLTWAL  610

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR+ L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP  P++    S
Sbjct  611  SLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAPLSVPHES  670

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC +S GYH+PAGTRL+IN++KIHRD   W +P EFQPERFLTT+KD DVRGQ+FELI
Sbjct  671  MEDCVVS-GYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDVRGQNFELI  729

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+ L+LQ L + LA LL  F+   P +E +DM E+ G+ N+K +PL+V +
Sbjct  730  PFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVSPLEVLI  789

Query  101  TPRLPATVF  75
            TPRLPA  +
Sbjct  790  TPRLPAVCY  798



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   306 bits (783),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 189/246 (77%), Gaps = 5/246 (2%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTLTWALSLLL  630
            + +G +DF+D+ML  ++    +S F  D+DT IK+TCL +++ GSD  A T+TWA+SLLL
Sbjct  283  KAEGEQDFIDIMLS-LQKGGHLSNFQYDSDTSIKSTCLALILGGSDTTAGTVTWAISLLL  341

Query  629  NNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDC  450
            NNR  L K QEELD  +G  R V ESDI+NL ++QA+IKETLRLYP GP+ G R + EDC
Sbjct  342  NNRQALKKAQEELDLNVGMERQVEESDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDC  401

Query  449  TLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGS  270
             ++ GYHVPAGTRL++N+WKIHRD  +W EP+ F+PERFLT+   +DVRGQ+FELIPFGS
Sbjct  402  NVA-GYHVPAGTRLVVNLWKIHRDPRVWQEPSAFRPERFLTSDA-VDVRGQNFELIPFGS  459

Query  269  GRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
            GRRSCPG+  +LQ LH+ LA LLH F+FA PS++ +DM+ES GL   KATPL+V LTPRL
Sbjct  460  GRRSCPGMSFALQVLHLTLARLLHAFEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRL  519

Query  89   PATVFG  72
            PA ++ 
Sbjct  520  PAKLYA  525



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 189/255 (74%), Gaps = 7/255 (3%)
 Frame = -1

Query  821  KRRMSEEGKG---ARDFMDVMLEIMEDDAQ---ISGFDADTIIKATCLNMLVAGSDAIAV  660
            KR++S + KG     DFMDVML I++ D      + +DADT+ KAT + ++VAG +A AV
Sbjct  263  KRKISGQVKGDDDQLDFMDVMLSILDVDGANEITTDYDADTVNKATSMALIVAGVEAPAV  322

Query  659  TLTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPV  480
             +TWAL+LLLNNR  L K QEELD  IG+GR V ESDIKNLV+LQA+IKE+ RLYP GP+
Sbjct  323  QMTWALALLLNNREALKKAQEELDQIIGKGRQVKESDIKNLVYLQAIIKESTRLYPAGPL  382

Query  479  NGLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRG  300
            +    S EDC +   YHVPAGTRL +N+ K+HRD  +W EPNEF+PERFLTTHK  DV+G
Sbjct  383  SLPHESTEDCMVGD-YHVPAGTRLFVNLSKLHRDPRVWSEPNEFRPERFLTTHKSFDVKG  441

Query  299  QHFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKAT  120
              FELIPFGSGRR CPG+ L+L+ + + LA+LLH F+ A P++E +DM E+ GL N KAT
Sbjct  442  HDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIATPTDEPVDMVETVGLTNNKAT  501

Query  119  PLKVCLTPRLPATVF  75
            PL+V  TPRLPA ++
Sbjct  502  PLEVLFTPRLPAQLY  516



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 186/249 (75%), Gaps = 2/249 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R S E +G  DF+ VML ++ D+A Q+   DADT+IKA CL +++  +D  +VTLTWA+
Sbjct  273  KRGSSEVEGDEDFIYVMLSLLYDNAKQLPDSDADTVIKALCLTVILGAADTTSVTLTWAI  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR  L K Q+EL+  +G  R VNESDIKNLV+LQA++KET+RLYP  P+     S
Sbjct  333  SLLLNNRDALKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAAPLLLPHQS  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+S GYHVPAGT+L +N WK+H D  +W EP +F PERFLTTHKDID+RGQ+FELI
Sbjct  393  MEDCTIS-GYHVPAGTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKDIDLRGQNFELI  451

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  + Q + + LA+LLH FD A P +E +DM E+  L   +ATPLKV L
Sbjct  452  PFGSGRRICPGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRATPLKVLL  511

Query  101  TPRLPATVF  75
            TPRL A+++
Sbjct  512  TPRLSASLY  520



>gb|AAP49697.1| cytochrome P-450-like protein [Vitis vinifera]
Length=259

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 188/252 (75%), Gaps = 3/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            + R+S    GA +DF+  ML ++ DD Q SG D DTIIK TC N+++AG+D  ++TLTWA
Sbjct  7    QNRLSANDNGAEQDFIHAMLSVI-DDGQFSGHDPDTIIKGTCSNLILAGNDTTSITLTWA  65

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L K Q EL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    
Sbjct  66   LSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHE  125

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL
Sbjct  126  AMEDCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYEL  184

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L+  H+ LA LLH F+    ++  +DM+ES GL   KATPL+V 
Sbjct  185  LPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVT  244

Query  104  LTPRLPATVFGH  69
            + PRLP  ++ +
Sbjct  245  IVPRLPFELYSY  256



>ref|XP_009341185.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=534

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 187/252 (74%), Gaps = 4/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKG---ARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLT  651
            KR +S   KG    RDFMD+ML +++D    + F+AD I KAT L++L+AG D    TLT
Sbjct  279  KRTVSGGVKGDEEERDFMDLMLSVLDDAKVTNSFEADIINKATSLSLLLAGVDVTTGTLT  338

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WALSLLLN+   L KV+EE+D  IGR R V ESD+ NLV+LQAVIKETLRLYPPGP    
Sbjct  339  WALSLLLNSPKTLKKVREEIDQNIGRERAVKESDVDNLVYLQAVIKETLRLYPPGPTLLP  398

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
             +S EDC L+ GYH+PA TR+++N+WKIHRD ++WP+PNEFQPERF TTH DIDV+GQ F
Sbjct  399  HASNEDCVLA-GYHIPANTRVLVNVWKIHRDPTVWPDPNEFQPERFFTTHSDIDVKGQDF  457

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRR C GI L+L+ + + LA+LLH F+ A P+ E +DM ES  L N + + L+
Sbjct  458  ELIPFGSGRRMCAGIALALRIMPLTLASLLHGFEIATPTGEPVDMRESMELTNHRTSQLE  517

Query  110  VCLTPRLPATVF  75
            V LTPRLPA ++
Sbjct  518  VLLTPRLPAQLY  529



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 185/250 (74%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D A+    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  273  KRGSSEVKGDEDFMYVMLSLFDDKAKQLPDGDDTDTVIKAICLSLILAASDTTAVTLTWA  332

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L K Q ELD Q+G  R VNESD+KNL +LQ ++KETLRLYP GP+     
Sbjct  333  IALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHE  392

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDCT+ +GYHVPAGT+L++N WK+ RD  +W EP +F PERFL  +KD+D++GQ+FE 
Sbjct  393  SIEDCTI-RGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKGQNFEF  451

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  452  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVL  511

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  512  LTPRLSASLY  521



>ref|XP_010070482.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59277.1| hypothetical protein EUGRSUZ_H01953 [Eucalyptus grandis]
Length=528

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 186/242 (77%), Gaps = 2/242 (1%)
 Frame = -1

Query  800  GKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNR  621
            G   +DFMD+ML + E  A+ S FD DT+IKATCLN++V G+D +A  LTWALSLL+N+R
Sbjct  281  GDREQDFMDLMLNVCES-AKFSDFDTDTVIKATCLNLIVGGTDTMATALTWALSLLVNDR  339

Query  620  SILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLS  441
              L K Q+ELDT +G+ R V ESD+K L +LQA++KET+RLYPP P+  +RSS+E+CT S
Sbjct  340  RTLKKAQQELDTHVGKSRPVEESDVKKLTYLQAIVKETMRLYPPVPI-AVRSSMEECTFS  398

Query  440  QGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRR  261
             G+ +P GTRL+ NI KI RDE +W  P++FQPERFLTTH+++D+RGQ+FELIPF +GRR
Sbjct  399  GGFRIPTGTRLLFNIAKIQRDERVWSNPDKFQPERFLTTHENVDMRGQNFELIPFATGRR  458

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPAT  81
            SC G  L+L T+H+ LA+LL  F+ +  S+E +DM+ES GL N+KATPL+V L PRL   
Sbjct  459  SCAGTSLALHTVHLVLASLLQSFEISTVSDEAVDMTESPGLSNMKATPLEVILIPRLDQK  518

Query  80   VF  75
            V+
Sbjct  519  VY  520



>ref|XP_006428104.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
 gb|ESR41344.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
Length=367

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D  +    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  118  KRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASDTTAVTLTWA  177

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L+K Q ELD  +G  R VNESD+ NL  LQ V+KETLRLYP  P+     
Sbjct  178  IALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAPLLLPHE  237

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDCT+S GYHVPAGT+L++N WKI RD  +W EP +F PERFLT +KD+D++GQ+FE 
Sbjct  238  SIEDCTIS-GYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKGQNFEF  296

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  297  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKATPLEVL  356

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  357  LTPRLSASLY  366



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 185/252 (73%), Gaps = 5/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGA---RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLT  651
            +R+    GK A   +DFMD ML ++E+    +G+D+D IIK+ CLN++  GSD   VTLT
Sbjct  271  RRKRGSAGKVATKEQDFMDSMLSVLEEK-DFAGYDSDMIIKSACLNLIAGGSDTSTVTLT  329

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            W +SLLLNN+  L+K QEELD  +GR R VNE DI  L++LQA+IKE+LRLYPP P++  
Sbjct  330  WTISLLLNNKQALEKAQEELDRLVGRERQVNEFDISKLIYLQAIIKESLRLYPPAPLSAP  389

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
            R + E+CT+  G H+  GTRL+IN+WKIHRD   WP+P +F PERFLT+HKDIDVRGQ+F
Sbjct  390  RVTRENCTIG-GCHIKKGTRLIINVWKIHRDPKNWPDPLQFTPERFLTSHKDIDVRGQNF  448

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRR+CPG    LQ +HI LA  L  F  + P+ E IDM+ES GL N+KATPL+
Sbjct  449  ELIPFGSGRRACPGTAFGLQMVHIALARFLQAFQISNPTTEPIDMTESPGLTNLKATPLE  508

Query  110  VCLTPRLPATVF  75
            V L+PRLP  ++
Sbjct  509  VLLSPRLPPGLY  520



>emb|CAN72749.1| hypothetical protein VITISV_004418 [Vitis vinifera]
Length=259

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 184/249 (74%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR      +  +DF  VML ++ED  Q S  D DT+IKAT L +++AG+D IA+TLTWAL
Sbjct  12   KRFSGSMNEAEQDFNHVMLSVIED-GQFSDHDHDTVIKATXLTVMLAGNDTIAITLTWAL  70

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+     +
Sbjct  71   SLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEA  130

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DVRGQHFEL+
Sbjct  131  MEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWLDPLEFQPERFLTKHVGLDVRGQHFELL  189

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI L+L+ L + LA LLH F+  + ++  +DM+E  GL   KATPL+V L
Sbjct  190  PFGSGRRMCPGISLALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEVTL  249

Query  101  TPRLPATVF  75
             PRLP+ ++
Sbjct  250  VPRLPSELY  258



>gb|KHN22284.1| Cytochrome P450 82A3 [Glycine soja]
Length=452

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR    E K  +D MDV+L ++E+  +  G DADT IKATCL +++AGSD    TL+WAL
Sbjct  202  KRNSEAEPKSNQDLMDVLLSLVEEGQEFDGQDADTTIKATCLGLILAGSDTTTTTLSWAL  261

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L+K   ELDTQIG  + V  SD+K L +LQ++IKETLRLYP  P+N    S
Sbjct  262  SLLLNNREVLNKAIHELDTQIGSEKIVEISDLKKLEYLQSIIKETLRLYPAAPLNVPHES  321

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            LEDCT+  GYHVP GTRL+ NI K+ RD S++P P EF PERFLTTHKD+D++GQHFELI
Sbjct  322  LEDCTVG-GYHVPTGTRLLTNISKLQRDPSLYPNPLEFWPERFLTTHKDVDIKGQHFELI  380

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR CPG+   LQ + + LATLLH FD      E +DM E  GL N+KA+PL+V L
Sbjct  381  PFGAGRRMCPGLSFGLQVMQLTLATLLHGFDIVTSDGEHVDMLEQIGLTNIKASPLQVIL  440

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  441  TPRLSGHIY  449



>gb|KJB63760.1| hypothetical protein B456_010G014600 [Gossypium raimondii]
Length=525

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 187/250 (75%), Gaps = 5/250 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R   +  G  DFM VML I+ D  +     ADTI KATCL++++A  D+ ++TLTW L
Sbjct  276  QKRAENKANGEEDFMGVMLSILSDREE---HHADTINKATCLSLVLAAEDSTSITLTWVL  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRN-VNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            SLLLNNR  L KVQ+EL+  +G+ R  V ESD KNLV+LQ++IKETLRLYPP P++ +  
Sbjct  333  SLLLNNRDKLSKVQQELNVHVGKDRLLVTESDTKNLVYLQSIIKETLRLYPPAPLSVIHE  392

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT++ GYHV AGT L++N++KIH D  IW  P EFQPERF+TTHKDIDVRGQ+FEL
Sbjct  393  AMEDCTVN-GYHVSAGTWLIMNLYKIHHDPLIWANPFEFQPERFMTTHKDIDVRGQNFEL  451

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPG+  +LQ L   LA +LH F+F  PSNE +DMSE+ GL N KATPL+V 
Sbjct  452  IPFGSGRRMCPGVSFALQILLFTLANVLHWFEFETPSNEAVDMSEALGLTNSKATPLEVH  511

Query  104  LTPRLPATVF  75
            +TPRLP  V+
Sbjct  512  ITPRLPVFVY  521



>ref|XP_006428105.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
 gb|ESR41345.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
Length=367

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 181/250 (72%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D  +    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  118  KRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASDTTAVTLTWA  177

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L+K Q ELD  +G  R VNESD+ NL +LQ V+KETLRLYP  P+     
Sbjct  178  IALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAPLLVPHE  237

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +S GYHVPAGT+L++N WKI RD  +W EP  F PERFLT +KD+D++GQ+FE 
Sbjct  238  SIEDCNIS-GYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKGQNFEF  296

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  297  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVL  356

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  357  LTPRLSASLY  366



>emb|CBI32508.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 187/251 (75%), Gaps = 4/251 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDAD--TIIKATCLNMLVAGSDAIAVTLTW  648
            KR      +  +DF+  ML ++ DDAQ+S  D D  T+IKATCL +++AG+D IA+TLTW
Sbjct  86   KRLSGSINEAEQDFIHAMLSVI-DDAQLSAHDHDHDTVIKATCLTVMLAGNDTIAITLTW  144

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+    
Sbjct  145  ALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPH  204

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             ++EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DVRGQHFE
Sbjct  205  EAMEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFE  263

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFGSGRR CPGI L+L+ L + LA LLH F+  + ++  +DM+E  GL   KATPL+V
Sbjct  264  LLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEV  323

Query  107  CLTPRLPATVF  75
             L PRLP+ ++
Sbjct  324  TLVPRLPSELY  334



>gb|KDO37275.1| hypothetical protein CISIN_1g012878mg [Citrus sinensis]
Length=454

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 192/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA C+ ++VA +D   VTLTWA+
Sbjct  206  KRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAAADTTVVTLTWAI  265

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR +L K Q+ELD Q+G  R VN SD++NLV+LQA+IKET+RLYP  P+     S
Sbjct  266  ALLLNNRDVLKKAQDELDIQVGTKRQVNGSDMRNLVYLQAMIKETMRLYPALPLLLPHES  325

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLTTHKDIDVRGQ+FELI
Sbjct  326  IEECTVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTTHKDIDVRGQNFELI  384

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS E +DM+E+ GL + KATPL+V +
Sbjct  385  PFGSGRRMCPAVSYGLQVMQLMLASLVHGFDFTTPSGEPVDMAETMGLTSAKATPLEVLV  444

Query  101  TPRLPATVFG  72
            +PRL A+ +G
Sbjct  445  SPRLSASSYG  454



>gb|AII31758.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               IL K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHILKKAQEELDTYIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKD+DVRGQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDVDVRGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLTNIKSTPLEALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_004293232.2| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 186/252 (74%), Gaps = 5/252 (2%)
 Frame = -1

Query  821  KRRMSEEG---KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLT  651
            KR + EE    K   DFMD ++  +E  A +SG+DA+T+ KATCLN++ AGSD++ VTLT
Sbjct  285  KRALREEEDDIKEPGDFMDALVYALEG-ADLSGYDANTVNKATCLNLIAAGSDSMYVTLT  343

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WA+SLLLN+  +L++ QEELDT++GR R V ESD+  LV+LQA++KETLRLYP  P+   
Sbjct  344  WAISLLLNHPHVLERAQEELDTEVGRERAVAESDLCKLVYLQAIVKETLRLYPAAPLAAP  403

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
                EDCT++ GYHVP GTRL+ NIW++  D   WPEP EF+PERFLTTHKD+DVRGQ+F
Sbjct  404  HEFNEDCTIA-GYHVPKGTRLITNIWRVQTDPQAWPEPLEFKPERFLTTHKDVDVRGQNF  462

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRRSCP +  SLQ +   LA+ LH F  + P N  +DMSES G  NVKATPL+
Sbjct  463  ELIPFGSGRRSCPAVSFSLQMVQSTLASFLHAFQISAPFNAHVDMSESFGATNVKATPLE  522

Query  110  VCLTPRLPATVF  75
            V + PRLP  ++
Sbjct  523  VLIKPRLPFELY  534



>ref|XP_006435894.1| hypothetical protein CICLE_v10033457mg [Citrus clementina]
 gb|ESR49134.1| hypothetical protein CICLE_v10033457mg [Citrus clementina]
Length=454

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 192/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA C+ ++VA +D   VTLTWA+
Sbjct  206  KRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAAADTTVVTLTWAI  265

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR +L K Q+ELD Q+G  R VN SD++NLV+LQA+IKET+RLYP  P+     S
Sbjct  266  ALLLNNRDVLKKAQDELDIQVGTKRQVNGSDMRNLVYLQAMIKETMRLYPALPLLLPHES  325

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLTTHKDIDVRGQ+FELI
Sbjct  326  IEECTVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTTHKDIDVRGQNFELI  384

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS E +DM+E+ GL + KATPL+V L
Sbjct  385  PFGSGRRMCPAVSYGLQVMQLMLASLVHGFDFTTPSGEPVDMAETMGLTSAKATPLEVLL  444

Query  101  TPRLPATVFG  72
            +PRL A+ +G
Sbjct  445  SPRLFASSYG  454



>gb|KDO37196.1| hypothetical protein CISIN_1g019564mg [Citrus sinensis]
Length=339

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 184/251 (73%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S+E K    DFM VML I+ D  Q SG D DT+ KATCL +++A +D  AVTLTW 
Sbjct  90   RKRNSQEIKEEELDFMSVMLLILGDKEQYSGRDVDTVNKATCLGLILAATDTTAVTLTWV  149

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R IL+K Q ELD Q+G  R VNESDIKNLV+LQA++KET+RLYP  P+     
Sbjct  150  ISLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHE  209

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+C ++ GYHVPAGT++ IN WK+ RD  +W EP +F P+ FLT  KDIDV+GQ+FEL
Sbjct  210  SMEECIVN-GYHVPAGTQIFINAWKLQRDPRVWEEPCKFHPKTFLTRQKDIDVKGQNFEL  268

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PF SGRR CPG+  +LQ +   LA+LLH FDFA PSNE +DM E  GL   K+TPL+V 
Sbjct  269  LPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLEVL  328

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  329  VAPRLSASLYG  339



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 182/244 (75%), Gaps = 7/244 (3%)
 Frame = -1

Query  785  DFMDVMLEIMED--DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSIL  612
            +FM  ML I++D    +  G DADTI KATCL +++ GSD  + TLTWA+SLLLNNR  L
Sbjct  284  NFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSDTTSGTLTWAISLLLNNRHAL  343

Query  611  DKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGY  432
             K QEELD Q+G+ R V+ESD +NLV+LQA+IKETLRLYP GP+   R ++EDCT+S GY
Sbjct  344  KKAQEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVS-GY  402

Query  431  HVPAGTRLMINIWKIHRDESIWPEPNEFQPERFL---TTHKDIDVRGQHFELIPFGSGRR  261
            HVPAGTRLMIN WKI RD S+W  P+ FQPERFL     H D+DVRGQ FELIPFGSGRR
Sbjct  403  HVPAGTRLMINAWKIQRDPSVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRR  462

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPR-LPA  84
            SCPG   +LQ LH+ LA LLH F+ A P ++ +DMSES GL   KATPLKV L+PR LPA
Sbjct  463  SCPGASSALQVLHLTLARLLHSFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRLLPA  522

Query  83   TVFG  72
              +G
Sbjct  523  NPYG  526



>gb|KHG29694.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               IL K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHILKKAQEELDTYIGRDRLVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKD+DVRGQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDVDVRGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLTNIKSTPLQALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 187/250 (75%), Gaps = 4/250 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR S    G +DFMDVML  +E+   +SG+DAD + KATC+N++  G+D  AVTLTWAL
Sbjct  278  QRRGSGNFGGEKDFMDVMLSKLEESTDLSGYDADIVNKATCMNIISGGTDTTAVTLTWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN+S+L KVQEELD  +G+ R V ESDI NLV+LQAV+KETLRLYP GP++G+R  
Sbjct  338  SLLLNNKSVLQKVQEELDLHVGKERPVKESDISNLVYLQAVVKETLRLYPAGPLSGIREF  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWP-EPNEFQPERFLTTHKDIDVRGQHFEL  285
             EDCT+  GYHVP GTRL+ N+WKI  D   W  +P EF+P+RFLTTHKD+DV+G+HFEL
Sbjct  398  SEDCTIG-GYHVPKGTRLITNLWKIQTDPKTWSDDPLEFKPDRFLTTHKDVDVKGKHFEL  456

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRRSCPG+   LQ  H+ +A LL  FD  + ++  +DM+   GL N KATPL+V 
Sbjct  457  IPFGAGRRSCPGMTYGLQMTHLVIACLLQAFD--VFTDGPVDMTAIFGLTNAKATPLEVL  514

Query  104  LTPRLPATVF  75
            + PRL  +++
Sbjct  515  VKPRLSISLY  524



>ref|XP_006384482.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
 gb|ERP62279.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
Length=344

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 182/238 (76%), Gaps = 2/238 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            RDF+ VML  +ED  +IS  D DT IK TCL++++ G D   VTLTWALSL+LNNR +L+
Sbjct  107  RDFIHVMLSNLED-GKISAVDTDTAIKGTCLSLILGGHDTTFVTLTWALSLILNNREVLE  165

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K Q+ELD Q+G+ R V+E+DIKNLV+LQA++KET+RLYP  P++  R ++EDCT++ G+H
Sbjct  166  KAQDELDIQVGKHRQVDETDIKNLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVA-GFH  224

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PAGTRL++N+WK+HRD +IW  P EFQPERFL  H ++DVRGQ FE +PFGSGRR CPG
Sbjct  225  IPAGTRLLVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPG  284

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L+LQ LH+ LA LLH F+    S+  IDMSE  G+   K TPL+V L PRL ++++
Sbjct  285  ISLALQVLHLTLARLLHGFEMGTVSDALIDMSEGPGITIPKETPLEVILRPRLHSSLY  342



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 189/250 (76%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA CL ++VA +D  AVTLTWA+
Sbjct  280  KRVSGEIKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLTLIVAATDTTAVTLTWAI  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNN  +L K Q+ELD Q+G  R VNESD++NLV+LQA+IKET+RLYP GP+     S
Sbjct  340  ALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAGPLLLPHES  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+C ++ GY VPAGT+L +N WKI RD  +W EP +FQPERFLT HKDIDV GQ FELI
Sbjct  400  IEECIVN-GYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQDFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS+E +DM E+ GL   KATPL+V +
Sbjct  459  PFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKATPLEVLV  518

Query  101  TPRLPATVFG  72
            +PRL A+++G
Sbjct  519  SPRLSASLYG  528



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 181/249 (73%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR + + G+   DFMDVML I E+   +  FDADT IKATC+ +L AG+D   VT TW L
Sbjct  274  KREIIKSGEAEEDFMDVMLSICENRG-LPEFDADTAIKATCMGVLAAGTDTTIVTSTWTL  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L K Q+ELD  +G+ R V ESDIKNLV+LQA++KE LRLYP  P+     S
Sbjct  333  SLLLNNYESLKKAQDELDAHVGKNRWVQESDIKNLVYLQAIVKEALRLYPAAPLAVPHES  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+S GY +P GTRL++NIWKIH D +IWP P+EF+PERFLTTHKD+DV+G HFELI
Sbjct  393  MEDCTIS-GYDIPKGTRLLVNIWKIHHDPNIWPNPHEFKPERFLTTHKDVDVKGNHFELI  451

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI L+LQ +   +A LL  F+   PS+E IDMSE  GL  +KA+PL+V L
Sbjct  452  PFGSGRRMCPGISLTLQVVPFVIAVLLQGFNIKRPSDEPIDMSEIFGLTVLKASPLEVLL  511

Query  101  TPRLPATVF  75
             PRL   ++
Sbjct  512  APRLAPVLY  520



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 185/251 (74%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S+E K    DFM VML I+ D  Q SG D DT+ KATCL +++A +D  AVTLTW 
Sbjct  276  RKRNSQEIKEEELDFMSVMLLILGDKEQYSGRDVDTVNKATCLGLILAATDTTAVTLTWV  335

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R IL+K Q ELD Q+G  R VNESDIKNLV+LQA++KET+RLYP  P+     
Sbjct  336  ISLLLNHRDILNKAQNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHE  395

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+C ++ GYH+PAGT+L IN WK+ RD  +W EP +F P+RFLT HKDIDV+GQ+FEL
Sbjct  396  SMEECIVN-GYHIPAGTQLFINAWKLQRDPRVWEEPYKFHPKRFLTRHKDIDVKGQNFEL  454

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PF SGRR CPG+  +LQ +   LA+LLH FDFA PSNE +DM E  GL   K+TPL V 
Sbjct  455  LPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLVVL  514

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  515  VAPRLSASLYG  525



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 187/245 (76%), Gaps = 5/245 (2%)
 Frame = -1

Query  797  KGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            +G +DF+DVML+ ++    +S F  D+DT IK+TCL +++ GSD  A TLTWA+SLLLNN
Sbjct  287  EGEQDFIDVMLD-LQKTGHLSNFQYDSDTSIKSTCLAIILGGSDTSAGTLTWAISLLLNN  345

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
            R  L K QEELD  +G  R V ESDI+NL +LQA+IKETLRLYP GP+ G R + EDC +
Sbjct  346  RQALKKAQEELDLNVGMERQVEESDIRNLAYLQAIIKETLRLYPAGPLLGPREAQEDCNV  405

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GY VPAGTRL++N+WKIHRD  +W EP+ F+PERFLT+   +DVRGQ+FELIPFGSGR
Sbjct  406  G-GYDVPAGTRLVVNLWKIHRDPRVWEEPSAFRPERFLTSDA-VDVRGQNFELIPFGSGR  463

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPA  84
            RSCPG+  +LQ LH+ LA LLH F+FA PS+E +DM+ES GL   KATPL+V LTPRLP 
Sbjct  464  RSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDMTESPGLTIPKATPLEVLLTPRLPP  523

Query  83   TVFGH  69
             ++ +
Sbjct  524  QLYAY  528



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR     KG +DF+D ML ++ D A + GFDADTI KAT LNM+  GSD   VTLTWA+
Sbjct  279  QRRAKGGAKGEQDFIDAMLSVL-DGADLGGFDADTINKATSLNMIAGGSDTTMVTLTWAI  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN  +L +   ELDT+IGR R V+E DI NLV++QA++KETLRLYP  P++G R  
Sbjct  338  SLLVNNPHVLKRALNELDTKIGRQRVVSEEDISNLVYIQAIVKETLRLYPAAPLSGPREF  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ G H+  GTRL++N+WK+  D  IWP+P EF+PERFLTTHKD+DV+G HFELI
Sbjct  398  TEDCTIA-GCHIRKGTRLIMNLWKLQTDPKIWPDPLEFKPERFLTTHKDVDVKGHHFELI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPG+  +LQ +   LA+ LH F+ + PS+  IDM+ES GL N+K TPLKV +
Sbjct  457  PFGSGRRACPGLAFALQMVQFTLASFLHAFEISNPSSAPIDMTESFGLTNMKVTPLKVLI  516

Query  101  TPRL  90
             PRL
Sbjct  517  KPRL  520



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R   +    +DFMDVML I++   +  G+DADT IKATC+ +++AGSD  +V+LTWALS
Sbjct  286  KRRGNDKNNDQDFMDVMLSIVDATEEFPGYDADTFIKATCMGLVLAGSDTTSVSLTWALS  345

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R  L K Q ELDTQIGR + V ESD+KNLV++QA+IKETLRLYP GP+     S+
Sbjct  346  LLLNHREALKKAQHELDTQIGREKRVKESDLKNLVYIQAIIKETLRLYPAGPLGVPHESM  405

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYHVP GTRL+ N WKIHRD  IW +P +F+PERFLTT+KD+D+RGQ+FELIP
Sbjct  406  EDCTVD-GYHVPKGTRLLFNFWKIHRDPHIWSDPLKFRPERFLTTYKDVDIRGQNFELIP  464

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH F+    +NE + M+E+ GL N+KATPL+V +T
Sbjct  465  FGSGRRMCPGINLAMQLMSLSLAALLHGFEVTTLANEPVGMTEAIGLTNLKATPLEVLVT  524

Query  98   PRLPATVF  75
            PRL    +
Sbjct  525  PRLQERAY  532



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 183/251 (73%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S E KG   DFM VM  I+ D  Q SG D DTI KA CL +++AG D   VTLTW 
Sbjct  282  RKRDSREVKGEELDFMSVMPSILGDTEQYSGRDVDTINKAVCLGLIIAGLDTTTVTLTWV  341

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R ILDKVQ ELD Q+G  R VNESD+KNLV+LQA +KE +RLYP  P+     
Sbjct  342  ISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHE  401

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++E+CT++ GYHVPA T+L+IN+WK+ RD  +W EP +FQPERFLT HKDIDVRGQH EL
Sbjct  402  AIEECTVN-GYHVPARTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLEL  460

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPG+  +LQ +   +A+LL  FDFA PSNE +DM E  GL   K+ PL+V 
Sbjct  461  LPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVL  520

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  521  IAPRLSASLYG  531



>gb|KJB58361.1| hypothetical protein B456_009G206600 [Gossypium raimondii]
Length=522

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               IL K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHILKKAQEELDTYIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF PERFLTTHKD+DVRGQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFNPERFLTTHKDVDVRGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLTNIKSTPLEALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>gb|AII31759.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
 gb|KJB58362.1| hypothetical protein B456_009G206700 [Gossypium raimondii]
Length=522

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               IL K QEELDT IG+ R VNE+DI  LV++QA++KETLRLYPP P++  R   E C+
Sbjct  339  KPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRLYPPAPLSAPRELSETCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKD+DVRGQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDVDVRGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L + ++  LH FDF+ PSN  ID++ +AGL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLTNIKSTPLEALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 189/250 (76%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA C+ ++VA +D  AVTLTWA+
Sbjct  278  KRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAATDTTAVTLTWAI  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNN  +L K Q+ELD Q+G  R VNESD++NLV+LQA+IKET+RLYP GP+     S
Sbjct  338  ALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAGPLLLPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+C ++ GY VPAGT+L +N WKI RD  +W EP +FQPERFLT HKDIDV GQ FELI
Sbjct  398  IEECIVN-GYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQDFELI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS+E +DM E+ GL   KATPL+V +
Sbjct  457  PFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKATPLEVLV  516

Query  101  TPRLPATVFG  72
            +PRL A+++G
Sbjct  517  SPRLSASLYG  526



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 188/252 (75%), Gaps = 4/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ---ISGFDADTIIKATCLNMLVAGSDAIAVTLT  651
            ++R+S +  G +DFMDVML I++D+ +   I   DAD I KATCLN+L+A +D + V+LT
Sbjct  269  RKRVSGQPTGDQDFMDVMLSILDDETRAQDIKSSDADIINKATCLNVLIATTDTVTVSLT  328

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WALSLLLNNR +L+K +EELD  +GR R V E D+ NLV+L A+IKETLRLY    V   
Sbjct  329  WALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYLDAIIKETLRLYSAVQVLAA  388

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
              S E+C +  G ++PAGTRL+IN+WKIH D S+W +P++F PERFLTTHKD+DVRG HF
Sbjct  389  HESTEECVVG-GCYIPAGTRLIINLWKIHHDPSVWSDPDQFMPERFLTTHKDVDVRGMHF  447

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRR CPG+ L+LQ L   LA+L+  F+FA  S+  +DM+ES GL N+KATPL 
Sbjct  448  ELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGPVDMTESIGLTNLKATPLD  507

Query  110  VCLTPRLPATVF  75
            V LTPRL + ++
Sbjct  508  VLLTPRLSSNLY  519



>ref|XP_006366469.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=455

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 180/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRM-SEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR++   + K   DFMDVML I  +D  I GFD DT IKATC+ ML AG+    VTL W 
Sbjct  205  KRKLRGNKCKDEDDFMDVMLSICHEDKNIHGFDVDTTIKATCMIMLSAGTVTTIVTLIWT  264

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN   L K Q+ELDT IG+ R V ESDIKNLV+LQA+IKE+LRLY PGP+     
Sbjct  265  LSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQAIIKESLRLYSPGPLLLPHE  324

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +S GY +P GTRL++N+WK+  D  IWP P+EF+PERFLTTHK++DVRG HFEL
Sbjct  325  SIEDCVVS-GYDIPKGTRLLVNVWKLRNDPKIWPNPHEFKPERFLTTHKNVDVRGNHFEL  383

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRR CPG   +LQ +   LA LL  FD   PS+E IDMSES GL  +KA+PL+V 
Sbjct  384  IPFGTGRRICPGTSFALQVVQYVLAILLQGFDIKRPSDEAIDMSESFGLTILKASPLEVH  443

Query  104  LTPRLPATVF  75
             TPRL + ++
Sbjct  444  PTPRLNSNLY  453



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 186/237 (78%), Gaps = 2/237 (1%)
 Frame = -1

Query  797  KGARDFMDVMLEIMEDDAQIS-GFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNR  621
            KG  DFMD++L+IM+D+A+ +   D+DTI KATCL + +A SD  +VTL WALSLL+NN 
Sbjct  287  KGEEDFMDLILDIMDDEAEATLSRDSDTINKATCLALTLAASDTTSVTLIWALSLLVNNP  346

Query  620  SILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLS  441
             +L K Q+ELD Q+GR R V+ESD+ NL+FL+A++KETLRLYP GP++    S++DCT++
Sbjct  347  DVLKKAQDELDVQVGRERQVHESDVNNLIFLKAIVKETLRLYPAGPLSVPHESMKDCTVA  406

Query  440  QGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRR  261
             GYH+PAGTRL+ N+ KIHRD  +W  P+E+Q ERFLT+H+D DVRG+ FE IPFGSGRR
Sbjct  407  -GYHIPAGTRLVTNLSKIHRDPRVWSNPSEYQQERFLTSHQDFDVRGKTFEFIPFGSGRR  465

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
             CPG+  +LQ LHI LATLLH F+F  P+ E +DM+E+ GL N++ATPL+V + PRL
Sbjct  466  MCPGVSFALQVLHITLATLLHGFNFGTPTGEPLDMTENFGLTNLRATPLEVAINPRL  522



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 181/249 (73%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R S+E K   DFM VML I+ D  Q  G D DTI KA CL +++  +D   VTLTW +
Sbjct  276  RKRDSQEIKKEEDFMYVMLSILGDTEQYLGRDVDTINKAICLALILGAADTTTVTLTWVM  335

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+R IL+K Q ELD Q+G  R VNESDIKNLV+LQA++KE +RLYP GP+     S
Sbjct  336  SLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHES  395

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT++ GYHVPA T+L IN WKI RD S+W EP++FQPERFLT HKDIDV+GQ+FEL+
Sbjct  396  IEECTVN-GYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKGQNFELL  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRR CPG+  +LQ +   LA+LL  F+FA PSNE +DM E  GL   K+ P +V +
Sbjct  455  PFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLV  514

Query  101  TPRLPATVF  75
            TPRL A V+
Sbjct  515  TPRLSAAVY  523



>ref|XP_010061806.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=541

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 190/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     +DFMDVML  ++   ++ G+DADT IKATC+ +++AGSD  +V+LTWALS
Sbjct  294  KRRGDNKDSDQDFMDVMLSTVDAAEELPGYDADTFIKATCMALVLAGSDTTSVSLTWALS  353

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD++NLV++QA+IKET+RLYP  P+     S 
Sbjct  354  LLLNHREVLKKAQHELDTQIGRERLVNESDLENLVYIQAIIKETMRLYPAAPLGVPHEST  413

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL+ N  KIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FEL+P
Sbjct  414  EDCTVD-GYHIPKGTRLLFNFSKIHRDQHIWSDPQEFRPERFLTTHRNFDVRGQNFELLP  472

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E++DM+E+ G+ N+KATPL+V +T
Sbjct  473  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEQVDMAEAIGMTNLKATPLEVLVT  532

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  533  PRLPEHTY  540



>ref|XP_008388074.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82A4-like [Malus 
domestica]
Length=290

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 180/249 (72%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A +  FDADTI KAT +N++  G D   V LTWA+
Sbjct  43   QRRAKGDAKGEKDFIDSLLSVL-DGADLGSFDADTITKATSVNIIAGGGDTTMVPLTWAI  101

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN  +L K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP++G R  
Sbjct  102  SLLVNNPQVLKKAVNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPVGPLSGPRLF  161

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+P GTRL+ N WKI  D   WPEP EF+PERFLTTHKD+D++G+HF+ +
Sbjct  162  TEDCTIA-GYHIPKGTRLIPNFWKIQTDPKNWPEPFEFKPERFLTTHKDVDLKGRHFQFL  220

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKATPL V +
Sbjct  221  PFSSGRRSCPGLAFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGITNVKATPLNVLI  280

Query  101  TPRLPATVF  75
             PRL   ++
Sbjct  281  KPRLSXELY  289



>ref|XP_006432705.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
 gb|ESR45945.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
Length=452

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 185/251 (74%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S+E K    DFM VML I+ D  Q SG D DTI KATCL +++A +D   +TLTW 
Sbjct  203  RKRDSQEIKEEDLDFMSVMLSILGDTKQYSGRDVDTINKATCLGLVLAATDNTKMTLTWV  262

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R IL+K Q ELD  +G  R VNESDIKNLV+LQA++KE +RLYP  P+     
Sbjct  263  ISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHK  322

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+CT+S GY+VP  T+L+IN+WK+ RD  +W EP +FQPERFLT HKDIDVRGQ+FEL
Sbjct  323  SIEECTIS-GYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFEL  381

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR+CPG+  +LQ +   LA LLH FDFA PSNE +DM E  GL   KA PL+V 
Sbjct  382  LPFGSGRRTCPGVSFALQVMEFTLAALLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVL  441

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  442  IAPRLSASLYG  452



>gb|AII31760.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               +L K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKDIDV+GQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDIDVKGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTDGLTNIKSTPLQALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 180/250 (72%), Gaps = 3/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKG-ARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR++     G   DFMDVML I ED   + GFD D IIKATC+ +  AG+D   VTL W 
Sbjct  268  KRKLRGNNCGDEEDFMDVMLSICED-KNLHGFDTDAIIKATCMALQTAGTDTTIVTLIWI  326

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN   L K Q+ELDT IG+ R V ESDIKNLV+LQA++KE+ RLYP  P+     
Sbjct  327  LSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQAIVKESFRLYPAAPLMLPHE  386

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +S GY +P GTRL++N+WK+  D  IWP P+EF+PERFLTTHKD+DVRG HFEL
Sbjct  387  SIEDCVVS-GYDIPKGTRLLVNVWKLQYDPEIWPNPHEFKPERFLTTHKDVDVRGNHFEL  445

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPG+ L+LQ L   ++ LL  FD   PS+E IDMSES GL  +KA+PL+V 
Sbjct  446  IPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPSDEAIDMSESFGLTILKASPLEVQ  505

Query  104  LTPRLPATVF  75
            LTPRL + ++
Sbjct  506  LTPRLDSNLY  515



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 7/244 (3%)
 Frame = -1

Query  785  DFMDVMLEIMED--DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSIL  612
            +FM  ML I++D    +  G DADTI KATCL +++ GSD  + TLTWA+SLLLNNR  L
Sbjct  284  NFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSDTTSGTLTWAISLLLNNRHAL  343

Query  611  DKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGY  432
             K QEELD Q+G+ R V+ESD +NLV+LQA+IKETLRLYP GP+   R ++EDCT+S GY
Sbjct  344  KKAQEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVS-GY  402

Query  431  HVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLT---THKDIDVRGQHFELIPFGSGRR  261
            HVPAGTRLMIN WKI RD  +W  P+ FQPERFL     H D+DVRGQ FELIPFGSGRR
Sbjct  403  HVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRR  462

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPR-LPA  84
            SCPG   +LQ LH+ LA LLH F+ A P ++ +DMSES GL   KATPLKV L+PR LPA
Sbjct  463  SCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRLLPA  522

Query  83   TVFG  72
              +G
Sbjct  523  NPYG  526



>gb|KJB60932.1| hypothetical protein B456_009G331600 [Gossypium raimondii]
Length=522

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               +L K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKDIDV+GQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDIDVKGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTDGLTNIKSTPLQALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 189/255 (74%), Gaps = 7/255 (3%)
 Frame = -1

Query  821  KRRMSEEGKGARD---FMDVMLEIMEDDAQ---ISGFDADTIIKATCLNMLVAGSDAIAV  660
            +R++S + KG  D   FMDVML I++ D      S +DADT+ KAT + ++VAG +A AV
Sbjct  263  RRKISGQVKGGDDQLDFMDVMLSILDVDGANEITSDYDADTVNKATSMALIVAGVEAPAV  322

Query  659  TLTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPV  480
             +TWAL+LLLNNR  L K QEELD  IG+ R V ESDIKNLV+LQA+IKE++RLYP GP+
Sbjct  323  QMTWALALLLNNREALKKAQEELDQIIGKDRQVKESDIKNLVYLQAIIKESMRLYPAGPL  382

Query  479  NGLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRG  300
            +    S EDC +   YHVPAGTRL++N+ K+HRD  +W +PNEF+PERFLTTHK  DV+G
Sbjct  383  SLPHESTEDCMVGD-YHVPAGTRLLVNLSKLHRDPRVWSDPNEFRPERFLTTHKSFDVKG  441

Query  299  QHFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKAT  120
              FELIPFGSGRR CPG+ L+L+ + + LA+LLH F+   P++E +DM E+ G+ N KAT
Sbjct  442  HDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIGTPTDETVDMGETVGVTNNKAT  501

Query  119  PLKVCLTPRLPATVF  75
            PL+V  TPRLPA ++
Sbjct  502  PLEVLFTPRLPAQLY  516



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR + + G+   DFMDVML I ED   + GFDADT IKA C+ +L AG+D   VTLTWAL
Sbjct  293  KRGIIKSGE-EEDFMDVMLSICED-RDLPGFDADTAIKANCMGLLSAGTDTTIVTLTWAL  350

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
             LLLNN   L K Q+ELD  +G  R V ESDIKNLV+LQA++KE LRLYP GP++    S
Sbjct  351  CLLLNNYEALKKAQDELDAHVGNNRWVQESDIKNLVYLQAIVKEVLRLYPAGPLSVPHES  410

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC +  GY +P GTRL++N+WKI  D +IWP P+EF+PERFL+THKD+DV+G HFEL+
Sbjct  411  MEDCVIG-GYDIPKGTRLLVNLWKIQHDPNIWPNPHEFKPERFLSTHKDVDVKGNHFELM  469

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI L+LQ +   +A LL  FD   PS+E IDMSES GL  +KA+PL+V L
Sbjct  470  PFGSGRRMCPGISLALQVVPFVIAVLLQGFDMKRPSDEAIDMSESFGLTVLKASPLQVLL  529

Query  101  TPRLPATVF  75
             PRL + ++
Sbjct  530  APRLASVLY  538



>ref|XP_008355533.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=534

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 178/238 (75%), Gaps = 1/238 (0%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            RDFMD+ML +++D    + F+AD I KAT L++L+AG D    TLTWALSLLLN+   L 
Sbjct  293  RDFMDLMLSVLDDAKVTNSFEADIINKATSLSLLLAGVDVTTGTLTWALSLLLNSPKTLK  352

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            KVQEE+D  IGR R V ESD+ NLV+LQAVIKETLRLYPPGP     +S EDC L+ GYH
Sbjct  353  KVQEEIDQNIGRERAVKESDVDNLVYLQAVIKETLRLYPPGPTLLPHASNEDCVLA-GYH  411

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PA TR+++N+WKIHRD  +WP+PNEF+PERF TTH DIDV+GQ FELIPFGSGRR C G
Sbjct  412  IPANTRVLVNVWKIHRDPKVWPDPNEFRPERFFTTHSDIDVKGQDFELIPFGSGRRMCAG  471

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L+L+ + + LA+LLH F+ A P+ E +DM ES    N + + L+V LTPRL A V+
Sbjct  472  IALALRIMPLTLASLLHGFEIATPTGEPVDMRESMEFTNXRTSQLEVLLTPRLSAQVY  529



>gb|KHG24650.1| Cytochrome P450 protein [Gossypium arboreum]
Length=509

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 189/239 (79%), Gaps = 2/239 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMD ML I+ED   ++ FDADTI KATCLN+++ GSD   VTLTW LSLLLNN  +L 
Sbjct  270  QDFMDAMLSILED-GNVNDFDADTINKATCLNLVLGGSDTTMVTLTWTLSLLLNNPRVLK  328

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K Q+ELD  +G+ R + ESDI+NLV+LQA++KETLRLYP  PV GLR++LEDC LS GYH
Sbjct  329  KAQDELDMHVGKHRPLEESDIQNLVYLQAIVKETLRLYPSQPVIGLRAALEDCILSTGYH  388

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +P+GTRLM+N WKI RDE +W EP++FQPERFLTT+KD+D +GQ FELIPFG GRRSCPG
Sbjct  389  IPSGTRLMVNAWKIQRDERVWSEPHDFQPERFLTTNKDMDFQGQTFELIPFGLGRRSCPG  448

Query  248  IQLSLQTLHICLATLLHCFDFALPSN-EKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            + L+L+ LH  L +LLH F+   PS  E +DM+ES GL N+KATPL+V +TPRL + ++
Sbjct  449  VSLALKMLHFILGSLLHSFEVGKPSKLEDVDMTESTGLTNLKATPLEVLITPRLESKLY  507



>ref|XP_006486180.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
Length=526

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 192/250 (77%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA C+ ++VA +D   VTLTWA+
Sbjct  278  KRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAAADTTVVTLTWAI  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR +L K Q+ELD Q+G  R VN SD++NLV+LQA+IKET+RLYP  P+     S
Sbjct  338  ALLLNNRDVLKKAQDELDIQVGTKRQVNGSDMRNLVYLQAMIKETMRLYPALPLLLPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLTTHKDIDVRGQ+FELI
Sbjct  398  IEECTVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTTHKDIDVRGQNFELI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS E +DM+E+ GL + KATPL+V L
Sbjct  457  PFGSGRRMCPAVSYGLQVMQLMLASLVHGFDFTTPSGEPVDMAETMGLTSAKATPLEVLL  516

Query  101  TPRLPATVFG  72
            +PRL A+ +G
Sbjct  517  SPRLFASSYG  526



>ref|XP_003528211.2| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=541

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR    E K  +D MDV+L ++E+  +  G DADT IKATCL +++AGSD    TL+WAL
Sbjct  291  KRNSEAEPKSNQDLMDVLLSLVEEGQEFDGQDADTTIKATCLGLILAGSDTTTTTLSWAL  350

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L+K   ELDTQIG  + V  SD+K L +LQ++IKETLRLYP  P+N    S
Sbjct  351  SLLLNNREVLNKAIHELDTQIGSEKIVEISDLKKLEYLQSIIKETLRLYPAAPLNVPHES  410

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            LEDCT+  GYHVP GTRL+ NI K+ RD S++P P EF PERFLTTHKD+D++GQHFELI
Sbjct  411  LEDCTVG-GYHVPTGTRLLTNISKLQRDPSLYPNPLEFWPERFLTTHKDVDIKGQHFELI  469

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR CPG+   LQ + + LATLLH FD      E +DM E  GL N+KA+PL+V L
Sbjct  470  PFGAGRRMCPGLSFGLQVMQLTLATLLHGFDIVTSDGEHVDMLEQIGLTNIKASPLQVIL  529

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  530  TPRLSGHIY  538



>ref|XP_007158552.1| hypothetical protein PHAVU_002G161900g [Phaseolus vulgaris]
 gb|ESW30546.1| hypothetical protein PHAVU_002G161900g [Phaseolus vulgaris]
Length=343

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 177/244 (73%), Gaps = 2/244 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R ++E K  +DF+DV++ +++    + G+D DT+IKATC  ++   +D  AVT+TWAL
Sbjct  90   QKREADESKTEQDFVDVLVSVLKG-VDLGGYDIDTVIKATCTTLIAGATDTTAVTMTWAL  148

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR  L KVQ+ELD  +GR R VNESDI  LV+LQAV+KETLRLYP GP++G R  
Sbjct  149  SLLLNNRHALKKVQDELDEHVGRDRLVNESDINKLVYLQAVVKETLRLYPSGPLSGPREF  208

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             E+CTL+ G+H+ AGTR M+N WK+ RD  IW  P EFQPERFL TH+ +D++GQHFE +
Sbjct  209  TENCTLA-GFHIQAGTRFMLNTWKLQRDPRIWSNPLEFQPERFLNTHRSVDLKGQHFEFL  267

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG GRR CPGI   LQ  H+ LA+ L  F+   PSN ++DMS + GL  +K TPL+V L
Sbjct  268  PFGGGRRLCPGISFGLQMTHLALASFLQAFEITTPSNAQVDMSATFGLTIMKTTPLQVLL  327

Query  101  TPRL  90
            TP L
Sbjct  328  TPAL  331



>ref|XP_007151141.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
 gb|ESW23135.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
Length=529

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 179/243 (74%), Gaps = 2/243 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            E KG  DFMDVM+  + + AQ+ GFDADTI KAT L +++ G+D  AVTLTWALSLLL N
Sbjct  286  EKKGDGDFMDVMISAL-NGAQLEGFDADTICKATSLELILGGTDTAAVTLTWALSLLLRN  344

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
               ++K +EE+D  IG+  +V ESDI  LV+LQAV+KETLRLYPP P++  R  +E+CTL
Sbjct  345  PLAMEKAKEEIDMHIGKDGHVKESDISKLVYLQAVVKETLRLYPPAPLSSPREFIENCTL  404

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GYH+  GTRLM N+WKIHRD S+W +P EF+PERFLTTHK +D+RG+HFEL+PFGSGR
Sbjct  405  G-GYHIKKGTRLMHNLWKIHRDPSVWSDPLEFKPERFLTTHKHVDLRGRHFELLPFGSGR  463

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPA  84
            R C G+ L L  +H  LA +LHCFD + PS E IDM+E  G  N +ATPL+V + PRL  
Sbjct  464  RICAGMSLGLNVIHFSLANMLHCFDISNPSAEPIDMTEFFGFTNTRATPLEVLVKPRLSP  523

Query  83   TVF  75
              +
Sbjct  524  NYY  526



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 186/249 (75%), Gaps = 4/249 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR   E      DFMDVML I+ D  +   +DADTI KATCL +++A +D  AVTLTW L
Sbjct  381  KRASGEFRDEEEDFMDVMLSILTDAKE---YDADTINKATCLILILAATDPTAVTLTWCL  437

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR  L K Q+E+D  IG+ + V E+DIKNLV+LQA+IKETLRL+P GP+     S
Sbjct  438  ALLLNNRDALKKAQQEIDIHIGKDKPVEENDIKNLVYLQAIIKETLRLHPAGPLAVPHES  497

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT++ GYH+PAGT L+IN++KIHRD  +W +P +FQPERFLTTHK+ DVRGQ+FELI
Sbjct  498  MENCTVN-GYHIPAGTELLINLYKIHRDSRVWSDPYKFQPERFLTTHKNFDVRGQNFELI  556

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRR CPG+  +LQ + + LA LLH FD A P +E +DM E+AGL N KATPL+V +
Sbjct  557  PFSSGRRMCPGVSFALQVVQLTLANLLHGFDLATPFDEPVDMREAAGLSNFKATPLEVSI  616

Query  101  TPRLPATVF  75
            +PRLP + +
Sbjct  617  SPRLPNSCY  625



>ref|XP_006473406.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=523

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 187/250 (75%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGAR-DFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            RR  E G     DF+DV+L ++E +   +S FD DT+IKAT + ++V  +D   V LTWA
Sbjct  274  RRKKESGANLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVNLTWA  333

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L+KV++ELD+ +G+ R + ESDI+ LV+LQAVIKETLRLYP GP+ G R 
Sbjct  334  LSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLRLYPAGPLAGARQ  393

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
              EDCT+++ YHVP GTRL++N+WK+  D  +W +P EF+PERFLTTHKD+DV+GQHFEL
Sbjct  394  FTEDCTVAE-YHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTTHKDVDVKGQHFEL  452

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFG GRR+CPGI  +LQ  H+ LA  LH FD + P    +DM+ +AGL N++ATPL++ 
Sbjct  453  LPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATPLEIL  512

Query  104  LTPRLPATVF  75
            L PRLP++++
Sbjct  513  LKPRLPSSLY  522



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 189/253 (75%), Gaps = 5/253 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTLTW  648
            +RR S+     +DF+DVML + E   ++S F  DAD  IK+TCL +++ GSD  A TLTW
Sbjct  277  RRRASKMADSDQDFIDVMLSLQEG-GELSNFQYDADISIKSTCLALILGGSDTTAGTLTW  335

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            A+SLLLNN   L K Q+ELD ++G  R V++SDIKNLV+LQA+IKETLRLYP GP+ G R
Sbjct  336  AISLLLNNSHALKKAQQELDIEVGTNRLVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPR  395

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             +LEDCT+S GYHVPAGTRL++N+WKI RD ++W  P  F+PERFLTTH  +DVRGQ FE
Sbjct  396  EALEDCTVS-GYHVPAGTRLVVNVWKIQRDPTVWSNPEAFEPERFLTTHAHVDVRGQQFE  454

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEK-IDMSESAGLINVKATPLK  111
            LIPFGSGRRSCPG   +LQ LH+ LA LL  F+F+ P + + +DM+E+ GL   KA PL+
Sbjct  455  LIPFGSGRRSCPGASFALQVLHLTLARLLQAFEFSNPLDGRPVDMTENPGLTIPKAHPLE  514

Query  110  VCLTPRLPATVFG  72
            V L+PRLP  ++G
Sbjct  515  VLLSPRLPRELYG  527



>gb|AJZ68877.1| gossypol pathway P450 hydroxylase [Gossypium hirsutum]
 gb|AJZ68878.1| gossypol pathway P450 hydroxylase [Gossypium hirsutum]
Length=522

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               +L K QEELDT IGR R VNE DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHVLKKAQEELDTHIGRDRFVNEPDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKDIDV+GQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDIDVKGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PSN  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTDGLTNIKSTPLQALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_010686308.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=515

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 185/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQIS-GFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R  S+E +  RDFMDVML + E        FD+DTIIKATC+ M++A +D  AVTLTWA
Sbjct  261  ERTNSKEREEKRDFMDVMLSVFETGQDTPFKFDSDTIIKATCMAMILAATDTTAVTLTWA  320

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ +  K Q ELDT +G+ R V ESD+KNLV+LQAV+KET+RLYP GP++G R 
Sbjct  321  LSLLLNNKDVFKKTQAELDTVVGKERQVEESDLKNLVYLQAVLKETMRLYPAGPLSGPRE  380

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ DCT++ GYH+P GT+L +N+ KIHRD  +W +P EF PERFL+T+K  DVRGQ FE 
Sbjct  381  AIVDCTVN-GYHIPPGTQLFVNLHKIHRDPEVWEDPLEFHPERFLSTYKQYDVRGQQFEY  439

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFG+GRR CPGI  +L  +   LA+LLH FD ++PS+  +DM+E  GL N+KATPL+V 
Sbjct  440  MPFGNGRRICPGISFALLAMQFTLASLLHGFDISIPSDGTVDMTEGFGLTNLKATPLEVI  499

Query  104  LTPRLPATVF  75
             T RLP  ++
Sbjct  500  ATHRLPHNLY  509



>gb|KHG29695.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               IL K QEELDT IG+ R VNE+DI  LV++QA++KETLRLYPP P++  R   E C+
Sbjct  339  KPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRLYPPAPLSAPRELSETCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKD+DVRG HFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDVDVRGLHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L + ++  LH FDF+ PSN  ID++ +AGL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLTNIKSTPLEALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>ref|XP_008245476.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=522

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 181/249 (73%), Gaps = 4/249 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K++++EE    +DFMDVML  + +   ++GFDADT+IKATCL ++  GSD   VTLTWAL
Sbjct  277  KQKITEEKD--QDFMDVMLSAI-NGTDVAGFDADTVIKATCLILIAGGSDTTMVTLTWAL  333

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L KV EELD  +G+GR + ESDI NLV+LQA +KE +RL P GP++G R  
Sbjct  334  SLLLNNRQVLKKVYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGPLSGQREF  393

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+  GYHVP GT L++N+WKI  D  +W +P EF+PERFLTTHKD+DVRGQ FEL+
Sbjct  394  TEDCTIG-GYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELM  452

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR+CPGI   LQ   + LA+ LH FD A   N  +DM+ S GL N+K TPL V +
Sbjct  453  PFGSGRRACPGISFGLQMTLLTLASFLHSFDVATQENAPVDMTGSIGLTNIKLTPLDVLI  512

Query  101  TPRLPATVF  75
             PRL   ++
Sbjct  513  KPRLSPNLY  521



>gb|AJD25201.1| cytochrome P450 CYP82D71 [Salvia miltiorrhiza]
Length=516

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++  S E K A+DFMDVML +++ +   S +D DTIIKATC  ++  G+D  +V   WA+
Sbjct  266  RKEYSGEDK-AQDFMDVMLSVVKGEDFGSEYDVDTIIKATCGTLIAGGTDTTSVVFIWAI  324

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNNR +L+K QEELD  +G+ R V ESDI NLV+LQA++KETLRLYPPGP+ G R  
Sbjct  325  ALLLNNRRVLEKAQEELDKHVGKERRVEESDIANLVYLQAIVKETLRLYPPGPLGGARRV  384

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             +DC++  GY++P GT L++N+WK+HRD  +W +P+EF+PERFL    + DV+GQ FELI
Sbjct  385  TQDCSIG-GYNIPKGTWLIVNLWKLHRDPRVWQDPSEFRPERFLNGESNADVKGQDFELI  443

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR CPGI   +Q LH+ LA+LL  FD    S+E +DMSESAGL N+KATPL V +
Sbjct  444  PFGAGRRICPGINFGVQMLHLVLASLLQAFDLNTVSDEGVDMSESAGLTNIKATPLDVVI  503

Query  101  TPRLPATVF  75
             PRLP  ++
Sbjct  504  APRLPPNLY  512



>gb|KCW68808.1| hypothetical protein EUGRSUZ_F02407 [Eucalyptus grandis]
Length=562

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 190/248 (77%), Gaps = 1/248 (0%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R  +     +DFMDVML  ++   ++ G+DADT IKATC+ +++AGSD  +V+LTWALS
Sbjct  315  KRRGDNKDSDQDFMDVMLSTVDAAEELPGYDADTFIKATCMALVLAGSDTTSVSLTWALS  374

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+R +L K Q ELDTQIGR R VNESD++NLV++QA+IKET+RLYP  P+     S 
Sbjct  375  LLLNHREVLKKAQHELDTQIGRERLVNESDLENLVYIQAIIKETMRLYPAAPLGVPHEST  434

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT+  GYH+P GTRL+ N  KIHRD+ IW +P EF+PERFLTTH++ DVRGQ+FEL+P
Sbjct  435  EDCTVD-GYHIPKGTRLLFNFSKIHRDQHIWSDPQEFRPERFLTTHRNFDVRGQNFELLP  493

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI L++Q + + LA LLH FD    ++E++DM+E+ G+ N+KATPL+V +T
Sbjct  494  FGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEQVDMAEAIGMTNLKATPLEVLVT  553

Query  98   PRLPATVF  75
            PRLP   +
Sbjct  554  PRLPEHTY  561



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            D MDVML I ED   + GFDADTIIKATCL +  AG+D   VTLTW LSL+LNN  IL K
Sbjct  284  DLMDVMLSICED-RDLPGFDADTIIKATCLALQSAGTDTTIVTLTWTLSLILNNYQILKK  342

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             Q+ELD  +G+ R V ESDIKNLV+LQA++KE LRLYP  P+      +EDC +S GY +
Sbjct  343  AQDELDAHVGKHRWVQESDIKNLVYLQAIVKEALRLYPAAPLLLPHECIEDCDIS-GYDI  401

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            P GTRL++NIWKIH D  +WP P EF+PERFLTTHKD+DVRG HFELIPFGSGRR CPGI
Sbjct  402  PKGTRLLVNIWKIHYDPDLWPNPEEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGI  461

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
             + LQ +   LA LL  F+   PS+E IDMSES GL  +KA+PL++ L PRL   ++
Sbjct  462  SMGLQVVQYVLAVLLQGFEIKRPSDEPIDMSESFGLTILKASPLEILLAPRLAPNLY  518



>gb|KHG01290.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  280  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLIWGLSLMLN  338

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
               +L K QEELDT IGR R VNE+DI  LV++QA++KETLR+YPP P++  R   E C+
Sbjct  339  KPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLSAPRELSESCS  398

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY +P GTRL+IN+ KI RD   WPEP+EF+PERFLTTHKDIDV+GQHFEL+PFGSG
Sbjct  399  IG-GYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKDIDVKGQHFELMPFGSG  457

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF+ PS+  ID++ + GL N+K+TPL+  ++PRL 
Sbjct  458  RRSCPGTSFALHMLYLTMSNFLHAFDFSTPSDGLIDLTGTDGLTNIKSTPLEALVSPRLA  517

Query  86   ATVF  75
              ++
Sbjct  518  PELY  521



>emb|CBI32515.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 187/250 (75%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            R  + + +  +DF+  ML ++ DD Q SG D DTIIK TC N+++AG ++  +TLTWALS
Sbjct  23   RLSANDNRAEQDFIHAMLSVI-DDGQFSGRDPDTIIKGTCSNLILAGYESTFITLTWALS  81

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLNNR  L   QEEL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    ++
Sbjct  82   LLLNNRHALKNAQEELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAI  141

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            E+CT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL+P
Sbjct  142  ENCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLP  200

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGR+ CPGI  +L+  H+ LA LLH F+    ++ ++DM+ES GL  +KATPL+V + 
Sbjct  201  FGSGRKVCPGISFALELTHLTLARLLHGFELGAVADSRVDMTESPGLTALKATPLEVTIV  260

Query  98   PRLPATVFGH  69
            PRLP  ++ +
Sbjct  261  PRLPFELYSY  270



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 186/251 (74%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S+E K    DFM VML I+ D  Q SG D DTI KATCL +++A +D   +TLTW 
Sbjct  276  RKRDSQEIKEEDLDFMSVMLSILGDTKQYSGRDVDTINKATCLGLVLAATDNTKMTLTWV  335

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R IL+K Q ELD  +G  R VNESDIKNLV+LQA++KE +RLYP  P+     
Sbjct  336  ISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHK  395

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+CT+S GY+VP  T+L+IN+WK+ RD  +W EP +FQPERFLT HKDIDVRGQ+FEL
Sbjct  396  SIEECTIS-GYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFEL  454

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR+CPG+  +LQ +   LA+LLH FDFA PSNE +DM E  GL   KA PL+V 
Sbjct  455  LPFGSGRRTCPGVSFALQVMEFTLASLLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVL  514

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  515  IAPRLSASLYG  525



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 180/236 (76%), Gaps = 3/236 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVM  I+  DA     DA+TI KA CLN+++ G D   VTLTWALSLLLNNR  L 
Sbjct  289  QDFMDVMFSILSTDA--GKHDAETINKANCLNLILGGFDTTTVTLTWALSLLLNNRDALK  346

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K QEELD  +GR + V ESD+K L++LQA++KETLRLYP GP++    S EDCT+S GYH
Sbjct  347  KAQEELDIHVGRDKLVEESDVKKLIYLQAIVKETLRLYPAGPLSVPHESTEDCTVS-GYH  405

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PAGTRL+IN++KIHRD  +W +P EFQPERFLTT+KD DVRGQ+FELIPFGSGRR CPG
Sbjct  406  IPAGTRLLINLYKIHRDPRVWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPG  465

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPAT  81
            +  +LQ L + LA LL  F+   P +E +DMSE+ G+ N+KA+PL+V +TPRLPA 
Sbjct  466  VSFALQVLELTLANLLQGFELGTPLDELVDMSEAIGMTNLKASPLEVLITPRLPAA  521



>gb|KDO84377.1| hypothetical protein CISIN_1g009899mg [Citrus sinensis]
Length=523

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 186/250 (74%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGAR-DFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            RR  E G     DF+DV+L ++E +   +S FD DT+IKAT + ++V  +D   V LTWA
Sbjct  274  RRKKESGANLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVNLTWA  333

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L+KV++ELD+ +G+ R + ESDI+ LV+LQAVIKETLRLYP GP+ G R 
Sbjct  334  LSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLRLYPAGPLAGARQ  393

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
              EDCT+++ YHVP GTRL++N+WK+  D  +W +P EF+PERFLT HKD+DV+GQHFEL
Sbjct  394  FTEDCTVAE-YHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTAHKDVDVKGQHFEL  452

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFG GRR+CPGI  +LQ  H+ LA  LH FD + P    +DM+ +AGL N++ATPL++ 
Sbjct  453  LPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATPLEIL  512

Query  104  LTPRLPATVF  75
            L PRLP++++
Sbjct  513  LKPRLPSSLY  522



>ref|XP_009364169.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=528

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 173/243 (71%), Gaps = 2/243 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            EG   +DFM VML ++ D A +SGFD DT+IKATCL ++  GSD   VTL W LSLLLNN
Sbjct  286  EGHDQQDFMGVMLSVL-DGAHVSGFDTDTVIKATCLALIAGGSDTTTVTLIWTLSLLLNN  344

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
            R  L KV EELD  +G+ R VNESDI NLV+LQA +KE +RL P GP++G R   ED T+
Sbjct  345  RHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGPLSGQREFTEDGTV  404

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GYHVP GT L++N+WKI  D  +W +P EF+PERFLTTHKDIDVRGQHFEL+PFGSGR
Sbjct  405  G-GYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRGQHFELMPFGSGR  463

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPA  84
            R+CPGI   LQ   + LA  LH FD +   N  +DM+ S GL N+K TPL V + PRL +
Sbjct  464  RACPGITFGLQATLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLTPLDVLVKPRLSS  523

Query  83   TVF  75
             +F
Sbjct  524  QIF  526



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D  +    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  273  KRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASDTTAVTLTWA  332

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L+K Q ELD  +G  R VNESD+ NL  LQ V+KETLRLYP  P+     
Sbjct  333  IALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAPLLLPHE  392

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDCT+S GYHVPAGT+L++N WKI RD  +W EP +F PERFLT +KD+D++GQ+FE 
Sbjct  393  SIEDCTIS-GYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKGQNFEF  451

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  452  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKATPLEVL  511

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  512  LTPRLSASLY  521



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 185/251 (74%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGAR-DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            ++R S+E K    DFM VML I+ D  Q SG D DTI KATCL +++A +D   +TLTW 
Sbjct  276  RKRDSQEIKEEELDFMSVMLSILGDTKQYSGRDVDTINKATCLGLVLAATDNTKMTLTWV  335

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            +SLLLN+R IL+K Q ELD  +G  R VNESDIKNLV+LQA++KE +RLYP  P+     
Sbjct  336  ISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHK  395

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+E+CT+S GY+VP  T+L+IN+WK+ RD  +W EP +FQPERFLT HKDIDVRGQ+FEL
Sbjct  396  SIEECTIS-GYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFEL  454

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPG+  +LQ +   LA+LLH FDFA PSNE +DM E  GL   KA PL+V 
Sbjct  455  LPFGSGRRICPGVSFALQVMEFTLASLLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVL  514

Query  104  LTPRLPATVFG  72
            + PRL A+++G
Sbjct  515  IAPRLSASLYG  525



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 181/249 (73%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K+R      G  DFMD ML  ++  A + G++ADT+ KATCLNM++ GSD   VTL WA+
Sbjct  276  KQRRRAGDTGEHDFMDAMLTELQG-ADLGGYEADTVNKATCLNMILGGSDTTMVTLIWAI  334

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L + Q+ELD ++GR R V ESD   LV++QA++KETLRLYP  P++     
Sbjct  335  SLLLNNRHVLKQAQDELDAEVGRERFVTESDTGKLVYIQAIVKETLRLYPAVPLSAQHEF  394

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             ED T++ GYHV  GTRL+ N+WKI  +  +WP+P EF+PERFLTTHK+IDVRG HFELI
Sbjct  395  TEDSTVN-GYHVQKGTRLITNLWKIQTNPQMWPDPLEFKPERFLTTHKNIDVRGHHFELI  453

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPGI  +LQ +   LA+ LH F+ + PSNE +DMSES GL NVKATPL V +
Sbjct  454  PFGSGRRSCPGISFALQMVSFALASFLHAFEVSTPSNELVDMSESFGLTNVKATPLNVLI  513

Query  101  TPRLPATVF  75
             PRL + ++
Sbjct  514  KPRLCSKLY  522



>emb|CBI19610.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+   E  G  DFMDV+L +++  A +  +DADTI KAT + ++  G+D + VTLTWAL
Sbjct  686  RRKDWGEDNGMHDFMDVLLSVLDGKA-LPEYDADTINKATSMALISGGTDTMTVTLTWAL  744

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SL+LNNR  L K +EELDT +G+ R VN SDI  LV+LQA++KETLRL PPGP++G R  
Sbjct  745  SLILNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGPLSGPRQF  804

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC +  GYHVP GTRL++N+ K+HRD S+W +P EFQPERFLTTH+D+D RGQHF+L+
Sbjct  805  TEDCIIG-GYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPERFLTTHRDVDARGQHFQLL  863

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRRSCPGI  +LQ LH+ LA+ LH F+ + PSN  +DMSE  GL N+K+TPL++ +
Sbjct  864  PFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKSTPLEILI  923

Query  101  TPRLPATVF  75
             PRLP   +
Sbjct  924  APRLPYNSY  932


 Score =   231 bits (589),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 151/244 (62%), Gaps = 36/244 (15%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+ S E    +DFMDVML ++ D   +  +DADT+ KATCL ++V GSD   VTLTWAL
Sbjct  77   RRKDSGEVNSTQDFMDVMLSVL-DSKNLGDYDADTVNKATCLALIVGGSDTTVVTLTWAL  135

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR  L K QEELD Q+G+ R VNE DI  LV+LQA++KETLRLYPP  + G R  
Sbjct  136  SLLLNNRDTLKKAQEELDIQVGKERLVNEQDISKLVYLQAIVKETLRLYPPAALGGPRQF  195

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTL  GYHV  GTRL++N+ KI +D  IW                            
Sbjct  196  TEDCTLG-GYHVSKGTRLILNLSKIQKDPRIW----------------------------  226

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
                   +CPGI  +LQ LH+ LA  L  FDF+ PSN ++DM ES GL N+K+TPL+V +
Sbjct  227  ------MTCPGIAFALQMLHLTLANFLQAFDFSTPSNAQVDMCESLGLTNMKSTPLEVLI  280

Query  101  TPRL  90
            +PR+
Sbjct  281  SPRM  284



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 185/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R S + KG  DFM V+L +++D+A Q+   DAD +IKA C+ ++VA +D   VTLTWA+
Sbjct  280  KRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAADTSVVTLTWAI  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LL+NNR +L K Q+ELD Q+G  R VNESD +NLV+LQA+IKET+RLYP  P+      
Sbjct  340  ALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAPLLLPHEC  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+C ++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLT HKDIDV GQ FELI
Sbjct  400  IEECIVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQDFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS+E +DM E+ GL   KATPL+V +
Sbjct  459  PFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKATPLEVLV  518

Query  101  TPRLPATVFG  72
            +PRL A+++G
Sbjct  519  SPRLSASLYG  528



>ref|XP_008343753.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 177/248 (71%), Gaps = 2/248 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            ++   +G+  +DFM VML ++ D A +SGFD DT+IKATCL++++ GSD   VTL W LS
Sbjct  281  KQRRAKGQDQQDFMGVMLSVL-DGAHVSGFDTDTVIKATCLSLILGGSDTTMVTLIWTLS  339

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLNNR  L KV EELD  +G+ R VNESDI NLV+LQA +KE +RL P GP++G R   
Sbjct  340  LLLNNRHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGPISGQREFT  399

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            ED T+  GYHVP GT L++N+WKI  D  +W +P EF+PERFLTTHKDIDVRGQHFEL+P
Sbjct  400  EDGTVG-GYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRGQHFELMP  458

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR+CPGI   LQ   + LA  LH FD +   N  +DM+ S GL N+K TPL V + 
Sbjct  459  FGSGRRACPGITFGLQVTLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLTPLDVLVK  518

Query  98   PRLPATVF  75
            PRL   +F
Sbjct  519  PRLTPQIF  526



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 180/244 (74%), Gaps = 7/244 (3%)
 Frame = -1

Query  785  DFMDVMLEIMED--DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSIL  612
            +FM  ML I++D    +  G DADTI KATCL +++ GSD  + TLTWA+SLLLNNR  L
Sbjct  284  NFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSDTTSGTLTWAISLLLNNRHAL  343

Query  611  DKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGY  432
             +  EELD Q+G+ R V+ESD +NLV+LQA+IKETLRLYP GP+   R ++EDCT+S GY
Sbjct  344  KRAHEELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVS-GY  402

Query  431  HVPAGTRLMINIWKIHRDESIWPEPNEFQPERFL---TTHKDIDVRGQHFELIPFGSGRR  261
            HVPAGTRLMIN WKI RD  +W  P+ FQPERFL     H D+DVRGQ FELIPFGSGRR
Sbjct  403  HVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRR  462

Query  260  SCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPR-LPA  84
            SCPG   +LQ LH+ LA LLH F+ A P ++ +DMSES GL   KATPLKV L+PR LPA
Sbjct  463  SCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRLLPA  522

Query  83   TVFG  72
              +G
Sbjct  523  NPYG  526



>ref|XP_008355522.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=539

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 177/238 (74%), Gaps = 1/238 (0%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            RDFMD+ML +++D    + F+AD I KAT L++L+AG D    TLTWALSLLLN+   L 
Sbjct  298  RDFMDLMLSVLDDAKVTNSFEADIINKATSLSLLLAGVDVTTGTLTWALSLLLNSPKTLK  357

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            KVQEE+D  IGR R V ESD+ NLV+LQAVIKETLRLYPPGP     +S EDC L+ GYH
Sbjct  358  KVQEEIDQNIGRERAVKESDVDNLVYLQAVIKETLRLYPPGPTLLPHASNEDCVLA-GYH  416

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PA TR+++N+WKIHRD  +WP+PNEF+PERF TTH  ID++GQ FELIPFGSGRR C G
Sbjct  417  IPANTRVLVNVWKIHRDPKVWPDPNEFRPERFFTTHSYIDIKGQDFELIPFGSGRRMCAG  476

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L+L+ + + LA+LLH F+ A P+ E +DM ES    N + + L V LTPRLPA V+
Sbjct  477  IALALRIMPLTLASLLHGFEIATPTGEPVDMRESMEFTNHRTSXLDVLLTPRLPAQVY  534



>ref|XP_010686299.1| PREDICTED: cytochrome P450 CYP82D47-like, partial [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 185/246 (75%), Gaps = 2/246 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMED-DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R  S+E +  RDFMDVML + E    +   FD+DTIIKA  + M++A +D  AVTLTWA
Sbjct  289  ERTSSKEKEEKRDFMDVMLSVFETGQNKPFKFDSDTIIKANSMAMILAATDTTAVTLTWA  348

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ +L+K+Q ELD  +G+ R V ESD+KNLV+LQAV+KET+RLYP  P++  R 
Sbjct  349  LSLLLNNKDVLNKIQAELDNVVGKERQVEESDLKNLVYLQAVLKETMRLYPAAPLSAPRE  408

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ DCT+S GYH+ AGT+L +N++KIHRD  +W  P +F PERFLTT+KD DVRGQ F+ 
Sbjct  409  AITDCTVS-GYHISAGTQLFVNLYKIHRDPEVWENPLDFHPERFLTTNKDYDVRGQSFKY  467

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L  +   LA+LLH FD ++PS+E +DM+ES GL N+KATPL+V 
Sbjct  468  MPFGSGRRICPGISFALLAMQFTLASLLHGFDISMPSDETVDMTESFGLTNLKATPLEVI  527

Query  104  LTPRLP  87
             T RLP
Sbjct  528  ATHRLP  533



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K  + E      DFMDVML  + DD Q+S +DA T+ KATCL++++AGSD   VT+ WAL
Sbjct  275  KNNLGEVKMEEHDFMDVMLSNVRDDGQLSKYDAHTVTKATCLSLILAGSDTTTVTMIWAL  334

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN+ +L + Q ELD ++GR R V ESD+KNL++LQA++KETLRLYP  P+     S
Sbjct  335  SLLLNNQEVLKRAQLELDERVGRQRQVKESDVKNLLYLQAIVKETLRLYPAAPILVPHES  394

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            ++DC ++ GYH+P GTRL++N+ K+ RD  IW +P EF+PERFLT+ KD DVRGQ+  LI
Sbjct  395  VDDCVVA-GYHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSAKDFDVRGQNPRLI  453

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +LQ +H+ LA LLH F+ + PS E +DM ESAG+ +++  PL+V L
Sbjct  454  PFGSGRRMCPGISFALQVMHLALANLLHGFEISRPSKEFLDMEESAGMTSIRKNPLEVVL  513

Query  101  TPRLPATVF  75
            TPRLP  V+
Sbjct  514  TPRLPPHVY  522



>gb|KJB58364.1| hypothetical protein B456_009G206900 [Gossypium raimondii]
Length=523

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 183/244 (75%), Gaps = 2/244 (1%)
 Frame = -1

Query  806  EEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AGSD   VTL W LSL+LN
Sbjct  281  DENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGSDTTTVTLVWCLSLMLN  339

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
            N  IL K QEELDT I + R VNE+DI  LV++QA+IKET R+YPP P++  R   E C+
Sbjct  340  NPRILKKAQEELDTHISKDRFVNETDIGKLVYIQAIIKETFRMYPPAPLSAPRELNESCS  399

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +  GY++P GTRL+IN+ KI RD   WPEP +F+PERFLTTHKD+DV+GQHFEL+PFGSG
Sbjct  400  IG-GYNIPKGTRLIINLHKIQRDPKKWPEPLKFKPERFLTTHKDVDVKGQHFELMPFGSG  458

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RRSCPG   +L  L++ ++  LH FDF++PS   IDM+ + GL N+K+TPL+V ++PRL 
Sbjct  459  RRSCPGTSFALHMLYLTVSNFLHAFDFSIPSYGLIDMTGTVGLTNMKSTPLEVLVSPRLA  518

Query  86   ATVF  75
              V+
Sbjct  519  PEVY  522



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 187/249 (75%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+ S   KG  DFMD+ML +++D  ++S   ADTI KATCL +++A SD  +VTLTW L
Sbjct  278  QRKASGTAKGEEDFMDLMLSVLDDAKELSNRSADTINKATCLALILAASDTTSVTLTWTL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD  +GR R V ESD+KNLV+LQA+ KE+ RLYP  P++G   S
Sbjct  338  SLLLNNREVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIFKESFRLYPAAPLSGPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+  GYH+PAGTRL  N+ KIHRD  +W +P+EFQPERFLTTHKD D RGQHFELI
Sbjct  398  MEECTVG-GYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ L++ LATLLH FD     +  IDM+E+ G+ NVKATPLKV L
Sbjct  457  PFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGITNVKATPLKVLL  516

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  517  TPRLSPGLY  525



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 188/250 (75%), Gaps = 4/250 (2%)
 Frame = -1

Query  815  RMSEEGKGAR--DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            RM + G+  R  DFMDV++ I+ED  +IS +D DTIIK+TCL+++  G D   VTLTW L
Sbjct  263  RMRQTGELNREQDFMDVLMSILED-TRISEYDNDTIIKSTCLSIVTGGGDTTMVTLTWIL  321

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN+  L K Q+ELD+ +G+ R V ESDIKNLV+LQA+ KE LRLYP GP++G R +
Sbjct  322  SLLLNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQAITKEALRLYPAGPLSGPRVA  381

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
              DCT++ GYHVPAGTRL++N +KI RD  +W EP+EF+PERFLT+H ++DV+G H+ELI
Sbjct  382  DADCTVA-GYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPERFLTSHVNMDVKGLHYELI  440

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRRSCPG+  +LQ + + LA  LH FD     +  +DM+E+AGL N KATPL+V +
Sbjct  441  PFGAGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVDMTETAGLTNAKATPLEVVI  500

Query  101  TPRLPATVFG  72
            TPRL   ++G
Sbjct  501  TPRLHPEIYG  510



>emb|CDP16080.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDA--QISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            K++  E     RDFMDVML + E  A   + G+DADTI KATC  ++  GSD   V L W
Sbjct  279  KKQSGEATSDHRDFMDVMLSLKEAAAIAAVGGYDADTITKATCTILISGGSDTTLVALIW  338

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
             LSL++NN  +L K QEELD Q+G+GR V+ESDI NLV+LQA+IKE LRLYPP P+ G R
Sbjct  339  TLSLIMNNPQVLKKAQEELDLQVGKGRRVSESDISNLVYLQAIIKEALRLYPPEPLGGAR  398

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIW-PEPNEFQPERFLTTHKDIDVRGQHF  291
               EDC +  GYH+P GTR+++NI KI RD ++W  +P EF+PERFLTTHK ID +G +F
Sbjct  399  ELREDCIVG-GYHIPKGTRVILNIRKIQRDPNVWHDDPLEFRPERFLTTHKHIDAKGYNF  457

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFG GRR CPGI   LQ LH+ L  LLH F+ + PSNE +DM+ESAGL N+KATPL+
Sbjct  458  ELIPFGGGRRICPGINFGLQILHLVLPNLLHAFELSTPSNEPVDMTESAGLSNMKATPLQ  517

Query  110  VCLTPRLPATVF  75
            + + PRLP  ++
Sbjct  518  LLVAPRLPHHLY  529



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 181/250 (72%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQI--SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R S E KG  DFM VML + +D  +    G D DT+IKA CL++++A SD  AVTLTWA
Sbjct  273  KRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASDTTAVTLTWA  332

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            ++LLLNNR +L+K Q ELD  +G  R VNESD+ NL +LQ V+KETLRLYP  P+     
Sbjct  333  IALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAPLLVPHE  392

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +S GYHVPAGT+L++N WKI RD  +W EP  F PERFLT +KD+D++GQ+FE 
Sbjct  393  SIEDCNIS-GYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKGQNFEF  451

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRR CPGI  + Q + + LA+LLH FDFA PS+  +DM E+  L   KATPL+V 
Sbjct  452  IPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVL  511

Query  104  LTPRLPATVF  75
            LTPRL A+++
Sbjct  512  LTPRLSASLY  521



>emb|CBI36493.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 178/247 (72%), Gaps = 2/247 (1%)
 Frame = -1

Query  815  RMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSL  636
            R++ EG   +D +DVML ++ED +   G   +T+IKAT + ++V G+D +A T TW LS 
Sbjct  92   RLNSEGSKRQDLIDVMLSVLEDTSMF-GHSRETVIKATVMTLMVGGTDTVATTSTWLLSA  150

Query  635  LLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLE  456
            LLNN+  L + QEELD ++GRGR V ESDI NL +LQAVIKETLRLY   P++    ++E
Sbjct  151  LLNNKHALKRAQEELDLKVGRGRWVEESDIPNLHYLQAVIKETLRLYTAAPLSVPHEAME  210

Query  455  DCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
            DC ++ GYH+P GTRL +N WK+HRD S+W +P +FQPERFLT+H D+DV GQHFELIPF
Sbjct  211  DCHVA-GYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPF  269

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
            GSGRRSCPGI ++L+ LH+ +  LL  FD + P N  +DM E   +I  K TPL+V LTP
Sbjct  270  GSGRRSCPGITMALKLLHLVIGRLLQGFDLSTPLNAPVDMREGLSIILAKVTPLEVMLTP  329

Query  95   RLPATVF  75
            RLP+  +
Sbjct  330  RLPSQFY  336



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 180/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A +  FDADTI +AT LN++  G D   VTLTWAL
Sbjct  279  QRRAKGDAKGEQDFIDALLSVL-DGADLGSFDADTITRATSLNVIAGGGDTTMVTLTWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP++G R  
Sbjct  338  SLLLNNPHVMKKALNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPVGPLSGPRIF  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTR + N WKI  D   WPEP EF+PERFLTTHKD+D++GQHF+ I
Sbjct  398  TEDCTIA-GYHIRKGTRFIPNFWKIQTDPKNWPEPFEFKPERFLTTHKDVDLKGQHFQFI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKA PL V +
Sbjct  457  PFSSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPIDMTESFGMTNVKAAPLNVLI  516

Query  101  TPRLPATVFG  72
             PRL + ++G
Sbjct  517  KPRLSSELYG  526



>ref|XP_006434891.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
 gb|ESR48131.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
Length=523

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 184/250 (74%), Gaps = 3/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGAR-DFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            RR  E G     DF+DV+L ++E +   +S FD DT+IKAT + ++V  +D   V LTWA
Sbjct  274  RRKKESGTNLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVNLTWA  333

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  LDKV++ELD+ +G+ R + ESDI+ L +LQAVIKETLRLYP GP+ G R 
Sbjct  334  LSLLLNNRRELDKVKKELDSVVGKERLLRESDIEKLGYLQAVIKETLRLYPAGPLAGARQ  393

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
              EDCT+++ Y VP GTRL++N+WK+  D  +W +P EF+PERFLTTHKD+DV+GQHFEL
Sbjct  394  FTEDCTVAE-YQVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTTHKDVDVKGQHFEL  452

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFG GRR+CPGI  +LQ  H+ LA  LH FD + P    +DM+ +AGL N++ATPL++ 
Sbjct  453  LPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATPLEIL  512

Query  104  LTPRLPATVF  75
            L PRLP+ ++
Sbjct  513  LKPRLPSNLY  522



>ref|XP_002313829.2| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
 gb|EEE87784.2| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
Length=407

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 185/248 (75%), Gaps = 5/248 (2%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            R +SEE K   DF+ VML IM DD  IS  +ADT +KA+CL++L+ GSD  A+ LTWAL+
Sbjct  163  RSISEEEK---DFIYVMLSIM-DDGNISVDEADTTVKASCLSLLLGGSDTTAIALTWALA  218

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
             LLNNR++L K Q ELDT +G+ R V E+DIKNLV++QA++KET RL+ P P++G R ++
Sbjct  219  SLLNNRNMLKKAQCELDTHVGKHREVAETDIKNLVYMQAIVKETFRLHQPAPLSGPREAM  278

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT++ G+H+PAGTRL++N+WK+HRD +IW  P EFQPERFL  H ++DVRGQ FE  P
Sbjct  279  EDCTVA-GFHIPAGTRLVVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEFTP  337

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CP +  ++Q +H+ LA LLH F+    S+  +DM+ES GL   KATPL+V L 
Sbjct  338  FGSGRRMCPAVSFAVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLR  397

Query  98   PRLPATVF  75
            PRLP+  +
Sbjct  398  PRLPSIAY  405



>ref|XP_010106083.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07353.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 183/240 (76%), Gaps = 2/240 (1%)
 Frame = -1

Query  809  SEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLL  630
            S E K  +DFMDVML ++ D +++ GFDADTI KAT LN++  GSD  AVTLTWA+SLLL
Sbjct  289  SNEEKKEQDFMDVMLSVLHD-SELGGFDADTINKATILNLIAGGSDTTAVTLTWAVSLLL  347

Query  629  NNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDC  450
            NNR +L K Q+ELD+Q+G+ R VNE D+  L ++QA++KETLRLYP  P++G    L+DC
Sbjct  348  NNRHVLKKAQDELDSQVGKNRAVNEFDMHKLTYIQAIVKETLRLYPAAPLSGPHVFLKDC  407

Query  449  TLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGS  270
            T+  GYH+  GTRL+ N+WKI  D ++WP+P +F+PERFLTT+KD+DVRGQHFELIPFG+
Sbjct  408  TIG-GYHIHKGTRLLTNLWKIQTDPNLWPDPLDFKPERFLTTNKDVDVRGQHFELIPFGT  466

Query  269  GRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
            GRR+CPGI  +LQ +   +A+ L  F+ A P +  +DM+ES GL N++ATPL++ +T  L
Sbjct  467  GRRACPGISFALQMVQFTVASFLQAFEIATPLDASVDMTESFGLTNIRATPLELLITAEL  526



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR + + G+   DFMDVML + ED   + G DADT IKATC+ +L AG+D   VTLTW L
Sbjct  274  KRGIIKSGE-EEDFMDVMLSVCED-RDLPGVDADTAIKATCMALLSAGTDTTMVTLTWIL  331

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L K Q+ELD  +G+ R V ESDIKNLV+ QA++KE LRLYP GP++    S
Sbjct  332  SLLLNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVYFQAIVKEALRLYPAGPLSLPHES  391

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+S GY +P GTRL++NIWKI RD +IWP P+EF+PERFL+THKD+DV+G HFEL+
Sbjct  392  MEDCTIS-GYDIPKGTRLLVNIWKIQRDPNIWPNPHEFKPERFLSTHKDVDVKGNHFELM  450

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI L+LQ L   +A LL  FD     +E IDMSES GL  +KA+PL+V L
Sbjct  451  PFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDEPIDMSESFGLTVLKASPLEVLL  510

Query  101  TPRLPATVF  75
             PRL   ++
Sbjct  511  APRLAPDLY  519



>ref|XP_011005663.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=520

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 183/238 (77%), Gaps = 2/238 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            RDF+ V+L  +ED  +IS  DADT IK TCL++++ G D   VTLTWALSL+LNNR++L+
Sbjct  283  RDFIHVLLSNLED-GKISTVDADTAIKGTCLSLILGGHDTTFVTLTWALSLILNNRNVLE  341

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K Q+ELD Q+G+ R V+E+DIK+LV+LQA++KET+RLYP  P++  R ++EDCT++ G+H
Sbjct  342  KAQDELDIQVGKHRQVDETDIKSLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVA-GFH  400

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PAGTRL++N+WK+HRD +IW  P EFQPERFL  H ++DVRGQ FE +PFGSGRR CPG
Sbjct  401  IPAGTRLLVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPG  460

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L+LQ LH+ LA LLH F+    S+  IDMSE  G+   K TPL+V L PRL + ++
Sbjct  461  ISLALQVLHLSLARLLHGFEMGTVSDALIDMSEGPGITITKETPLEVILRPRLHSNLY  518



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 186/251 (74%), Gaps = 4/251 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDAD--TIIKATCLNMLVAGSDAIAVTLTW  648
            KR         +DF+  ML ++ DDAQ+SG D D  T+IKATCL +++AG+D IAVTLTW
Sbjct  267  KRLSGSINDAEQDFIHAMLSVI-DDAQLSGHDHDHDTVIKATCLTVMLAGNDTIAVTLTW  325

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+    
Sbjct  326  ALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPH  385

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             ++EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DV GQHFE
Sbjct  386  EAMEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVGGQHFE  444

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFGSGRR CPGI L+L+ L + LA LLH F+  + S+  +DM+E  GL   KATPL+V
Sbjct  445  LLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPLEV  504

Query  107  CLTPRLPATVF  75
             L PRLP+ ++
Sbjct  505  TLVPRLPSELY  515



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 187/251 (75%), Gaps = 4/251 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDAD--TIIKATCLNMLVAGSDAIAVTLTW  648
            KR      +  +DF+  ML ++ DDAQ+S  D D  T+IKATCL +++AG+D IA+TLTW
Sbjct  267  KRLSGSINEAEQDFIHAMLSVI-DDAQLSAHDHDHDTVIKATCLTVMLAGNDTIAITLTW  325

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+    
Sbjct  326  ALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPH  385

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             ++EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DVRGQHFE
Sbjct  386  EAMEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFE  444

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFGSGRR CPGI L+L+ L + LA LLH F+  + ++  +DM+E  GL   KATPL+V
Sbjct  445  LLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEV  504

Query  107  CLTPRLPATVF  75
             L PRLP+ ++
Sbjct  505  TLVPRLPSELY  515



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 179/249 (72%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++  S EGK A+DFMDVML  ++       +D DTIIKATC  ++  G+D  AV   WAL
Sbjct  269  RKEYSGEGK-AQDFMDVMLSEVKGANFECEYDVDTIIKATCGTLIAGGTDTTAVVFIWAL  327

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNN  +L K Q ELDT +G+ R VNESD+ NLV+LQA+ KETLRLYPPGP+ G R  
Sbjct  328  ALLLNNPHVLQKAQHELDTHVGKQRRVNESDLNNLVYLQAITKETLRLYPPGPLGGTRRL  387

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             +DC +  GYH+P  T L++N+WK+HRD  +W +P+EF+PERFL   K +DV+GQ FELI
Sbjct  388  TQDCHVG-GYHIPKETWLIVNLWKLHRDPRVWSDPSEFRPERFLNGEKSMDVKGQDFELI  446

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF +GRR CPG    LQ LH+ LA+LL  FD +  SNE+IDMSESAGL N+KATPL V +
Sbjct  447  PFSAGRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLI  506

Query  101  TPRLPATVF  75
             PRLP +++
Sbjct  507  APRLPPSLY  515



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 186/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+S E KG  DF+ V+L +++D+A Q+   DADT+IKA CL+++VAG+    VTLTWA+
Sbjct  280  KRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLSLIVAGTQTTVVTLTWAI  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LLLNN  +L K ++E+D Q+G  R VNESD +NLV+LQA+IKET+RLYP GP+     S
Sbjct  340  ALLLNNPEVLKKARDEIDIQVGTERPVNESDTRNLVYLQAIIKETMRLYPAGPLLLPHES  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+C ++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLT HKDIDV GQ FELI
Sbjct  400  IEECIVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQDFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+  FDF  PS E +DM ES GL   KATPL+V L
Sbjct  459  PFGSGRRMCPAVSYGLQVMPLMLASLVRGFDFTTPSGEPVDMGESMGLSIAKATPLEVLL  518

Query  101  TPRLPATVFG  72
            +PRL A+ +G
Sbjct  519  SPRLSASSYG  528



>ref|XP_007226806.1| hypothetical protein PRUPE_ppa017795mg, partial [Prunus persica]
 gb|EMJ28005.1| hypothetical protein PRUPE_ppa017795mg, partial [Prunus persica]
Length=440

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 176/238 (74%), Gaps = 2/238 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVML  + D A I+GFDADTIIKATCL M+  GSD   V LTW LSLLLNNR IL 
Sbjct  204  QDFMDVMLSAI-DGADIAGFDADTIIKATCLAMISGGSDTTRVALTWTLSLLLNNRQILK  262

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            KV EELD  +G+GR +NESDI NLV+LQA +KE +RL PPGP++  R   EDCT+  GYH
Sbjct  263  KVYEELDQHVGKGRQLNESDINNLVYLQATVKEAMRLCPPGPLSFQREFTEDCTVG-GYH  321

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            VP GT L++N+WKI  D  +W +P EF+PERFLTTHKD+DVRGQ FEL+PFGSGRR+CPG
Sbjct  322  VPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPG  381

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L LQT  + LA+ LH FD     N  +DM+ SAGL N+K +PL V + PRL   ++
Sbjct  382  INLGLQTTLLTLASFLHWFDVTTRGNAPVDMTGSAGLTNMKLSPLDVLVKPRLSPNLY  439



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 187/249 (75%), Gaps = 5/249 (2%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            +R + E     DFM VML I+ D  +    DADT+ KAT L +++A  D  + T+TWALS
Sbjct  277  KRAANEANSEEDFMGVMLSILRDAEE---HDADTVNKATSLALILAAEDTTSTTMTWALS  333

Query  638  LLLNNRSILDKVQEELDTQIGRGRN-VNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            LLLNNR+ L KVQ+ELDTQ+G  R  V ESD KNLV+LQ+V+KETLRLYP  P++ +  +
Sbjct  334  LLLNNRNRLKKVQQELDTQVGMDRLLVTESDTKNLVYLQSVVKETLRLYPAAPLSVIHEA  393

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT++  YHV AGT L++N+ KIHRD  +W +P EF+PERFLTTHKD+DVRGQ+FELI
Sbjct  394  IEDCTVND-YHVSAGTWLILNLHKIHRDPGVWSDPCEFRPERFLTTHKDVDVRGQNFELI  452

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ LH+ LA +LH FDFA P +E + M E AGL + +ATPL+V +
Sbjct  453  PFGSGRRMCPGVSFALQILHLTLANVLHWFDFATPLDEPVAMREGAGLTSPRATPLEVHI  512

Query  101  TPRLPATVF  75
            TPRLPA+++
Sbjct  513  TPRLPASLY  521



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = -1

Query  809  SEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLL  630
            ++E K   DFMDVML ++   +   GFDADTIIKAT LNM+  GSD I  TLTWA+SLLL
Sbjct  291  NDEKKEQDDFMDVMLSVLHG-SDFGGFDADTIIKATILNMIAGGSDTIPATLTWAVSLLL  349

Query  629  NNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDC  450
            NN  +L K QEEL+  +G+ R V+ESDI  L ++ A++KETLRLYP  P++     L+DC
Sbjct  350  NNHHVLKKAQEELENNVGKNRVVSESDIGKLTYIFAIVKETLRLYPVAPLSVPHVFLKDC  409

Query  449  TLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGS  270
            T+  GYHV  GTRL+ NIWKI  +  +WP+P EF+PERFLTT+KD+D+RGQHFELIPFGS
Sbjct  410  TIG-GYHVAKGTRLITNIWKIQTNPILWPDPFEFKPERFLTTNKDVDIRGQHFELIPFGS  468

Query  269  GRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
            GRR+CPG   +LQ +   LA+ L  FD + P N  +DM+ES GL N KATPL+V +TPRL
Sbjct  469  GRRACPGTSFALQMVQFTLASFLQAFDISTPLNAPVDMTESFGLTNTKATPLEVLITPRL  528

Query  89   PATVFG  72
            PA ++ 
Sbjct  529  PAELYA  534



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/251 (54%), Positives = 187/251 (75%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R  +   +   DF+ VML ++ DD Q SG D DT+IKATCLN+++AG D  ++TLTWAL
Sbjct  276  QRLSANNNRAEVDFLHVMLSVI-DDGQFSGRDPDTVIKATCLNLILAGYDTTSITLTWAL  334

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR  L K Q EL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    +
Sbjct  335  SLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSVPHEA  394

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL+
Sbjct  395  MEDCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVRGKNYELL  453

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +L+  H+ LA LLH F+  + ++  +DM+E  GL   KATPL+V +
Sbjct  454  PFGSGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPLEVTI  513

Query  101  TPRLPATVFGH  69
             PRLP  ++ +
Sbjct  514  VPRLPFELYSY  524



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 181/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR     KG +DF+D ML ++ D A +  FDADTI+KAT LN++  G D   VTLTWA+
Sbjct  284  QRRAKGNAKGEQDFIDAMLSVL-DGADLGSFDADTIVKATSLNVIAGGGDTTMVTLTWAI  342

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IGR R V+E D+ NLV++QA++KETLRLYP GP++G R  
Sbjct  343  SLLLNNPHVMKKALNELDTKIGRQRVVSEEDLSNLVYIQAIVKETLRLYPVGPLSGPRVF  402

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC ++ GY +  GTR + N+WKI  D   WPEP +F+PERFLTTHKD+D++GQHF+ I
Sbjct  403  NEDCIIA-GYPIRKGTRFLPNLWKIQIDPKFWPEPLKFKPERFLTTHKDVDLKGQHFQFI  461

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPG+   LQ +   LA+ LH F+ + PS+  +DM+ES G+ NVKATPL V +
Sbjct  462  PFGSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPVDMTESFGMTNVKATPLNVLI  521

Query  101  TPRLPATVFG  72
             PRL + ++G
Sbjct  522  KPRLSSELYG  531



>ref|XP_008378401.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 176/248 (71%), Gaps = 2/248 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            ++   +G+  +DFM VML ++ D A +SGFD DT+IKATCL++++ GSD   VTL W LS
Sbjct  281  KQRRAKGQDQQDFMGVMLSVL-DGAHVSGFDTDTVIKATCLSLILGGSDTTMVTLIWTLS  339

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLNNR  L KV EELD  +G+ R VNESDI NLV+LQA +KE +RL P GP++G R   
Sbjct  340  LLLNNRHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGPISGQREFT  399

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            ED T+  GYHVP GT L++N+WKI  D  +W +P EF+PERFLTTHKDIDVRGQHFEL+P
Sbjct  400  EDGTVG-GYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRGQHFELMP  458

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR+CPGI   LQ   + LA  LH FD +   N  +DM+ S GL N+K  PL V + 
Sbjct  459  FGSGRRACPGITFGLQVTLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLXPLDVLVK  518

Query  98   PRLPATVF  75
            PRL   +F
Sbjct  519  PRLTPQIF  526



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 181/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR     KG +DF+D ML ++ D A +  FDADTI+KAT LN++  G D   VTLTWA+
Sbjct  284  QRRAKGNAKGEQDFIDAMLSVL-DGADLGSFDADTIVKATSLNVIAGGGDTTMVTLTWAI  342

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IGR R V+E D+ NLV++QA++KETLRLYP GP++G R  
Sbjct  343  SLLLNNPHVMKKALNELDTKIGRQRVVSEEDLSNLVYIQAIVKETLRLYPVGPLSGPRVF  402

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC ++ GY +  GTR + N+WKI  D   WPEP +F+PERFLTTHKD+D++GQHF+ I
Sbjct  403  NEDCIIA-GYPIRKGTRFLPNLWKIQIDPKFWPEPLKFKPERFLTTHKDVDLKGQHFQFI  461

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRRSCPG+   LQ +   LA+ LH F+ + PS+  +DM+ES G+ NVKATPL V +
Sbjct  462  PFGSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPVDMTESFGMTNVKATPLNVLI  521

Query  101  TPRLPATVFG  72
             PRL + ++G
Sbjct  522  KPRLSSELYG  531



>ref|XP_011030947.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 187/249 (75%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+ S   KG  DFMD+ML +++D  ++S   ADTI KATCL +++A +D  +VTLTW L
Sbjct  278  QRKASGTAKGEEDFMDLMLSVLDDAKELSNRSADTINKATCLTLILAAADTTSVTLTWTL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD  +GR R V ESD+KNLV+LQA+IKET RLYP  P++    S
Sbjct  338  SLLLNNRDVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSLPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+  GYH+PAGTRL  N+ KIHRD  +W +P+EFQPERFLTTHKD D RGQHFELI
Sbjct  398  MEECTVG-GYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ L++ LATLLH FD     +  IDM+E+ G+ NVKATPLKV L
Sbjct  457  PFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGITNVKATPLKVLL  516

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  517  TPRLSPGLY  525



>ref|XP_012071743.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
 gb|KDP38429.1| hypothetical protein JCGZ_04354 [Jatropha curcas]
Length=498

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = -1

Query  797  KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRS  618
            K   DFM  +L I++D  ++S  DADTI KATCL +++A SD  A+TLTW LSLLLNNR 
Sbjct  259  KEEEDFMSALLSILDDAKELSSRDADTINKATCLTLILAASDTTAITLTWTLSLLLNNRD  318

Query  617  ILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQ  438
            +L K QEELD  +G+ R V ESD+ NLVFLQA+IKE+LRLYP  P++    S+EDCT+  
Sbjct  319  VLKKAQEELDIHVGKERQVKESDMANLVFLQAIIKESLRLYPAAPLSVTHESIEDCTVG-  377

Query  437  GYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRS  258
            GY++PAGTRL++N+ KIHRDES+W  P+ FQPERFLTTHK+ID +GQ+FELIPF SGRR 
Sbjct  378  GYYIPAGTRLVVNVSKIHRDESVWLNPSAFQPERFLTTHKNIDFKGQNFELIPFSSGRRM  437

Query  257  CPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATV  78
            CPGI  +LQ L++ LATLLH F+   PSN+ +DM+ESAG+ N+KATP++  L PRLPA +
Sbjct  438  CPGISFALQVLNLTLATLLHSFEIETPSNQPVDMTESAGITNLKATPVEALLIPRLPAYL  497

Query  77   F  75
            +
Sbjct  498  Y  498



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 180/250 (72%), Gaps = 1/250 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR   E  +   DFM VML I+ D  Q  G D DTI KA CL +++A +D  AVTLTW +
Sbjct  277  KRDSQEMNQEEEDFMYVMLSILGDTDQYYGRDVDTINKAICLGLILAATDTTAVTLTWII  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  IL+K + ELD Q+G  R VNESDIKNLV+LQA++KE +RLYP  P+     S
Sbjct  337  SLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHES  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+S GY+VP+GT+L IN+WK+ RD  +W EP +FQPERFLT HKD DVRGQ+FEL+
Sbjct  397  IEECTVS-GYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELL  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRR CPG+  +LQ +   LA+LLH FD A PSNE +DM E  GL   K+TPL+V +
Sbjct  456  PFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLV  515

Query  101  TPRLPATVFG  72
             PRL A+++G
Sbjct  516  APRLSASLYG  525



>ref|XP_010248151.1| PREDICTED: cytochrome P450 82C4-like, partial [Nelumbo nucifera]
Length=464

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            R +S +    +DFMD+ML I+ED +++   +  TIIK+TCLN+++ G+D  AVTLTW +S
Sbjct  217  RILSSDAIDEKDFMDIMLSILED-SKLPDHNLGTIIKSTCLNLILGGNDTTAVTLTWCIS  275

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLNNR  + K QEELD Q+GR R V ESDI+NL +LQA+IK T RLYP  P++  + + 
Sbjct  276  LLLNNRHAMKKAQEELDIQVGRERIVEESDIENLKYLQAIIKXTFRLYPAAPLSAPQITT  335

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT++ G++VP+GTRL+ NIWKI RD ++W +P+ F PERFLT H ++DV GQHFELI 
Sbjct  336  EDCTVA-GFYVPSGTRLVTNIWKIQRDPAVWMDPSNFNPERFLTRHTNLDVWGQHFELIT  394

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FG GRRSCPGI L+L+ +++ L  LL  F+FA PS+  +DM+E AGL N+KATPL++ LT
Sbjct  395  FGLGRRSCPGINLALRVVNLTLXRLLQGFEFATPSDAPVDMTEKAGLTNLKATPLQILLT  454

Query  98   PRLPATVFG  72
            PR P+  +G
Sbjct  455  PRFPSKFYG  463



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 184/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R S + KG  DFM V+L +++D+A Q+   DAD +IKA C+ ++VA +D   VTLTWA+
Sbjct  280  KRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAADTSVVTLTWAI  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            +LL+NNR +L K Q+ELD Q+G  R VNESD +NLV+LQA+IKET+RLYP  P+      
Sbjct  340  ALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAPLLLPHEC  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+C ++ GYHVPAGT+L +N WKI RD  +W EP +FQPERFLT HKDIDV GQ FELI
Sbjct  400  IEECIVN-GYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQDFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CP +   LQ + + LA+L+H FDF  PS+E +DM E+ GL   KATPL+V +
Sbjct  459  PFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKATPLEVLV  518

Query  101  TPRLPATVFG  72
            +PR  A+++G
Sbjct  519  SPRHSASLYG  528



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 186/249 (75%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R S   +   DFM +ML ++ D A++  ++ADTIIKATCL +++ G+D   VT+TWAL
Sbjct  281  QKRNSGNAESEHDFMGMMLSLLNDAAELPSYNADTIIKATCLAIILGGTDTTTVTITWAL  340

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L+K Q ELDT +GR R V ESD+KNLV+LQA+IKET RLYP  P++ +  S
Sbjct  341  SLLLNHHDVLEKAQHELDTYVGRERPVQESDVKNLVYLQAIIKETTRLYPAAPLSVMHES  400

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT + GY +PAGTRL++N+ K+ RD   W  P+EF+PERFLTTHK  DVRGQ++EL+
Sbjct  401  VEDCT-TAGYFIPAGTRLLVNLSKLQRDPKAWSNPDEFRPERFLTTHKHFDVRGQNYELV  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +LQ L   LA+LL  F+   PS+E +DM E AGL N+KATPL+V L
Sbjct  460  PFGSGRRVCPGISFALQVLQFSLASLLQAFEITTPSDEPVDMGEGAGLTNLKATPLEVIL  519

Query  101  TPRLPATVF  75
            TPRLP  ++
Sbjct  520  TPRLPPHLY  528



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   307 bits (787),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 185/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821   KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
             +RR   + KG  DF+D ML ++ D A + GFDADT+ KAT LNM+   SD   VTLTWA+
Sbjct  770   RRRARGDAKGEPDFIDAMLSVL-DGADLGGFDADTVNKATSLNMIAGASDTTMVTLTWAI  828

Query  641   SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
             SLLLNN  +L + Q ELDT+IGR R V+ESDI  LV++QA++KETLRLYP  P++G R  
Sbjct  829   SLLLNNPHMLKRAQTELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPAAPLSGPREF  888

Query  461   LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
              +DCT+  GYHV  GTRL+ N+WKI  D  IWP+P EF+PERFLTT KD+DV+G HFELI
Sbjct  889   TKDCTIG-GYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTTQKDVDVKGLHFELI  947

Query  281   PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
             PFGSGRR+CPG+  +LQ +   LA+ +H F+ + P +  IDM+ES GL NVKATPL+V +
Sbjct  948   PFGSGRRACPGLAFALQMVQFTLASFVHAFEISNPLSAPIDMTESFGLTNVKATPLQVLI  1007

Query  101   TPRLPATVFG  72
              PRLP+ ++G
Sbjct  1008  KPRLPSQLYG  1017


 Score =   269 bits (687),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            EGK  +DFMDVML  + +   ++GFDADT+IKATCL ++  GSD   VTLTWALSLLLNN
Sbjct  293  EGKD-QDFMDVMLSAI-NGTDVAGFDADTVIKATCLILIAGGSDTTMVTLTWALSLLLNN  350

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
            R +L K+ EELD  +G+GR + ESDI NLV+LQA +KE +RL P GP++G R   EDCT+
Sbjct  351  RQVLKKIYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTI  410

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GYHVP GT L++N+WKI  D  +W +P EF+PERFLTTHKD+DVRGQ FEL+PFGSGR
Sbjct  411  G-GYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGR  469

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKI  162
            R+CPGI   LQ   + LA+ L   D++LP    I
Sbjct  470  RACPGISFGLQMTLLTLASFLFSMDYSLPYVNSI  503



>ref|XP_003554125.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 176/240 (73%), Gaps = 2/240 (1%)
 Frame = -1

Query  794  GARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSI  615
            G +DFMDVML +  D   I G DADTIIK+  L ++  G+++I  TLTWA+ L+L N  +
Sbjct  287  GIQDFMDVMLSLF-DGKTIYGIDADTIIKSNLLTIISGGTESITTTLTWAVCLILRNPIV  345

Query  614  LDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQG  435
            L+KV  ELD Q+G+ R + ESDI  L +LQAV+KETLRLYPPGP++  R  +EDCTL  G
Sbjct  346  LEKVIAELDFQVGKERCITESDISKLTYLQAVVKETLRLYPPGPLSAPREFIEDCTLG-G  404

Query  434  YHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSC  255
            Y+V  GTRL+ N+WKIH D S+W  P EF+PERFLTTHKDIDVRG HFEL+PFG GRR C
Sbjct  405  YNVKKGTRLITNVWKIHTDLSVWSNPLEFKPERFLTTHKDIDVRGHHFELLPFGGGRRGC  464

Query  254  PGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            PGI  SLQ +H+ LA+L H F F  PSNE IDM+E+ GL   KATPL++ + PRL ++ +
Sbjct  465  PGISFSLQMVHLILASLFHSFSFLNPSNEPIDMTETFGLAKTKATPLEILIKPRLSSSCY  524



>ref|XP_004488195.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=510

 Score =   296 bits (757),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 182/245 (74%), Gaps = 2/245 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R  S E K  +DF+DV+L ++ D   ++G+  DT+IKATCL ++   +D   VT+TWAL
Sbjct  261  RRNDSLESKMEQDFIDVLLSVL-DGVDLAGYHLDTVIKATCLTLIAGATDTTTVTITWAL  319

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR  L KVQ+ELD  +G+ R VNESDI NLV+LQAV+KETLRLYP GP++G R  
Sbjct  320  SLLLNNRHTLKKVQDELDNHVGKERLVNESDITNLVYLQAVVKETLRLYPAGPLSGARQF  379

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             E+C L  GY++ AGTRL++N+WK+HRD  +W EP EF+PERFL THKD+DV+GQHFEL+
Sbjct  380  TENCILG-GYNINAGTRLILNLWKMHRDPRVWSEPLEFRPERFLNTHKDVDVKGQHFELL  438

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG GRRSCPGI   LQ  H+ LA  L  F+   P+N+++DMS + GL N+K TPL+V  
Sbjct  439  PFGGGRRSCPGITFGLQMTHLALAAFLQAFEVTTPTNDEVDMSATFGLTNIKTTPLEVIA  498

Query  101  TPRLP  87
             PRLP
Sbjct  499  KPRLP  503



>ref|XP_004147803.2| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis sativus]
 gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            DFMDVML  + DD Q+S +DA  + KATCL +++AGSD   VT+ WALSLLLNN+ +L +
Sbjct  301  DFMDVMLSNVRDDGQLSKYDAHIVTKATCLALILAGSDTTTVTMIWALSLLLNNQEVLKR  360

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             Q ELD  +GR R V ESD+KNL++LQAV+KETLRLYP  P+     S+EDC ++ GYH+
Sbjct  361  AQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAAPILIPHESIEDCVVA-GYHI  419

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            P GTRL++N+ K+ RD  IW +P EF PERFLT+ KD DVRGQ  +LIPFGSGRR CPGI
Sbjct  420  PLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDFDVRGQSPQLIPFGSGRRMCPGI  479

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
              +LQ +H+ LA LLH F+ + P+ E +DM ESAG+ +++  PL+V LTPRLP  V+
Sbjct  480  SFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRKNPLEVVLTPRLPPQVY  536



>ref|XP_006375028.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
 gb|ERP52825.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
Length=342

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 185/249 (74%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +++ S   KG  DFMD+ML +++D  ++S   ADTI KATCL +++A +D  +VTLTW L
Sbjct  92   QKKASGTAKGEEDFMDLMLSVLDDGKELSNRSADTINKATCLTLVLAAADTTSVTLTWTL  151

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD  +GR R V ESD+KNLV+LQA+IKET RLYP  P++    S
Sbjct  152  SLLLNNREVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHES  211

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+  GY +PAGTRL  N+ KIHRD  +W +P+EFQPERFLTTHKD D RGQHFELI
Sbjct  212  MEECTVG-GYQIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELI  270

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ +++ LATLLH FD     +  IDM+E+ G+ N+KATPL+  L
Sbjct  271  PFGSGRRMCPGVSFALQVVNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALL  330

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  331  TPRLSPGLY  339



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   296 bits (757),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 188/252 (75%), Gaps = 3/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            + R+S    GA +DF+  ML ++ DD Q SG D DTIIK TC N+++AG+D  ++TLTWA
Sbjct  275  QNRLSANDNGAEQDFIHAMLSVI-DDGQFSGRDPDTIIKGTCSNLILAGNDTTSITLTWA  333

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L K Q EL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    
Sbjct  334  LSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHE  393

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL
Sbjct  394  AMEDCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYEL  452

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L+  H+ LA LLH F+    ++  +DM+ES GL   KATPL+V 
Sbjct  453  LPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVT  512

Query  104  LTPRLPATVFGH  69
            + PRLP  ++ +
Sbjct  513  IVPRLPFELYSY  524



>ref|XP_009365936.1| PREDICTED: cytochrome P450 82A3-like, partial [Pyrus x bretschneideri]
Length=341

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 177/249 (71%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A +  FDADTI +AT LN++  G D   VTLTWAL
Sbjct  94   QRRAKGDAKGEQDFIDALLSVL-DGADLGSFDADTIARATSLNVIAGGGDTTMVTLTWAL  152

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IG+ R V+E DI NLV++Q ++KETLRLYP GP++G R  
Sbjct  153  SLLLNNPHVMKKALNELDTKIGKQRVVSEEDISNLVYIQVIVKETLRLYPVGPLSGPRIF  212

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTR + N WKI  +   WPEP EF+PERFLTTHKD+D++G HF+ I
Sbjct  213  SEDCTIA-GYHIRKGTRFIPNFWKIQTNPKNWPEPFEFKPERFLTTHKDVDLKGHHFQYI  271

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKA+PL V +
Sbjct  272  PFSSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPIDMTESFGITNVKASPLNVLI  331

Query  101  TPRLPATVF  75
             PRL   ++
Sbjct  332  KPRLSYELY  340



>ref|XP_010686309.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   295 bits (756),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 183/250 (73%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R+ S+E    RDFMDVML + E    +   FD+DTIIKAT + M++A +D  AVTLTWA
Sbjct  262  ERKSSKEKDEKRDFMDVMLSVFETGQDKPFKFDSDTIIKATSMAMILAATDTTAVTLTWA  321

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ IL K Q ELD  +G+ R V ESD+KNLV+LQAV+KET+RLYP  P++  R 
Sbjct  322  LSLLLNNKDILKKTQAELDNVVGKERQVEESDLKNLVYLQAVLKETMRLYPAAPLSVPRE  381

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ DCT+S GY++P GT+L +N++KIHRD  +W +P EF PERFLTT+K  DVRGQ FE 
Sbjct  382  AITDCTVS-GYYIPVGTQLFVNLYKIHRDPEVWEDPLEFHPERFLTTYKQYDVRGQQFEY  440

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L  +   LA+LLH FD ++P +  +DM+E  GL N+KATPL+V 
Sbjct  441  MPFGSGRRICPGISFALLAMQFTLASLLHGFDISIPCDGTVDMTEGFGLTNLKATPLEVI  500

Query  104  LTPRLPATVF  75
             T RLP  ++
Sbjct  501  ATHRLPRNIY  510



>ref|XP_010934114.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=527

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 184/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQI-SGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +RRM   G G +DFMDVML IME + ++ S  D DT+IKA  L +++ G+D  +VT+TWA
Sbjct  278  ERRMEGRGDGKQDFMDVMLAIMEKEGELLSDHDPDTVIKANSLALIIGGTDTTSVTMTWA  337

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            L+L+LN+  +L K QEEL+  +GR RNVNESD++ LV+LQA++KETLRLYPPGP+     
Sbjct  338  LALMLNHPHVLRKAQEELEAHVGRARNVNESDVEKLVYLQAIVKETLRLYPPGPILLPHQ  397

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDC ++ G+ VPAGT++++N W I RD  +WPEP+ F+PERFLT+H D+ VRG+  EL
Sbjct  398  AMEDCQVA-GFDVPAGTQVLVNAWAIQRDPQVWPEPSAFRPERFLTSHGDVGVRGRQLEL  456

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR+CPG   +LQ +H+ LA ++H FD   P+ E +DM+E  G    KATPL+V 
Sbjct  457  LPFGSGRRACPGASFALQVVHLTLARIIHGFDLETPTGEPVDMTEGKGATLPKATPLEVL  516

Query  104  LTPRLPATVF  75
            +TPRL   ++
Sbjct  517  VTPRLAPVLY  526



>ref|XP_006375024.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
 gb|ERP52821.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
Length=425

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 186/249 (75%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +++ S   KG  DFMD+ML +++D  ++S   ADTI KATCL +++A SD  +VTLTW L
Sbjct  175  QKKASGTAKGEEDFMDLMLSVLDDGKELSNRSADTINKATCLTLILAASDTTSVTLTWTL  234

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR IL K Q+ELD  +GR R V ESD+KNLV+LQA+IKET RLYP  P++    S
Sbjct  235  SLLLNNREILKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHES  294

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+  GYH+PAGTRL  N+ KIHRD  +W +P+EFQPERFLTTHKD D RGQHFELI
Sbjct  295  MEECTVG-GYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELI  353

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ L++ LATLLH FD     +  IDM+E+ G+ N+KATPL+  L
Sbjct  354  PFGSGRRMCPGVSFALQVLNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALL  413

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  414  TPRLSPGLY  422



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 181/250 (72%), Gaps = 5/250 (2%)
 Frame = -1

Query  806  EEG---KGARDFMDVMLEIME-DDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            EEG   K  +DFMDVMLE +   D  I G+  +TI+KAT LN+++AG+D  +VTLTWALS
Sbjct  251  EEGRVRKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATALNLILAGTDTTSVTLTWALS  310

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
            LLLN+  +L + Q+E+D  +G  R V ESDIKNLV+LQA++KETLRLYPPGP+   R SL
Sbjct  311  LLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESL  370

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDC +  GY VP GT+L++N WK+HRD  IW  P EF PERFLT+H   DVRGQ FE +P
Sbjct  371  EDCYVD-GYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVP  429

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CPGI  SLQ LH+ L+ LL  F+F+ P N ++DMSE  GL   KATPL+V LT
Sbjct  430  FGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATPLEVVLT  489

Query  98   PRLPATVFGH  69
            PRL   ++ H
Sbjct  490  PRLENEIYQH  499



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 180/249 (72%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R   E +G RDFMDVML I+     +  +DADTI KATCL ++  G+D  AVTLTWAL
Sbjct  281  RKRACGEAEGDRDFMDVMLSILGTADVLPSYDADTINKATCLALISGGTDTTAVTLTWAL  340

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L + Q+ELD+QIGR R V ESDIKN V++QA+IKETLRLYP  P++    S
Sbjct  341  SLLLNNRHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHES  400

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            ++DCT+   Y VPAGTRL++NI K+H +  +WP P EF+PERFLTTHKD+ V GQ+FE +
Sbjct  401  VKDCTIGS-YRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDLGVWGQNFEYL  459

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ LHI LATLLH F+    S    DM    G+ + K TPL+V L
Sbjct  460  PFGSGRRMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVL  519

Query  101  TPRLPATVF  75
            TPRLP  ++
Sbjct  520  TPRLPPHLY  528



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 185/251 (74%), Gaps = 4/251 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDAD--TIIKATCLNMLVAGSDAIAVTLTW  648
            KR      +  +DF+  ML ++ DDAQ SG D D  T+IKATCL +++A +D IA+TLTW
Sbjct  267  KRLSGSINEAEQDFIHAMLSVI-DDAQFSGHDHDHDTVIKATCLTVMLASNDTIAITLTW  325

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLL+NN   L K QEELD  +GR + V ESDIK LV+LQA+IKETLRLYP GP+    
Sbjct  326  ALSLLMNNPHALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPH  385

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             ++EDCT++ G+H+ AGTRL++N+WK+HRD +IW +P EFQPERFLT H  +DVRGQHFE
Sbjct  386  EAMEDCTIA-GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFE  444

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFGSGRR CPGI  +L+ L + LA LLH F+  + ++  +DM+E  GL   KATPL+V
Sbjct  445  LLPFGSGRRMCPGISFALEILQLTLARLLHGFELGVVADSPLDMTEGVGLALPKATPLEV  504

Query  107  CLTPRLPATVF  75
             L PRLP+ ++
Sbjct  505  TLVPRLPSELY  515



>ref|XP_007225086.1| hypothetical protein PRUPE_ppa017464mg, partial [Prunus persica]
 gb|EMJ26285.1| hypothetical protein PRUPE_ppa017464mg, partial [Prunus persica]
Length=519

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 185/252 (73%), Gaps = 4/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGA--RDFMDVMLEIMEDDAQISG-FDADTIIKATCLNMLVAGSDAIAVTLT  651
            KR++S   KG   RDFMD M+  ++DD +++  +DADTI KAT L +L+AG D    TL+
Sbjct  268  KRKISGGVKGDDDRDFMDTMISFLDDDLKVTKEYDADTINKATALTILLAGVDVTTGTLS  327

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WALSLLLNN   L + QEELD  IGR R V ESDI NLV+LQAV+KET+RLYPPGPV   
Sbjct  328  WALSLLLNNPVTLKRAQEELDQVIGRERQVKESDIDNLVYLQAVLKETMRLYPPGPVPLA  387

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
              S EDC L  GYH+PA TR+ INI KI  D   WPEPNEF+PERFLTTHK+IDVRGQ F
Sbjct  388  HVSTEDCILG-GYHIPAKTRVFINIGKIQLDPKTWPEPNEFRPERFLTTHKNIDVRGQDF  446

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPF SGRR C G+ L+++ + + LA+LLH F+ A PS+E +DMSE+  L N K++ L+
Sbjct  447  ELIPFSSGRRMCAGLSLAMKMMPLALASLLHGFEIATPSDEPVDMSENMELTNHKSSLLE  506

Query  110  VCLTPRLPATVF  75
            V +TPRLPA ++
Sbjct  507  VVVTPRLPAQLY  518



>ref|XP_003618354.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74572.1| cytochrome P450 family protein [Medicago truncatula]
Length=535

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 176/241 (73%), Gaps = 2/241 (1%)
 Frame = -1

Query  797  KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRS  618
            +G +D MDV+L ++ D   I GFD DTIIKAT L +   GSD  +VTLTWAL LLLNN  
Sbjct  294  QGNQDIMDVLLSLL-DGTTIEGFDGDTIIKATILTLFAGGSDTTSVTLTWALCLLLNNPL  352

Query  617  ILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQ  438
            +++K +EELD QIG+ R V ESDI  L +LQA++KETLRLYPP P++G R   E+CTL  
Sbjct  353  VMEKAKEELDAQIGKERCVCESDINKLTYLQAIVKETLRLYPPAPLSGPREFSENCTLG-  411

Query  437  GYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRS  258
            GYHV  GTRL+ N+W+I+ D +IWP+P EF+PERFLTTHKD+DVRG +F L+PFGSGRR 
Sbjct  412  GYHVIKGTRLITNLWRINTDPNIWPDPLEFKPERFLTTHKDVDVRGSNFVLLPFGSGRRI  471

Query  257  CPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATV  78
            CPGI L LQ LH  LA+ LH FD   P+ E +DMSES GL N KATPLK+ + P L    
Sbjct  472  CPGISLGLQMLHFILASFLHSFDILNPTPELVDMSESFGLTNTKATPLKILIKPHLSINC  531

Query  77   F  75
            +
Sbjct  532  Y  532



>ref|XP_010686293.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=518

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 187/250 (75%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +RR S+E +  RDFMDV+L + E    +   FD+DTIIKAT + +++A +D  A+TLTWA
Sbjct  262  ERRSSKEKEEKRDFMDVLLSVFETGQDKPFKFDSDTIIKATSMGIILAATDTTAITLTWA  321

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ +L K Q ELD  +G+ R V ESD+KNLV+LQAV+KET+RLYP GP+   R 
Sbjct  322  LSLLLNNKDVLKKTQAELDNVVGKERQVEESDLKNLVYLQAVLKETMRLYPAGPLAVPRE  381

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ DCT++ GY++PAGT+L +N++KIHRD  +W +P EF PERF TT+K  D+RGQ FE 
Sbjct  382  AITDCTVN-GYYIPAGTQLFVNLYKIHRDPKVWEDPLEFHPERFPTTYKQYDIRGQQFEY  440

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFG+G+R CPGI  +L  +   LA+LLH FD ++P++E +DM+ES GL N+KATPL+V 
Sbjct  441  MPFGNGKRICPGISFALLAMQFTLASLLHGFDISIPTDETVDMTESFGLTNLKATPLEVI  500

Query  104  LTPRLPATVF  75
             T RLP  ++
Sbjct  501  ATHRLPHNLY  510



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 173/237 (73%), Gaps = 2/237 (1%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDK  606
            DFMDVML I E+   +  FD+DT IKATC+ +L AG+D   VTLTW L LLLNN   L K
Sbjct  276  DFMDVMLSICENK-HLPAFDSDTAIKATCMGILSAGTDTTIVTLTWILCLLLNNYEALQK  334

Query  605  VQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHV  426
             Q+E+D  +G+   V ESDIKNLV+LQA++KE LRLYP GP++    S+EDC +  GY +
Sbjct  335  AQDEIDAHVGKNTWVQESDIKNLVYLQAIVKEALRLYPAGPLSVPHESMEDCVIG-GYDI  393

Query  425  PAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGI  246
            P GTRL++N+WKIH D +IW  P+EF+PERFLTTHKD+DVRG HFELIPFGSGRR CPGI
Sbjct  394  PKGTRLLVNLWKIHHDPNIWKNPHEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGI  453

Query  245  QLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
             L LQ +   +A LL  FD   PS+E IDMSES GL  +KA+PL+V L PRL   ++
Sbjct  454  SLVLQVVPFVIAMLLQGFDMKRPSDEPIDMSESFGLSVLKASPLEVLLAPRLAPVLY  510



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 179/250 (72%), Gaps = 1/250 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR   E  +   DFM VML I+ D  Q  G D DTI KA CL +++A +D  AVTLTW +
Sbjct  277  KRDSQEMNQEEEDFMYVMLSILGDTEQYYGRDVDTINKAICLGLILAATDTTAVTLTWII  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  IL+K + ELD Q+G  R VNESDIK LV+LQA++KE +RLYP  P+     S
Sbjct  337  SLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEAMRLYPAAPLLIPHES  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+S GY+VP+GT+L IN+WK+ RD  +W EP +FQPERFLT HKD DVRGQ+FEL+
Sbjct  397  IEECTVS-GYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELL  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRR CPG+  +LQ +   LA+LLH FD A PSNE +DM E  GL   K+TPL+V +
Sbjct  456  PFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLV  515

Query  101  TPRLPATVFG  72
             PRL A+++G
Sbjct  516  APRLSASLYG  525



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 180/249 (72%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            ++R   E +G RDFMDVML I+     +  +DADTI KATCL ++  G+D  AVTLTWAL
Sbjct  276  RKRACGEAEGDRDFMDVMLSILGTADVLPSYDADTINKATCLALISGGTDTTAVTLTWAL  335

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L + Q+ELD+QIGR R V ESDIKN V++QA+IKETLRLYP  P++    S
Sbjct  336  SLLLNNRHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHES  395

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            ++DCT+   Y VPAGTRL++NI K+H +  +WP P EF+PERFLTTHKD+ V GQ+FE +
Sbjct  396  VKDCTIGS-YRVPAGTRLLLNISKLHWNPLVWPAPLEFRPERFLTTHKDLGVWGQNFEYL  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ LHI LATLLH F+    S    DM    G+ + K TPL+V L
Sbjct  455  PFGSGRRMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVL  514

Query  101  TPRLPATVF  75
            TPRLP  ++
Sbjct  515  TPRLPPHLY  523



>gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum]
Length=534

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 180/256 (70%), Gaps = 2/256 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R  S EGK A+DFMDVM+ +++       FD DTIIKATC  ++  G+D  AV   WAL
Sbjct  281  EREFSGEGK-AQDFMDVMISVVKGADLQCEFDVDTIIKATCGTLIAGGTDTTAVVFVWAL  339

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L K Q+ELD  +G+ R V ESD+ NL++LQA++KETLRLYPPGP+ G R  
Sbjct  340  SLLLNHSHVLKKAQQELDKHVGKDRRVKESDLNNLIYLQAIVKETLRLYPPGPLAGTRRF  399

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDC +  GY++P  T L++N+WK+ RD  +W +P EF+PERFL   K  DV+GQ FELI
Sbjct  400  TEDCVVG-GYYIPKDTWLIVNLWKLQRDPRVWSDPLEFRPERFLAGDKTFDVKGQDFELI  458

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR CPG+   LQ LH+ LA+LL  FD +  S+E +DMSESAGL N+KATPL V +
Sbjct  459  PFGAGRRICPGLSFGLQMLHLVLASLLQAFDMSTVSDEAVDMSESAGLTNMKATPLDVVV  518

Query  101  TPRLPATVFGH*VYFY  54
            TPRLP  ++   V  Y
Sbjct  519  TPRLPPRLYNEIVEIY  534



>ref|XP_006379218.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
 gb|ERP57015.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
Length=487

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 185/248 (75%), Gaps = 5/248 (2%)
 Frame = -1

Query  818  RRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALS  639
            R +SEE K   DF+ VML IM DD  IS  +ADT +KA+CL++L+ GSD  A+ LTWAL+
Sbjct  243  RSISEEEK---DFIYVMLSIM-DDGNISVDEADTTVKASCLSLLLGGSDTTAIALTWALA  298

Query  638  LLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSL  459
             LLNNR++L K Q ELDT +G+ R V E+DIKNLV++QA++KET RL+ P P++G R ++
Sbjct  299  SLLNNRNMLKKAQCELDTHVGKHREVAETDIKNLVYMQAIVKETFRLHQPAPLSGPREAM  358

Query  458  EDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIP  279
            EDCT++ G+H+PAGTRL++N+WK+HRD +IW  P EFQPERFL  H ++DVRGQ FE  P
Sbjct  359  EDCTVA-GFHIPAGTRLVVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEFTP  417

Query  278  FGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLT  99
            FGSGRR CP +  ++Q +H+ LA LLH F+    S+  +DM+ES GL   KATPL+V L 
Sbjct  418  FGSGRRMCPAVSFAVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLR  477

Query  98   PRLPATVF  75
            PRLP+  +
Sbjct  478  PRLPSIAY  485



>ref|XP_011030958.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X3 [Populus 
euphratica]
Length=527

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 186/249 (75%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+ S   KG  DFMD+ML +++   ++S   ADTI KATCL +++A +D  +VTLTW L
Sbjct  277  QRKASGTAKGEEDFMDLMLSVLDGAKELSNRSADTINKATCLTLILAAADTTSVTLTWTL  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD  +GR R V ESD+KNLV+LQA+IKET RLYP  P++    S
Sbjct  337  SLLLNNRDVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSLPHES  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +E+CT+  GYH+PAGTRL  N+ KIHRD  +W +P+EFQPERFLTTHKD D RGQHFELI
Sbjct  397  MEECTVG-GYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELI  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPG+  +LQ L++ LATLLH FD     +  IDM+E+ G+ NVKATPLKV L
Sbjct  456  PFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGITNVKATPLKVLL  515

Query  101  TPRLPATVF  75
            TPRL   ++
Sbjct  516  TPRLSPGLY  524



>emb|CAN64501.1| hypothetical protein VITISV_020341 [Vitis vinifera]
Length=462

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 183/247 (74%), Gaps = 2/247 (1%)
 Frame = -1

Query  815  RMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSL  636
            R++ E    +DF+D+ML  ++D A + G+  +TIIKAT + ++VAGSD  ++T TW LS 
Sbjct  218  RLNSEASSRQDFIDIMLTKLKD-ASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSA  276

Query  635  LLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLE  456
            LLNNR ++   QEELD ++GR R V +SDI+NLV+L+A++KETLRLYP  P+     ++E
Sbjct  277  LLNNRHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAME  336

Query  455  DCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
            DC +  GYH+P GTRL++N WK+HRD ++W  P EFQPERFLT+H  +DV GQ+FELIPF
Sbjct  337  DCHVG-GYHIPKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPF  395

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
            GSGRRSCPGI ++LQ LH+ +A LL  FD A PSN  +DM+E+  +   K TPL+V LTP
Sbjct  396  GSGRRSCPGINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTP  455

Query  95   RLPATVF  75
            RLPA ++
Sbjct  456  RLPAELY  462



>ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=526

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 182/249 (73%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR + E   GA+DFM+VML  + D   I G DADT+IK+T L ++ AG++A   T+ WA+
Sbjct  277  KRALGEGVDGAQDFMNVMLSSL-DGKTIDGIDADTLIKSTVLTIIQAGTEASITTIIWAM  335

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
             L+L N  IL+K++ ELD Q+G+ R + ESDI NLV+LQAV+KET RLY PGP++  R  
Sbjct  336  CLILKNPLILEKIKAELDIQVGKDRCICESDISNLVYLQAVVKETFRLYAPGPLSSPREF  395

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTL  GYHV  GTRL+ NIWKIH D ++W +P EF+P+RFLTTHKDIDV+G HF+L+
Sbjct  396  AEDCTLG-GYHVKKGTRLITNIWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKGHHFQLL  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI   LQT+H+ LA+ LH F+   PS E +DM+E+ G+ N KATPL+V +
Sbjct  455  PFGSGRRVCPGISFGLQTVHLALASFLHSFEILNPSTEPLDMTEAFGVTNTKATPLEVLV  514

Query  101  TPRLPATVF  75
             PRL  + +
Sbjct  515  KPRLSPSCY  523



>ref|XP_010040235.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW45364.1| hypothetical protein EUGRSUZ_L00957 [Eucalyptus grandis]
Length=531

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 179/245 (73%), Gaps = 2/245 (1%)
 Frame = -1

Query  809  SEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLL  630
            S E +G RDFMDVML  + +D ++ G+DADTIIKATCL M+  G+D    TLTWA+SLLL
Sbjct  286  SSEKRGHRDFMDVMLSTI-NDKEMGGYDADTIIKATCLAMISGGTDTTMGTLTWAVSLLL  344

Query  629  NNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDC  450
            NN  IL K QEELDTQIG+ R VNESD+ NL ++ A++KETLRL+PPGP+     S++DC
Sbjct  345  NNLHILKKTQEELDTQIGKQRYVNESDVANLGYVFAIVKETLRLHPPGPLGVPHESIQDC  404

Query  449  TLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGS  270
             ++ G++VP GTR M NIWKI  D   WPEP EF+PERFL++HKD++V+ ++FE +PFG 
Sbjct  405  EIN-GHYVPKGTRFMFNIWKIQNDPRTWPEPMEFKPERFLSSHKDVEVKDRNFEFLPFGG  463

Query  269  GRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRL  90
            GRR CPG+   LQ +H  LA  LH F+ +   N  +DMSE+ G+   KATPLKV LTPRL
Sbjct  464  GRRICPGMSFGLQFVHSMLARFLHAFEISTLDNLPVDMSETFGITIEKATPLKVMLTPRL  523

Query  89   PATVF  75
            P  V+
Sbjct  524  PDEVY  528



>ref|XP_008351399.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=526

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 179/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A    FDADTI KAT LN++  G D   V L WA+
Sbjct  279  QRRAKGDAKGEKDFIDXLLSVL-DGADJGSFDADTITKATSLNIIAGGGDTTMVPLIWAI  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN  +L K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP++G R  
Sbjct  338  SLLVNNPQVLKKAVNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPVGPLSGPRLF  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTRL+ N WKI  D   WPEP EF+PERFLTTHKD+D++G+HF+ +
Sbjct  398  TEDCTIA-GYHIRKGTRLIPNFWKIQTDPKNWPEPFEFKPERFLTTHKDVDLKGRHFQFL  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKATPL V +
Sbjct  457  PFSSGRRSCPGLTFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGITNVKATPLNVLI  516

Query  101  TPRLPATVFG  72
             PRL + ++G
Sbjct  517  KPRLSSELYG  526



>emb|CBI19611.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 188/252 (75%), Gaps = 4/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQ---ISGFDADTIIKATCLNMLVAGSDAIAVTLT  651
            ++R+S +  G +DFMDVML I++D+ +   I   DAD I KATCLN+L+A +D + V+LT
Sbjct  269  RKRVSGQPTGDQDFMDVMLSILDDETRAQDIKSSDADIINKATCLNVLIATTDTVTVSLT  328

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WALSLLLNNR +L+K +EELD  +GR R V E D+ NLV+L A+IKETLRLY    V   
Sbjct  329  WALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYLDAIIKETLRLYSAVQVLAA  388

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
              S E+C +  G ++PAGTRL+IN+WKIH D S+W +P++F PERFLTTHKD+DVRG HF
Sbjct  389  HESTEECVVG-GCYIPAGTRLIINLWKIHHDPSVWSDPDQFMPERFLTTHKDVDVRGMHF  447

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRR CPG+ L+LQ L   LA+L+  F+FA  S+  +DM+ES GL N+KATPL 
Sbjct  448  ELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGPVDMTESIGLTNLKATPLD  507

Query  110  VCLTPRLPATVF  75
            V LTPRL + ++
Sbjct  508  VLLTPRLSSNLY  519



>gb|KJB47835.1| hypothetical protein B456_008G044400 [Gossypium raimondii]
Length=520

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 185/250 (74%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R++ E  KG +DF+ VML I+ DD  I   +ADTIIK TCL++++ G DA  V LTW +
Sbjct  273  QRKLGENIKGDQDFIHVMLSIL-DDNNIPTEEADTIIKGTCLSLILGGIDANVVVLTWTV  331

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L + Q+ELD  +G+ R V ESDI NLV+LQA+IKETLR+ PP P++G R +
Sbjct  332  SLLLNNRHVLKRAQDELDIHVGKHRQVQESDINNLVYLQAIIKETLRIKPPVPLSGPREA  391

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT++ G+H+PAGTRL  NIWK+ RD SIW +P EF PERFL  H ++DVRG+++E +
Sbjct  392  MEDCTIA-GFHIPAGTRLFPNIWKLQRDPSIWQKPLEFLPERFLNDHANVDVRGKNYEFL  450

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +L+ L + L  LLH F+    S+  +DMSES GL   KATPL+V L
Sbjct  451  PFGSGRRICPGITFALKFLPLALGRLLHGFELGTVSDVAVDMSESPGLTTPKATPLEVTL  510

Query  101  TPRLPATVFG  72
            TPRLPA ++G
Sbjct  511  TPRLPAMLYG  520



>ref|XP_006375029.1| putative cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52826.1| putative cytochrome P450 family protein [Populus trichocarpa]
Length=525

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 180/251 (72%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR   E     +DFMDVML  + D   ++G+DADT+ KAT L++++ G+D + VT+TWAL
Sbjct  275  KRDSGESANKEQDFMDVMLYAL-DGINLAGYDADTVRKATSLSLIIGGTDTVTVTITWAL  333

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L   QEELD  +G+ R VNESDI+ L +LQA +KE LRLYP GP+ G R  
Sbjct  334  SLLLNNTVALKSAQEELDVHVGKERLVNESDIEKLTYLQACVKEALRLYPAGPLGGFREF  393

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
              DCT+  GY+VPAGTRL++NI KI RD  +WP P EF+PER L +HK +DV GQHFELI
Sbjct  394  TADCTIG-GYYVPAGTRLLLNIHKIQRDPRVWPNPTEFKPERLLGSHKAVDVMGQHFELI  452

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR+CPG  L L+  H+ LA++L  F+ + PSN  IDM+ +AGL   +ATPL+V +
Sbjct  453  PFGAGRRACPGATLGLRMSHLVLASILQAFEISPPSNAPIDMTGTAGLTCSQATPLQVLV  512

Query  101  TPRLPATVFGH  69
             PRLPA+V+ +
Sbjct  513  KPRLPASVYEY  523



>gb|KHN04536.1| Cytochrome P450 82A1, partial [Glycine soja]
Length=490

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 180/246 (73%), Gaps = 4/246 (2%)
 Frame = -1

Query  821  KRRMSEEG--KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            K+++++ G  K  +DF+DV+L +++    ++G+D DT+IKATC  ++   +D  AVT+TW
Sbjct  237  KQQITDSGDTKTEQDFIDVLLFVLKG-VDLAGYDFDTVIKATCTMLIAGATDTTAVTMTW  295

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLLLNN   L KV++ELD  +G+ R VNESDI  LV+LQAV+KETLRLYP GP +G R
Sbjct  296  ALSLLLNNHHALKKVKDELDEHVGKERLVNESDINKLVYLQAVVKETLRLYPAGPFSGPR  355

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
               E+CTL  GY + AGTR M+NIWK+HRD  +W  P EFQPERFL THK++DV+GQHFE
Sbjct  356  EFTENCTLG-GYKIEAGTRFMLNIWKLHRDPRVWSNPLEFQPERFLNTHKNVDVKGQHFE  414

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFG GRRSCPGI   LQ  H+ LA+ L  F+   PSN ++DMS + GL N+K TPL+V
Sbjct  415  LLPFGGGRRSCPGISFGLQMSHLALASFLQAFEITTPSNAQVDMSATFGLTNMKTTPLEV  474

Query  107  CLTPRL  90
             + P L
Sbjct  475  LVRPVL  480



>ref|XP_003523886.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=526

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 180/246 (73%), Gaps = 4/246 (2%)
 Frame = -1

Query  821  KRRMSEEG--KGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            K+++++ G  K  +DF+DV+L +++    ++G+D DT+IKATC  ++   +D  AVT+TW
Sbjct  273  KQQITDSGDTKTEQDFIDVLLFVLKG-VDLAGYDFDTVIKATCTMLIAGATDTTAVTMTW  331

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLLLNN   L KV++ELD  +G+ R VNESDI  LV+LQAV+KETLRLYP GP +G R
Sbjct  332  ALSLLLNNHHALKKVKDELDEHVGKERLVNESDINKLVYLQAVVKETLRLYPAGPFSGPR  391

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
               E+CTL  GY + AGTR M+NIWK+HRD  +W  P EFQPERFL THK++DV+GQHFE
Sbjct  392  EFTENCTLG-GYKIEAGTRFMLNIWKLHRDPRVWSNPLEFQPERFLNTHKNVDVKGQHFE  450

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
            L+PFG GRRSCPGI   LQ  H+ LA+ L  F+   PSN ++DMS + GL N+K TPL+V
Sbjct  451  LLPFGGGRRSCPGISFGLQMSHLALASFLQAFEITTPSNAQVDMSATFGLTNMKTTPLEV  510

Query  107  CLTPRL  90
             + P L
Sbjct  511  LVRPVL  516



>ref|XP_007223263.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
 gb|EMJ24462.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
Length=508

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DFMDVML  + D A I+GFDADTIIKATCL M+  GSD   V LTW LSLLLNNR IL 
Sbjct  272  QDFMDVMLSAI-DGADIAGFDADTIIKATCLAMISGGSDTTRVALTWTLSLLLNNRQILK  330

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            KV EELD  +G+GR +NESDI NLV+L A +KE +RL PPGP++  R   EDCT+  GYH
Sbjct  331  KVYEELDQHVGKGRQLNESDINNLVYLHATVKEAMRLCPPGPLSFQREFTEDCTVG-GYH  389

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            VP GT L++N+WKI  D  +W +P EF+PERFLTTHKD+DVRGQ FEL+PFGSGRR+CPG
Sbjct  390  VPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPG  449

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            I L LQT  + LA+ LH FD     N  +DM+ SAGL N+K +PL V + PRL   ++
Sbjct  450  INLGLQTTLLTLASFLHWFDVTTRGNAPVDMTGSAGLTNMKLSPLDVLVKPRLSPNLY  507



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 183/247 (74%), Gaps = 2/247 (1%)
 Frame = -1

Query  815  RMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSL  636
            R++ E    +DF+D+ML  ++D A + G+  +TIIKAT + ++VAGSD  ++T TW LS 
Sbjct  275  RLNSEASSRQDFIDIMLTKLKD-ASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSA  333

Query  635  LLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLE  456
            LLNNR ++   QEELD ++GR R V +SDI+NLV+L+A++KETLRLYP  P+     ++E
Sbjct  334  LLNNRHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAME  393

Query  455  DCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
            DC +  GYH+P GTRL++N WK+HRD ++W  P EFQPERFLT+H  +DV GQ+FELIPF
Sbjct  394  DCHVG-GYHIPKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPF  452

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
            GSGRRSCPGI ++LQ LH+ +A LL  FD A PSN  +DM+E+  +   K TPL+V LTP
Sbjct  453  GSGRRSCPGINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTP  512

Query  95   RLPATVF  75
            RLPA ++
Sbjct  513  RLPAELY  519



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 175/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +D MD +L  + D   + GFDADTI KAT + ++  G D   V +TWA+
Sbjct  279  QRRAKGDAKGKQDLMDALLSAL-DGEDLGGFDADTITKATSVAIIAGGGDTTMVAVTWAI  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP+ G R  
Sbjct  338  SLLLNNPHVMKKALNELDTKIGKQRVVSEEDITNLVYIQAIVKETLRLYPGGPLAGPRIF  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+P GTR + N WKI  D   WPEP EF+PERFLTTHKD+D++G HF+ I
Sbjct  398  TEDCTIA-GYHIPKGTRFIPNFWKIQTDPKYWPEPFEFKPERFLTTHKDVDLKGHHFQFI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKA PL V +
Sbjct  457  PFSSGRRSCPGLAFGLQVVQFTLASFLHAFEISNPSSAPIDMTESFGMTNVKAAPLNVLI  516

Query  101  TPRLPATVFG  72
             PRL + ++G
Sbjct  517  KPRLSSELYG  526



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 179/248 (72%), Gaps = 2/248 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR      K   DF+DVML +M DD + S  DADT+IKATCL+++  G+D    T+TWAL
Sbjct  278  KRLNGSINKDEEDFIDVMLSVM-DDGKTSPEDADTVIKATCLSLISGGNDTTVTTITWAL  336

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNNR +L K Q+ELD  +G+ R V ESDIKNL++LQA++KETLRL PP P++  R +
Sbjct  337  SLLLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKETLRLCPPLPLSAPREA  396

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDCT+  G+H+PAGTRL++N+WK+HRD SIW  P+EF P+RFL  +  +DV GQ FE +
Sbjct  397  MEDCTID-GFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDRFLNENAKLDVNGQDFEFL  455

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +LQ  H+ LA LLH F     S+  +DMS S G+   KATPL+V L
Sbjct  456  PFGSGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGITVPKATPLEVTL  515

Query  101  TPRLPATV  78
            TPR+P+ V
Sbjct  516  TPRVPSNV  523



>ref|XP_011030924.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=521

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 178/249 (71%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR   E     +DFMDVML  + D   ++G+DADT+ KAT L++++ G+D I VT+ WAL
Sbjct  274  KRDSGESANKEQDFMDVMLYAL-DGINLAGYDADTVRKATSLSLIIGGTDTITVTIIWAL  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN   L   QEELD  +G+ R VNESDI+ L +LQA +KE LRLYP GP+ G R  
Sbjct  333  SLLLNNTVALKNAQEELDVHVGKERLVNESDIEKLTYLQACVKEALRLYPAGPLGGFREF  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
              DCT+  GYHVPAGTRL++NI KI RD  +WP P EF+PER L +H+ +DV+GQHFELI
Sbjct  393  TADCTIG-GYHVPAGTRLLLNIHKIQRDPRVWPNPTEFKPERLLGSHEAVDVKGQHFELI  451

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFG+GRR+CPG  L L+  H+ LA++L  F+ + PSN  IDM+ +AGL    ATPL+V +
Sbjct  452  PFGAGRRACPGATLGLRMSHLVLASILQAFEISPPSNAPIDMTGTAGLTCSPATPLQVLV  511

Query  101  TPRLPATVF  75
             PRLPA+V+
Sbjct  512  KPRLPASVY  520



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 188/252 (75%), Gaps = 3/252 (1%)
 Frame = -1

Query  821  KRRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            + R+S    GA +DF+  ML ++ DD Q SG D DTIIK TC N+++AG+D  ++TLTWA
Sbjct  358  QNRLSANDNGAEQDFIHAMLSVI-DDGQFSGRDPDTIIKGTCSNLILAGNDTTSITLTWA  416

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L K Q EL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    
Sbjct  417  LSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHE  476

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL
Sbjct  477  AMEDCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYEL  535

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L+  H+ LA LLH F+    ++  +DM+ES GL   KATPL+V 
Sbjct  536  LPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVT  595

Query  104  LTPRLPATVFGH  69
            + PRLP  ++ +
Sbjct  596  IVPRLPFELYSY  607



>ref|XP_010686300.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 181/251 (72%), Gaps = 2/251 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDA-QISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R  S+E +  RDFMDVML + E    +   FD+DTIIK T + M++A SD   VTLTWA
Sbjct  174  ERTSSKEKEEKRDFMDVMLSVFETGQDKPFKFDSDTIIKVTSMAMILAASDTTTVTLTWA  233

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN+ IL K Q ELD  +G+ R V ESD+KNLV+LQ V+KET+RLYP  P++  R 
Sbjct  234  LSLLLNNKDILKKTQAELDNVVGKERQVEESDLKNLVYLQTVLKETMRLYPAAPLSVPRE  293

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++ DCT+S GY++P GT+L +N++KIHRD  +W  P +F PERFLTT+KD DVRGQ FE 
Sbjct  294  AITDCTVS-GYYIPVGTQLFVNLYKIHRDPEVWENPLDFHPERFLTTNKDYDVRGQSFEY  352

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L  +   LA+LLH F+ ++PS+E +DM+E  G+  +KATPL V 
Sbjct  353  MPFGSGRRICPGISFALLAMQFTLASLLHGFNISIPSDETVDMTEGFGITILKATPLDVI  412

Query  104  LTPRLPATVFG  72
            +T RLP  ++ 
Sbjct  413  VTQRLPHNLYS  423



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 183/253 (72%), Gaps = 7/253 (3%)
 Frame = -1

Query  821  KRRMSEEGK--GARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTL  654
            +RR+S E K  G +DF+DVML  +E+   +SGF  DADT IK+TCL ++   SD    TL
Sbjct  272  RRRVSGEVKSEGDQDFIDVMLS-LEEKGHLSGFQYDADTSIKSTCLALIAGASDTTTTTL  330

Query  653  TWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNG  474
             WA+SLLLNN+  L   +EEL+  IG  R V+ESD+KNLV+LQAVIKETLRLYP  P+  
Sbjct  331  VWAISLLLNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQAVIKETLRLYPVAPLIP  390

Query  473  LRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQH  294
             R  +EDC +  GYHVPAGTRL++N+WKI RD  +W + + FQPERFLT+H DIDVRG H
Sbjct  391  -REFVEDCRVG-GYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPERFLTSHADIDVRGHH  448

Query  293  FELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPL  114
            FEL+PFGSGRRSCPG   +L  LH+ LA  LH FD A P ++ +DM+E +G    KATPL
Sbjct  449  FELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTERSGTTLPKATPL  508

Query  113  KVCLTPRLPATVF  75
            +V L+PRLPA ++
Sbjct  509  EVLLSPRLPAKLY  521



>ref|XP_003604789.1| Cytochrome P450 [Medicago truncatula]
 gb|AES86986.1| cytochrome P450 family protein [Medicago truncatula]
Length=532

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 177/250 (71%), Gaps = 3/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR +SE+  G  +DFMDV+L ++ D   I GFD DT+IKAT L + + GSD  +  LTWA
Sbjct  281  KRTLSEKVDGEDQDFMDVLLSLL-DGTTIEGFDCDTMIKATILTIFIGGSDTSSGALTWA  339

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLL N   ++K +EELDT +GR R VNESDI  LV+LQA++KETLRLYP  P+ G R 
Sbjct  340  LSLLLKNPIAMEKAKEELDTHVGRERFVNESDIIKLVYLQAIVKETLRLYPSAPLGGPRE  399

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
              E+CTL  GYHV  GTRL+ N+WKI  D S+WP P +F+PERFLTTHKDIDVRG HFEL
Sbjct  400  FSENCTLG-GYHVTKGTRLITNLWKIQTDLSVWPNPLDFKPERFLTTHKDIDVRGNHFEL  458

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
             PFGSGRR CPGI   LQ +H  LA+ LH FD   P+ E IDM+E  GL N KATPL++ 
Sbjct  459  QPFGSGRRKCPGICFGLQMVHFTLASFLHSFDILNPTPELIDMTEEFGLTNSKATPLEIL  518

Query  104  LTPRLPATVF  75
            + PRL    +
Sbjct  519  IKPRLSLNCY  528



>emb|CBI25922.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 179/247 (72%), Gaps = 2/247 (1%)
 Frame = -1

Query  815  RMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSL  636
            ++  +    +DF+DVML +++D++   G   +T+IKAT + ++V GS+  ++   W LS 
Sbjct  22   KLKSDPSSRQDFIDVMLSVLKDNSMF-GHRRETVIKATVMTLIVGGSETTSIASIWILSA  80

Query  635  LLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLE  456
            LLNNR  L + QEELD ++GRGR V ESDI+NL++LQA +KETLRLYPPGP+     +++
Sbjct  81   LLNNRHTLKRAQEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQ  140

Query  455  DCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
            DC++  GYH+P GTRL++N+WK+HRD   W +P EFQPERFLTTH +++V GQH ELIPF
Sbjct  141  DCSVC-GYHIPKGTRLLVNVWKLHRDPDAWSDPEEFQPERFLTTHANLNVFGQHSELIPF  199

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
             SGRRSCPGI L+LQ LH+ +A LL  +D   P N  +DM+E  GL   K TPL+V LTP
Sbjct  200  SSGRRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTP  259

Query  95   RLPATVF  75
            RLP+ ++
Sbjct  260  RLPSLLY  266



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 188/252 (75%), Gaps = 5/252 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISG--FDADTIIKATCLNMLVAGSDAIAVTLTW  648
            +RR+S + +G  DF+DVML  +E + ++S   +D  T IK+TCL +++ GSD  A TLTW
Sbjct  250  RRRVSGQSEGDSDFIDVMLS-LEGEGKLSDLQYDPRTSIKSTCLALILGGSDTTAGTLTW  308

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            A++LLLNNR +L K QEE+D  +G+ R V +SDI+NLV+LQA+IKETLRLYP GP+ G R
Sbjct  309  AIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  368

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHK-DIDVRGQHF  291
             ++EDCT++ GY V AGTRL++N+WKI RD  +W  P EF+PERFLT  + + DVRGQ+F
Sbjct  369  EAMEDCTVA-GYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKETEYDVRGQNF  427

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            EL+PFGSGRRSCPG  L+LQ LH+ LA +LH FD    S+ ++DM ES GL   KATPL+
Sbjct  428  ELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGLTIPKATPLE  487

Query  110  VCLTPRLPATVF  75
            V LTPRL   ++
Sbjct  488  VLLTPRLEQELY  499



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 187/250 (75%), Gaps = 3/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            + R+S    GA +DF+  ML ++ DD Q SG D DTIIK TC N+++AG+D  ++TLTWA
Sbjct  343  QNRLSANDNGAEQDFIHAMLSVI-DDGQFSGRDPDTIIKGTCSNLILAGNDTTSITLTWA  401

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNNR  L K Q EL+  +G+ R V+ SDIKNLV+LQA++KETLRLYPPGP++    
Sbjct  402  LSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHE  461

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDCT++ G+H+ AGTRL++N+WK+HRD  +W +P EFQPERFLT H  +DVRG+++EL
Sbjct  462  AMEDCTVA-GFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYEL  520

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPGI  +L+  H+ LA LLH F+    ++  +DM+ES GL   KATPL+V 
Sbjct  521  LPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVT  580

Query  104  LTPRLPATVF  75
            + PRLP  ++
Sbjct  581  IVPRLPFELY  590



>emb|CBI36489.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 177/247 (72%), Gaps = 2/247 (1%)
 Frame = -1

Query  815  RMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSL  636
            R++ EG   +DF+DVML ++ED +   G   +T+IKAT + ++V G+D ++ T TW LS 
Sbjct  69   RLNSEGNKRQDFIDVMLSVLEDTSMF-GHSRETVIKATIMILIVGGTDTVSTTSTWLLSA  127

Query  635  LLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLE  456
            LLNN+  L   QEELD ++GRGR V ESDI NL++LQAVIKETLRLY   P++    ++E
Sbjct  128  LLNNKHALKCAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAME  187

Query  455  DCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPF  276
            DC ++ GYH+P GTRL +N WK+HRD S+W +P +FQPERFLTTH D+DV GQHFELIPF
Sbjct  188  DCHVA-GYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPF  246

Query  275  GSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTP  96
            GSGRRSCPGI ++L+ L + +  LL  FD + P N  +DM E   +   K TPL+V LTP
Sbjct  247  GSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTP  306

Query  95   RLPATVF  75
            RLP+  +
Sbjct  307  RLPSQFY  313



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 188/253 (74%), Gaps = 5/253 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQIS--GFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            +R++S   +   DF+DVML + E   ++S   +DA+T IK+TCL +++ GSD  A TLTW
Sbjct  273  QRKVSGNKENDSDFIDVMLSLAEQ-GKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            A++LLLNN+ +L K Q+E+D Q+G  RNV +SDI+NLV+LQA+IKETLRLYP GP+ G R
Sbjct  332  AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTH-KDIDVRGQHF  291
             ++EDCT++ GYHV  GTRL++N+WKI RD  +W EPNEF+PERFLT   K+ DVRGQ+F
Sbjct  392  EAMEDCTIA-GYHVSCGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNF  450

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRRSCPG  L++Q LH+ LA  LH FD     +  +DMSES GL   KATPL+
Sbjct  451  ELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLE  510

Query  110  VCLTPRLPATVFG  72
            V ++PRL   +F 
Sbjct  511  VMISPRLEKHLFA  523



>ref|XP_008391540.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=531

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 179/249 (72%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A +  FDADTI KAT LN++  G D   V L WA+
Sbjct  284  QRRAKGDAKGEKDFIDALLSVL-DGADLGSFDADTITKATSLNIIAGGGDTTMVPLIWAI  342

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN  +L K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP++G R  
Sbjct  343  SLLVNNPQVLKKAVNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPVGPLSGPRLF  402

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTRL+ N WKI  D   WPEP EF+PERFLTTHKD+D++G+HF+ +
Sbjct  403  TEDCTIA-GYHIRKGTRLIPNFWKIQTDPKNWPEPFEFKPERFLTTHKDVDLKGRHFQFL  461

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ NVKATPL V +
Sbjct  462  PFSSGRRSCPGLXFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGITNVKATPLNVLI  521

Query  101  TPRLPATVF  75
             PRL + ++
Sbjct  522  KPRLSSELY  530



>ref|XP_012072001.1| PREDICTED: cytochrome P450 82A3-like [Jatropha curcas]
 gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 177/249 (71%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            K+R S   +G   FM +ML I++      G  +D I KA  L++++  SD  AVTL WAL
Sbjct  278  KKRASGFKQGEEHFMGLMLNILDHTQVAQGPHSDPINKAVSLSLILVASDTTAVTLNWAL  337

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLL+NN + L K Q+ELD  +GR R + ESDIKNL +LQA++KETLRLYP GP++    S
Sbjct  338  SLLVNNPNALKKAQDELDMHVGRERQIQESDIKNLEYLQAILKETLRLYPAGPLSLPHES  397

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT+  GY +PAGT+L+INIWKIH D  +W  P EF+PERFLT+HKD DVRGQ+FE I
Sbjct  398  TEDCTVG-GYDIPAGTKLVINIWKIHHDPRVWENPFEFRPERFLTSHKDFDVRGQNFEFI  456

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI   LQ + + LA LLH FD   PSNE +DM+E+ GL N++ATPL++ +
Sbjct  457  PFGSGRRRCPGISFGLQVMQLTLANLLHSFDIETPSNEPVDMTENIGLTNLRATPLEILM  516

Query  101  TPRLPATVF  75
             PRLP  ++
Sbjct  517  HPRLPPHLY  525



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 188/253 (74%), Gaps = 5/253 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQIS--GFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            +R++S   +   DF+DVML + E   ++S   +DA+T IK+TCL +++ GSD  A TLTW
Sbjct  273  QRKVSGNKENDSDFIDVMLSLAEQ-GKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            A++LLLNN+ +L K Q+E+D Q+G  RNV +SDI+NLV+LQA+IKETLRLYP GP+ G R
Sbjct  332  AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTH-KDIDVRGQHF  291
             ++EDCT++ GYHV  GTRL++N+WKI RD  +W EPNEF+PERFLT   K+ DVRGQ+F
Sbjct  392  EAMEDCTVA-GYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNF  450

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRRSCPG  L++Q LH+ LA  LH FD     +  +DMSES GL   KATPL+
Sbjct  451  ELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLE  510

Query  110  VCLTPRLPATVFG  72
            V ++PRL   +F 
Sbjct  511  VMISPRLEKHLFA  523



>ref|XP_006423133.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
 ref|XP_006479370.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR36373.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
Length=524

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 185/249 (74%), Gaps = 3/249 (1%)
 Frame = -1

Query  818  RRMSEEGKGA-RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R++E  K   +DF+DVML ++ DD + S  DADT+IK+TCL++++ G+D   VTLTWAL
Sbjct  277  KRLNESIKEEEKDFIDVMLSVL-DDGKTSAEDADTVIKSTCLSLILGGNDTTVVTLTWAL  335

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  +L K Q+EL   +G  R V ESDIKNL++LQA++KETLRLYP  P++  R +
Sbjct  336  SLLLNNHHVLKKAQDELSIHVGNNRQVEESDIKNLIYLQAIVKETLRLYPALPLSAPREA  395

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC +  G+H+PAGTRL++N+WK+HRD SIW  P+EF PERFL  + +++V+GQ FE +
Sbjct  396  MEDCIIG-GFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPERFLNENANLEVKGQDFEFL  454

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI  +LQ LH+ LA LLH F+    S+  +DM ES G+   KAT L+V L
Sbjct  455  PFGSGRRKCPGISFALQVLHLTLARLLHAFELGTVSDTLVDMRESPGMTVPKATALEVTL  514

Query  101  TPRLPATVF  75
            TPRLP+ ++
Sbjct  515  TPRLPSKLY  523



>gb|KEH37856.1| cytochrome P450 family protein [Medicago truncatula]
Length=524

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 180/239 (75%), Gaps = 2/239 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            E K  +DF+DV+L ++     + G+D DT+IKATCL ++   +D   VT+TWALSLLLNN
Sbjct  279  ETKMEQDFIDVLLSVLHG-VHLDGYDVDTVIKATCLTLIAGATDTTTVTITWALSLLLNN  337

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
            R  L K+Q+ELD ++G+ R VNESDI NLV+LQAV+KETLRLYP GP++G R   E+CT+
Sbjct  338  RHTLKKIQDELDEKVGKDRLVNESDINNLVYLQAVVKETLRLYPAGPLSGARQFTENCTV  397

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GY++ AGTRL++N+WK+HRD  +W +P EFQPERFL THKD+DV+GQH+EL+PFG GR
Sbjct  398  G-GYNIQAGTRLILNLWKMHRDPRVWSKPLEFQPERFLNTHKDVDVKGQHYELLPFGGGR  456

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RSCPGI   LQ  ++ LA+ L  F+   PSN ++DMS + GL N+K TPL+V   PRLP
Sbjct  457  RSCPGITFGLQMTNLALASFLQAFEVTTPSNAQVDMSATFGLTNIKTTPLEVIAKPRLP  515



>ref|XP_008219217.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=533

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 180/244 (74%), Gaps = 2/244 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISG-FDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            +G   RDFMD M+  ++DD +++  +DADTI KAT L +L+AG D    TL+WALSLLLN
Sbjct  290  KGDDDRDFMDTMISFLDDDLKVTKEYDADTINKATALTILLAGVDVTTGTLSWALSLLLN  349

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
            +   L + QEELD  IGR R V ESDI NLV+LQAV+KET+RLYPPGPV     S EDC 
Sbjct  350  SPETLKRAQEELDQIIGRERQVKESDIDNLVYLQAVLKETMRLYPPGPVPLAHVSTEDCI  409

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            L  GYH+PA TR+ INI KI  D   WPEPNEF+PERFLTTHK+IDVRGQ FELIPF SG
Sbjct  410  LG-GYHIPAKTRVFINIGKIQLDPKTWPEPNEFRPERFLTTHKNIDVRGQDFELIPFSSG  468

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RR C G+ L+++ + + LA+LLH F+ A PS+E +DMSE+  L N K++ L+V +TPRLP
Sbjct  469  RRMCAGLSLAMKMMPLALASLLHGFEIATPSDEPVDMSENMELTNHKSSLLEVVVTPRLP  528

Query  86   ATVF  75
            A ++
Sbjct  529  AQLY  532



>ref|XP_004306669.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 180/244 (74%), Gaps = 6/244 (2%)
 Frame = -1

Query  794  GARDFMDVMLEIMEDDAQISGFD----ADTIIKATCLNMLVAGSDAIAVTLTWALSLLLN  627
            G  DFMD++L +++DD  I  F     ADTI KATCL++L+ G+D  AVTLTWALSLLLN
Sbjct  290  GENDFMDMVLSVLDDDC-IQDFGGSVTADTISKATCLSVLLGGTDTTAVTLTWALSLLLN  348

Query  626  NRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCT  447
            N  +L K Q ELD  +GR R VNESD+KNLV+LQA++KETLRLYP  P++    S EDCT
Sbjct  349  NPEVLKKAQLELDNHVGRDRQVNESDVKNLVYLQAIMKETLRLYPAAPLSVPHESREDCT  408

Query  446  LSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSG  267
            +   YHV +GTRL+IN+ KI RD +IW EP +FQPERFLTTHK++DVRGQ  E  PFG+G
Sbjct  409  VGD-YHVSSGTRLLINLSKIQRDPNIWIEPCKFQPERFLTTHKNVDVRGQSLEFTPFGTG  467

Query  266  RRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLP  87
            RR CPGI L+LQ   + LA LLH F+   PS E +DM ES+GL N+KATPL+V LTPRL 
Sbjct  468  RRICPGISLALQVTQLTLAHLLHGFEITAPSGEPVDMGESSGLTNMKATPLEVFLTPRLH  527

Query  86   ATVF  75
              ++
Sbjct  528  PKLY  531



>gb|KHG07801.1| Cytochrome P450 [Gossypium arboreum]
Length=523

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 180/243 (74%), Gaps = 2/243 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            E K  +DFMDVM  +++  A ++G+DADTI KAT LNM++AG D   V L W LSL+LNN
Sbjct  282  ENKKEKDFMDVMNSVLKG-ASLAGYDADTINKATSLNMILAGGDTTTVALVWCLSLMLNN  340

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
              IL K QEELDT I + R VNE+DI  LV++QA+IKET R+YP  P++  R   E C++
Sbjct  341  PRILKKAQEELDTHISKDRFVNETDIGKLVYIQAIIKETFRMYPSAPLSAPRELNESCSI  400

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
              GY++P GTRL+IN+ KI RD   WPEP +F+PERFLTTHKD+DV+GQHFEL+PFGSGR
Sbjct  401  G-GYNIPKGTRLIINLHKIQRDPKKWPEPLKFKPERFLTTHKDVDVKGQHFELMPFGSGR  459

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPA  84
            RSCPG   +L  L++ ++  LH FDF++PSN  ID++ + GL N+K+TPL+V ++PRL  
Sbjct  460  RSCPGTSFALHMLYLTVSNFLHAFDFSVPSNGLIDLTGTVGLTNMKSTPLEVLVSPRLAP  519

Query  83   TVF  75
             ++
Sbjct  520  ELY  522



>gb|KHN08850.1| Cytochrome P450 82C4 [Glycine soja]
Length=428

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 175/249 (70%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KRR+  +G    DFMD M+   E+  +I G+  +T+IKAT + +++ GS +IA+TLTWAL
Sbjct  178  KRRVERDGGCESDFMDAMISKFEEQEEICGYKRETVIKATSMLLILTGSGSIAITLTWAL  237

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+  +L   Q+EL+T IG+ R V ESDIKNL +L A+IKETLRLYPP P+ G+R  
Sbjct  238  SLLLNHPKVLKAAQQELNTHIGKERWVLESDIKNLTYLHAIIKETLRLYPPAPLTGIREV  297

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC ++ GYHVP GTRL+IN+W + RD  +WP PNEFQPERFLTTH+DID   Q+FELI
Sbjct  298  MEDCCVA-GYHVPKGTRLLINLWNLQRDPQVWPNPNEFQPERFLTTHQDIDFMSQNFELI  356

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF  GRRSCPG+   LQ LH+ LA LL  FD       ++DM+E  GL   K   L+V L
Sbjct  357  PFSYGRRSCPGMTFGLQVLHLTLARLLQGFDMCPKDGVEVDMTEGLGLALPKEHALQVIL  416

Query  101  TPRLPATVF  75
             PRLP  ++
Sbjct  417  QPRLPLELY  425



>ref|XP_012085047.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
 gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 179/238 (75%), Gaps = 2/238 (1%)
 Frame = -1

Query  788  RDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILD  609
            +DF+DVML ++EDD    G   D IIK+T ++++VAGSD  ++T+TWALS LLNNR  L+
Sbjct  276  KDFIDVMLSVIEDDTTF-GHKCDVIIKSTAMSLIVAGSDTTSITMTWALSSLLNNRKTLE  334

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            ++QEELD ++GR R V++SDI+ L +  AVIKETLRLYPPGP+   R + EDCT++ GYH
Sbjct  335  RLQEELDQKVGRDRWVDDSDIEKLDYFSAVIKETLRLYPPGPLGVPREATEDCTIA-GYH  393

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +P GTRL  N+WK+HRD ++W +P EF+PERFLT + ++DV GQHFE +PFG+GRRSCPG
Sbjct  394  IPKGTRLFTNLWKLHRDPNVWADPEEFKPERFLTDNANLDVSGQHFEYLPFGAGRRSCPG  453

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            +  ++Q ++I LA LL  +DF  P NE +DM+E  G+   K TPL+V LTPRL   ++
Sbjct  454  LNFAMQVMNITLARLLQAYDFRTPGNEPVDMTEGKGIALPKITPLEVVLTPRLAPELY  511



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 181/253 (72%), Gaps = 8/253 (3%)
 Frame = -1

Query  806  EEG---KGARDFMDVMLEIMEDDA----QISGFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            EEG   K  +DFMDVMLE ++  A     I  +  +TI+KAT LN+L+AG D  ++TLTW
Sbjct  293  EEGLVRKEEKDFMDVMLESLDSLAIGEEPIFVYKRETIVKATALNLLLAGIDTTSITLTW  352

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            ALSLLLN+  +L + Q+E+D  +G  R V ESDIKNLV+LQA++KETLRLYPPGP+   R
Sbjct  353  ALSLLLNHTEVLKRAQKEIDIHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPR  412

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFE  288
             SLEDC +  GY VP GT+L++N WK+HRD  IW  P EF PERFLT+H   DVRGQ FE
Sbjct  413  ESLEDCYVD-GYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFE  471

Query  287  LIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKV  108
             +PFGSGRRSCPGI  SLQ LH+ L+ LL  F+F+ P N ++DMSE  GL   KATPL+V
Sbjct  472  YVPFGSGRRSCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTMPKATPLEV  531

Query  107  CLTPRLPATVFGH  69
             LTPRL   ++ H
Sbjct  532  VLTPRLENEIYQH  544



>gb|KHN44000.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (73%), Gaps = 2/249 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            KR + E   GA+DFM+VML  + D   I G DADT+IK+T L ++ AG++A   T+ WA+
Sbjct  274  KRALGEGVDGAQDFMNVMLSSL-DGKTIDGIDADTLIKSTVLTIIQAGTEASITTIIWAM  332

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
             L+L N  IL+K++ ELD Q+G+ R + ESDI NLV+LQAV+KET RLY PGP++  R  
Sbjct  333  CLILKNPLILEKIKAELDIQVGKDRCICESDISNLVYLQAVVKETFRLYAPGPLSSPREF  392

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCTL  GYHV  GTRL+ NIWKIH D ++W +P EF+P+RFLTTHKDIDV+G HF+L+
Sbjct  393  AEDCTLG-GYHVKKGTRLITNIWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKGHHFQLL  451

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PFGSGRR CPGI   LQT+H+ LA+ LH F+   PS E +DM+E+ G+ N KATPL+V +
Sbjct  452  PFGSGRRVCPGISFGLQTVHLALASFLHSFEILNPSTEPLDMTEAFGVTNTKATPLEVLV  511

Query  101  TPRLPATVF  75
             P L  + +
Sbjct  512  KPCLSPSCY  520



>ref|XP_012071999.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
Length=528

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 181/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSE-EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            KR  SE   KG  DFMDVML I+++  ++   DADTI KATCL + +A SD   +TLTWA
Sbjct  280  KRSSSECNVKGEEDFMDVMLSILDEAEELPCHDADTIKKATCLALTLAASDTTKITLTWA  339

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LS LL N  +L K Q ELDT+IGR RN+ E D+K LV+++A+IKETLRL P  P++    
Sbjct  340  LSFLLKNGEVLKKAQLELDTEIGRERNIEEPDMKKLVYIEAIIKETLRLEPAAPLSVPHE  399

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            S+EDC +   Y +P GTRL++N+WK+HRD  IW +P EF+PERFLTTHKD DV+GQ+FEL
Sbjct  400  SMEDCVVG-SYDIPKGTRLLVNLWKMHRDPRIWLDPYEFRPERFLTTHKDFDVKGQNFEL  458

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            +PFGSGRR CPG+  +LQ + + LA LLH FD ++PS ++ID+ E  G+ N +AT L V 
Sbjct  459  MPFGSGRRMCPGVSFALQVMQLTLANLLHAFDISVPSGKQIDLVEGFGVTNNEATQLDVV  518

Query  104  LTPRLPATVF  75
            L PRLPA ++
Sbjct  519  LCPRLPAYLY  528



>emb|CBI29742.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 169/225 (75%), Gaps = 1/225 (0%)
 Frame = -1

Query  749  DAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRSILDKVQEELDTQIGRG  570
            DA + G+  +TIIKAT + ++VAGSD  ++T TW LS LLNNR ++   QEELD ++GR 
Sbjct  7    DASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVMKHAQEELDLKVGRD  66

Query  569  RNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYHVPAGTRLMINIWK  390
            R V +SDI+NLV+L+A++KETLRLYP  P+     ++EDC +  GYH+P GTRL++N WK
Sbjct  67   RWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVG-GYHIPKGTRLLVNAWK  125

Query  389  IHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPGIQLSLQTLHICLA  210
            +HRD ++W  P EFQPERFLT+H  +DV GQ+FELIPFGSGRRSCPGI ++LQ LH+ +A
Sbjct  126  LHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINMALQMLHLTIA  185

Query  209  TLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
             LL  FD A PSN  +DM+E+  +   K TPL+V LTPRLPA ++
Sbjct  186  QLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLPAELY  230



>gb|KCW55291.1| hypothetical protein EUGRSUZ_I01217 [Eucalyptus grandis]
Length=305

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 180/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIME-DDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R +++     +DF+  ML   E ++ + S  +ADTI+KATCL+M++ G+D I +TLTWA
Sbjct  57   RRAVAKVEDDEQDFIHFMLSATELEEGKYSVQEADTIVKATCLSMILGGNDTIVLTLTWA  116

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LSLLLNN   L++ Q+ELD Q+G+ R V ESDIKNL +LQAV+KETLR+YP  P++  R 
Sbjct  117  LSLLLNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVVKETLRIYPVLPLSLQRE  176

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            ++EDC ++ G+HVPAGTRLM+N+WK+ RD  +W   +EFQPERFLT H  +DVRGQ FE 
Sbjct  177  AMEDCIVA-GFHVPAGTRLMVNLWKLQRDPRVWSHASEFQPERFLTDHVHVDVRGQSFEY  235

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFG+GRR CPG+   LQ + + LA LLH F     S  ++DMSES  L   +ATPL+  
Sbjct  236  IPFGTGRRMCPGVSFGLQVVQLILARLLHAFKLERVSGSEVDMSESPALTMPRATPLEAV  295

Query  104  LTPRLPATVF  75
            LTPRLPAT +
Sbjct  296  LTPRLPATCY  305



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 173/249 (69%), Gaps = 1/249 (0%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +R+   +G    DFMDVML  +  DA ISG   DTI+KAT L + + G ++ +VT+TW L
Sbjct  272  RRKRESQGSCESDFMDVMLANLPQDAVISGHTRDTIVKATTLILTMTGGESTSVTMTWVL  331

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLN+ S+L   Q+ELD  +G  R V ESDIK+L +LQA++KETLRLYPPGP+ G+R +
Sbjct  332  SLLLNHPSVLKAAQQELDLHVGIDRWVEESDIKSLKYLQAIVKETLRLYPPGPLTGIREA  391

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
            +EDC ++ GYHVP GTRL++N+WK+ RD  +W  P EFQPERFLTTH D DVRGQ+FE I
Sbjct  392  MEDCCIA-GYHVPKGTRLIVNLWKLQRDPRVWENPGEFQPERFLTTHADFDVRGQNFEYI  450

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCP I   LQ +H+ LA LL  FD   P  + +DM E  GL   K TPL V L
Sbjct  451  PFSSGRRSCPAITFGLQVVHLTLAKLLQGFDIRTPDGKPVDMGEGLGLALPKRTPLDVVL  510

Query  101  TPRLPATVF  75
            TPRL    +
Sbjct  511  TPRLAHEFY  519



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 193/254 (76%), Gaps = 6/254 (2%)
 Frame = -1

Query  821  KRRMSE-EGKGARDFMDVMLEIMEDDAQISGF--DADTIIKATCLNMLVAGSDAIAVTLT  651
            KRR+SE + +GA+DF+DVML + E+  ++S F  DADT IK+TCL +++ GSD  A TLT
Sbjct  271  KRRLSEGKNEGAQDFIDVMLSLQEE-GRLSNFQYDADTSIKSTCLALILGGSDTTAGTLT  329

Query  650  WALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGL  471
            WA+SLLLNN  IL K QEE+D  +G+ R V+ESDI+NL ++QA+IKETLRLYP GP+ G 
Sbjct  330  WAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLLGP  389

Query  470  RSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHF  291
            R ++++C +  GY +  GTRL++N+WKI RD  IW +P+ F+P+RFL ++ ++DV+GQ F
Sbjct  390  REAMDECEVG-GYKITPGTRLIVNVWKIQRDPRIWEDPDSFKPDRFLMSNSNVDVKGQDF  448

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEK-IDMSESAGLINVKATPL  114
            ELIPFGSGRRSCPG+ L+LQ LH+ LA  L  F+F+ P  ++ ID++ES GL   KATPL
Sbjct  449  ELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKPVGDQLIDLTESPGLTIPKATPL  508

Query  113  KVCLTPRLPATVFG  72
             V +TPRL A ++G
Sbjct  509  DVLITPRLNANLYG  522



>ref|XP_008466638.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=532

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 177/238 (74%), Gaps = 2/238 (1%)
 Frame = -1

Query  785  DFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNNRS-ILD  609
            DFMDVML  ++D  +++G+D  TI KATCL +++ G++    TLTWAL LLLNN   +L 
Sbjct  295  DFMDVMLSTVQDVEELAGYDVGTITKATCLTLILGGAETTQTTLTWALCLLLNNNEDVLM  354

Query  608  KVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTLSQGYH  429
            K Q ELD Q+GR R V+ESD+KNL++LQA+IKET+RLYP  P+  +  ++EDC L  GYH
Sbjct  355  KAQLELDEQVGRDRLVSESDVKNLLYLQAIIKETMRLYPAAPLAAMHEAMEDCNLV-GYH  413

Query  428  VPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGRRSCPG  249
            +PA TRL++N+ K+ +D  +W +P+EF+PERFLTTHKD DVRGQH + IPFGSGRR CPG
Sbjct  414  IPAKTRLIVNLKKLQKDPLVWEDPDEFRPERFLTTHKDFDVRGQHTQFIPFGSGRRMCPG  473

Query  248  IQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPATVF  75
            +  + Q +H+ LA LLH F+   PS E I+M E  GL ++K TPL++ LTPRLPA V+
Sbjct  474  VSFANQVMHLTLANLLHGFEIRRPSQELINMEEKVGLTSMKTTPLEIFLTPRLPAQVY  531



>ref|XP_003611843.1| Cytochrome P450 82A3 [Medicago truncatula]
Length=213

 Score =   280 bits (716),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 167/207 (81%), Gaps = 0/207 (0%)
 Frame = -1

Query  695  NMLVAGSDAIAVTLTWALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVI  516
            N+++AGSD   VTLTWALSLLLN++  L+KVQ+EL+T IG+ R V+ESDIKNLV+LQAV+
Sbjct  5    NLILAGSDTTMVTLTWALSLLLNHQMELNKVQDELNTHIGKDRKVDESDIKNLVYLQAVV  64

Query  515  KETLRLYPPGPVNGLRSSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPER  336
            KETLRLYPP P+  L +++ DCT S GYH+PAGT+L++N+WKIHRD  +W +P++F+P R
Sbjct  65   KETLRLYPPSPIITLHAAMNDCTFSCGYHIPAGTQLIVNVWKIHRDARVWTDPHDFKPGR  124

Query  335  FLTTHKDIDVRGQHFELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDM  156
            FLT+H+D+DVR  ++EL+PFGSGRR CPG  L+L+ + + LA LLH F+   PSN+ +DM
Sbjct  125  FLTSHRDVDVRSPNYELVPFGSGRRVCPGASLALRVVQLTLARLLHSFNVVSPSNQSVDM  184

Query  155  SESAGLINVKATPLKVCLTPRLPATVF  75
            + S GL N+KATPL+V LTPRL   ++
Sbjct  185  TGSPGLTNLKATPLEVVLTPRLDTNLY  211



>ref|XP_010064545.1| PREDICTED: cytochrome P450 82A3-like [Eucalyptus grandis]
 gb|KCW67751.1| hypothetical protein EUGRSUZ_F01484 [Eucalyptus grandis]
Length=271

 Score =   282 bits (721),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 173/243 (71%), Gaps = 2/243 (1%)
 Frame = -1

Query  803  EGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWALSLLLNN  624
            E +G RDFMDVML  + +   I GFDADTI+KATCL +L   +D+  +TLTWA+SLLLNN
Sbjct  28   EKRGDRDFMDVMLSTL-NGMDIGGFDADTIVKATCLAVLSGATDSTTITLTWAISLLLNN  86

Query  623  RSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSSLEDCTL  444
            R +L K QEEL TQIG+ R+VNESD  NL +L  ++KE LRL+PP P+     S +DC +
Sbjct  87   RHVLKKAQEELYTQIGKQRHVNESDFNNLTYLYGIVKEILRLHPPVPLAVPHVSTQDCII  146

Query  443  SQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELIPFGSGR  264
            + GY+VP   RL++N+WKI  D   WPEP +F+PERFL +HKD+ V+  +FE +PFG GR
Sbjct  147  N-GYYVPKDARLILNLWKIQTDSRAWPEPMKFRPERFLNSHKDLGVKDPNFEYMPFGGGR  205

Query  263  RSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCLTPRLPA  84
            R CPG+   LQ++H+ LA LLH F+ + P N  +DMSES G+   K TPL+V L+PRLP 
Sbjct  206  RICPGMSFGLQSVHLVLAKLLHAFEVSTPDNSPVDMSESFGITVGKETPLEVMLSPRLPT  265

Query  83   TVF  75
             V+
Sbjct  266  EVY  268



>gb|KJB10202.1| hypothetical protein B456_001G188600 [Gossypium raimondii]
Length=530

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 185/252 (73%), Gaps = 4/252 (2%)
 Frame = -1

Query  818  RRMSEEGK--GARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWA  645
            +R+  E K     DF+D+ML  +E+D+   G+  +TIIKA  +N+ +AGSD  ++TLTW 
Sbjct  279  KRLKIEAKPENTPDFIDIMLSAIEEDSMF-GYSRETIIKANVMNLFLAGSDTTSITLTWI  337

Query  644  LSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRS  465
            LS L+NNR  L   QEELD ++GR + V +SDI+ LV+LQAV+KETLRLYPPGP++    
Sbjct  338  LSNLMNNRHALKCAQEELDLKVGRDKWVQDSDIEKLVYLQAVVKETLRLYPPGPISVPHE  397

Query  464  SLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFEL  285
            + EDC++  GYHV  GTR+++N+WK+HRD  +W  P+ F+PERFLT+H D+DV GQHFEL
Sbjct  398  ASEDCSIG-GYHVGKGTRVIVNLWKLHRDPQVWSNPDVFEPERFLTSHADVDVLGQHFEL  456

Query  284  IPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVC  105
            IPFGSGRRSCPGI L+LQ  H+ +A++L  F+ + P  E +DMSE  G+   KATPL+V 
Sbjct  457  IPFGSGRRSCPGITLALQMTHLTIASILQGFELSTPFGETVDMSEGLGITMPKATPLEVI  516

Query  104  LTPRLPATVFGH  69
            L+PRLP+ ++ H
Sbjct  517  LSPRLPSAMYLH  528



>ref|XP_009364766.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 177/250 (71%), Gaps = 2/250 (1%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQISGFDADTIIKATCLNMLVAGSDAIAVTLTWAL  642
            +RR   + KG +DF+D +L ++ D A +  FDADT+ KAT L ++  GSD   V +TWA+
Sbjct  284  QRRAKGDAKGEQDFIDALLSVL-DGADLGSFDADTVTKATSLTVIAGGSDTTMVAMTWAI  342

Query  641  SLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLRSS  462
            SLLLNN  ++ K   ELDT+IG+ R V+E DI NLV++QA++KETLRLYP GP++G R  
Sbjct  343  SLLLNNPHVMKKALNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPGGPLSGPRIF  402

Query  461  LEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTHKDIDVRGQHFELI  282
             EDCT++ GYH+  GTR + N WKI  D   WPEP EF+PERFLTTHKD+D++G HF+ I
Sbjct  403  TEDCTIA-GYHIQKGTRFIPNFWKIQTDPKNWPEPFEFKPERFLTTHKDVDLKGHHFQFI  461

Query  281  PFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLKVCL  102
            PF SGRRSCPG+   LQ +   LA+ LH F+ + PS+  IDM+ES G+ N+KA PL V +
Sbjct  462  PFSSGRRSCPGLVFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGMTNLKAAPLNVLI  521

Query  101  TPRLPATVFG  72
             PRL   ++G
Sbjct  522  KPRLSFELYG  531



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 186/247 (75%), Gaps = 5/247 (2%)
 Frame = -1

Query  821  KRRMSEEGKGARDFMDVMLEIMEDDAQIS--GFDADTIIKATCLNMLVAGSDAIAVTLTW  648
            +R++S   +   DF+DVML + E   ++S   +DA+T IK+TCL +++ GSD  A TLTW
Sbjct  273  QRKVSGNKENDSDFIDVMLSLAEQ-GKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  647  ALSLLLNNRSILDKVQEELDTQIGRGRNVNESDIKNLVFLQAVIKETLRLYPPGPVNGLR  468
            A++LLLNN+ +L K Q+E+D Q+G  RNV +SDI+NLV+LQA+IKETLRLYP GP+ G R
Sbjct  332  AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  467  SSLEDCTLSQGYHVPAGTRLMINIWKIHRDESIWPEPNEFQPERFLTTH-KDIDVRGQHF  291
             ++EDCT++ GYHV  GTRL++N+WKI RD  +W EPNEF+PERFLT   K+ DVRGQ+F
Sbjct  392  EAMEDCTVA-GYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNF  450

Query  290  ELIPFGSGRRSCPGIQLSLQTLHICLATLLHCFDFALPSNEKIDMSESAGLINVKATPLK  111
            ELIPFGSGRRSCPG  L++Q LH+ LA  LH FD     +  +DMSES GL   KATPL+
Sbjct  451  ELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLE  510

Query  110  VCLTPRL  90
            V ++PRL
Sbjct  511  VMISPRL  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104