BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4237

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW80777.1|  hypothetical protein EUGRSUZ_C021581                    234   5e-73   Eucalyptus grandis [rose gum]
ref|XP_010278479.1|  PREDICTED: chloroplast envelope membrane pro...    239   3e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010656697.1|  PREDICTED: chloroplast envelope membrane pro...    233   1e-70   Vitis vinifera
ref|XP_010048512.1|  PREDICTED: chloroplast envelope membrane pro...    234   3e-70   Eucalyptus grandis [rose gum]
ref|XP_002267030.2|  PREDICTED: chloroplast envelope membrane pro...    234   3e-70   Vitis vinifera
emb|CBI24050.3|  unnamed protein product                                233   3e-70   Vitis vinifera
ref|XP_006372256.1|  proton extrusion family protein                    234   4e-70   
gb|KDP45838.1|  hypothetical protein JCGZ_17445                         230   8e-70   Jatropha curcas
ref|XP_011078172.1|  PREDICTED: chloroplast envelope membrane pro...    233   1e-69   Sesamum indicum [beniseed]
ref|XP_003516797.1|  PREDICTED: chloroplast envelope membrane pro...    232   2e-69   Glycine max [soybeans]
gb|KHN32931.1|  Chloroplast envelope membrane protein                   232   2e-69   Glycine soja [wild soybean]
ref|XP_011019941.1|  PREDICTED: chloroplast envelope membrane pro...    231   4e-69   Populus euphratica
emb|CDP14250.1|  unnamed protein product                                231   5e-69   Coffea canephora [robusta coffee]
ref|XP_011019940.1|  PREDICTED: chloroplast envelope membrane pro...    231   5e-69   Populus euphratica
gb|KHN24979.1|  Chloroplast envelope membrane protein                   230   8e-69   Glycine soja [wild soybean]
ref|XP_003532317.1|  PREDICTED: chloroplast envelope membrane pro...    230   8e-69   Glycine max [soybeans]
ref|XP_002309032.1|  proton extrusion family protein                    230   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_012079808.1|  PREDICTED: chloroplast envelope membrane pro...    229   1e-68   Jatropha curcas
gb|ACU19500.1|  unknown                                                 228   5e-68   Glycine max [soybeans]
gb|KJB53671.1|  hypothetical protein B456_009G000300                    224   5e-68   Gossypium raimondii
ref|XP_009376337.1|  PREDICTED: chloroplast envelope membrane pro...    228   7e-68   Pyrus x bretschneideri [bai li]
ref|XP_008224570.1|  PREDICTED: chloroplast envelope membrane pro...    227   7e-68   Prunus mume [ume]
ref|XP_009338666.1|  PREDICTED: chloroplast envelope membrane pro...    228   8e-68   Pyrus x bretschneideri [bai li]
ref|XP_009787228.1|  PREDICTED: chloroplast envelope membrane pro...    228   8e-68   Nicotiana sylvestris
ref|XP_011648976.1|  PREDICTED: chloroplast envelope membrane pro...    228   1e-67   Cucumis sativus [cucumbers]
ref|XP_010095213.1|  Proton extrusion protein PcxA                      228   1e-67   Morus notabilis
ref|XP_010928741.1|  PREDICTED: chloroplast envelope membrane pro...    222   1e-67   
ref|XP_008393390.1|  PREDICTED: chloroplast envelope membrane pro...    227   2e-67   
ref|XP_011625786.1|  PREDICTED: chloroplast envelope membrane pro...    223   2e-67   
ref|XP_007222729.1|  hypothetical protein PRUPE_ppa006489mg             226   2e-67   Prunus persica
ref|XP_004296645.1|  PREDICTED: chloroplast envelope membrane pro...    226   2e-67   Fragaria vesca subsp. vesca
ref|XP_008450426.1|  PREDICTED: chloroplast envelope membrane pro...    226   3e-67   
ref|XP_010693714.1|  PREDICTED: chloroplast envelope membrane pro...    226   4e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007153007.1|  hypothetical protein PHAVU_004G178700g             226   6e-67   Phaseolus vulgaris [French bean]
gb|KHG26078.1|  Proton extrusion PcxA                                   224   1e-66   Gossypium arboreum [tree cotton]
ref|XP_006412637.1|  hypothetical protein EUTSA_v10025215mg             225   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_004513126.1|  PREDICTED: chloroplast envelope membrane pro...    225   1e-66   Cicer arietinum [garbanzo]
ref|XP_006436389.1|  hypothetical protein CICLE_v10033693mg             216   2e-66   
ref|XP_009127292.1|  PREDICTED: chloroplast envelope membrane pro...    224   3e-66   Brassica rapa
emb|CDX68718.1|  BnaC01g07350D                                          224   3e-66   
emb|CDY28239.1|  BnaA01g06100D                                          224   3e-66   Brassica napus [oilseed rape]
ref|XP_011093931.1|  PREDICTED: chloroplast envelope membrane pro...    223   4e-66   Sesamum indicum [beniseed]
ref|XP_010527110.1|  PREDICTED: chloroplast envelope membrane pro...    216   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_009620166.1|  PREDICTED: chloroplast envelope membrane pro...    223   6e-66   Nicotiana tomentosiformis
gb|ERN12584.1|  hypothetical protein AMTR_s00025p00217750               222   8e-66   Amborella trichopoda
gb|EYU25775.1|  hypothetical protein MIMGU_mgv1a026960mg                221   1e-65   Erythranthe guttata [common monkey flower]
ref|XP_010928740.1|  PREDICTED: chloroplast envelope membrane pro...    220   1e-65   
ref|XP_006282610.1|  hypothetical protein CARUB_v10004828mg             222   2e-65   Capsella rubella
ref|XP_010447624.1|  PREDICTED: chloroplast envelope membrane pro...    222   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002867316.1|  hypothetical protein ARALYDRAFT_913365             222   2e-65   Arabidopsis lyrata subsp. lyrata
dbj|BAD43985.1|  unknown protein                                        222   2e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44317.1|  unknown protein                                        222   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KJB53667.1|  hypothetical protein B456_009G000300                    221   2e-65   Gossypium raimondii
ref|NP_567865.1|  CemA-like proton extrusion protein-like protein       222   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525825.1|  PREDICTED: chloroplast envelope membrane pro...    221   2e-65   Tarenaya hassleriana [spider flower]
gb|AAM64630.1|  unknown                                                 221   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438087.1|  PREDICTED: chloroplast envelope membrane pro...    221   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010432908.1|  PREDICTED: chloroplast envelope membrane pro...    221   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010928739.1|  PREDICTED: chloroplast envelope membrane pro...    221   3e-65   Elaeis guineensis
dbj|BAD44262.1|  unknown protein                                        220   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789722.1|  PREDICTED: chloroplast envelope membrane pro...    219   1e-64   
ref|XP_007014089.1|  CemA-like proton extrusion protein-related i...    219   2e-64   
ref|XP_009420410.1|  PREDICTED: chloroplast envelope membrane pro...    219   2e-64   
ref|XP_011078171.1|  PREDICTED: chloroplast envelope membrane pro...    219   3e-64   Sesamum indicum [beniseed]
gb|KFK29684.1|  hypothetical protein AALP_AA7G165300                    217   7e-64   Arabis alpina [alpine rockcress]
ref|XP_006468098.1|  PREDICTED: chloroplast envelope membrane pro...    214   2e-62   Citrus sinensis [apfelsine]
ref|XP_008781702.1|  PREDICTED: chloroplast envelope membrane pro...    212   7e-62   
ref|XP_009382830.1|  PREDICTED: chloroplast envelope membrane pro...    212   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC83122.1|  hypothetical protein OsI_28281                          201   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_006659940.1|  PREDICTED: chloroplast envelope membrane pro...    200   3e-57   
dbj|BAD02988.1|  putative heme binding protein cemA                     200   5e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010278478.1|  PREDICTED: uncharacterized protein LOC104612...    196   4e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008649946.1|  PREDICTED: chloroplast envelope membrane pro...    195   4e-55   Zea mays [maize]
ref|XP_003573565.1|  PREDICTED: chloroplast envelope membrane pro...    194   4e-55   
ref|XP_010278477.1|  PREDICTED: uncharacterized protein LOC104612...    196   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_011078174.1|  PREDICTED: chloroplast envelope membrane pro...    192   2e-54   Sesamum indicum [beniseed]
ref|XP_011078173.1|  PREDICTED: chloroplast envelope membrane pro...    192   3e-54   Sesamum indicum [beniseed]
ref|NP_001143182.1|  uncharacterized protein LOC100275682               192   4e-54   
ref|XP_008669837.1|  PREDICTED: uncharacterized protein LOC100275...    192   4e-54   Zea mays [maize]
ref|XP_008658167.1|  PREDICTED: uncharacterized protein LOC100216...    190   2e-53   
dbj|BAK06987.1|  predicted protein                                      190   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT15927.1|  hypothetical protein SHCRBa_040_O01_F_70                189   4e-53   Saccharum hybrid cultivar R570
gb|AGT17438.1|  hypothetical protein SHCRBa_062_F01_R_230               189   4e-53   Saccharum hybrid cultivar R570
gb|EPS63936.1|  hypothetical protein M569_10843                         184   2e-51   Genlisea aurea
gb|AGT16440.1|  hypothetical protein SHCRBa_062_I05_F_110               180   2e-49   Saccharum hybrid cultivar R570
gb|KDO37118.1|  hypothetical protein CISIN_1g033027mg                   170   4e-49   Citrus sinensis [apfelsine]
ref|XP_004243667.1|  PREDICTED: chloroplast envelope membrane pro...    177   2e-48   
gb|AGT15926.1|  hypothetical protein SHCRBa_040_O01_F_60                176   2e-48   Saccharum hybrid cultivar R570
gb|AGT16439.1|  hypothetical protein SHCRBa_062_I05_F_100               176   3e-48   Saccharum hybrid cultivar R570
ref|XP_002466007.1|  hypothetical protein SORBIDRAFT_01g049970          176   3e-48   Sorghum bicolor [broomcorn]
ref|XP_004972549.1|  PREDICTED: chloroplast envelope membrane pro...    174   1e-47   
ref|XP_001771702.1|  predicted protein                                  168   9e-46   
gb|AGT17439.1|  hypothetical protein SHCRBa_062_F01_R_270               169   1e-45   Saccharum hybrid cultivar R570
ref|XP_006353748.1|  PREDICTED: chloroplast envelope membrane pro...    169   2e-45   Solanum tuberosum [potatoes]
emb|CAN72886.1|  hypothetical protein VITISV_019713                     157   2e-39   Vitis vinifera
ref|XP_001771874.1|  predicted protein                                  137   5e-33   
ref|NP_001061276.2|  Os08g0224300                                       126   1e-32   
ref|XP_002466009.1|  hypothetical protein SORBIDRAFT_01g049976          121   8e-31   
emb|CDY13408.1|  BnaA03g51260D                                          122   5e-29   Brassica napus [oilseed rape]
ref|XP_005642727.1|  hypothetical protein COCSUDRAFT_26464              112   1e-25   Coccomyxa subellipsoidea C-169
ref|XP_011399168.1|  Chloroplast envelope membrane protein              109   2e-24   Auxenochlorella protothecoides
emb|CDX72287.1|  BnaC07g43090D                                          104   6e-23   
ref|WP_026732237.1|  hypothetical protein                               104   5e-22   Fischerella sp. PCC 9605
ref|XP_011078175.1|  PREDICTED: uncharacterized protein LOC105161...    103   6e-22   Sesamum indicum [beniseed]
ref|WP_040630852.1|  proton extrusion protein PcxA                    97.4    2e-20   
ref|WP_042466382.1|  proton extrusion protein PcxA                    97.1    4e-20   
ref|WP_015132959.1|  envelope membrane protein                        97.4    1e-19   Leptolyngbya sp. PCC 7376
ref|WP_036532828.1|  hypothetical protein                             97.4    1e-19   
ref|YP_009051128.1|  chloroplast envelope membrane protein            95.5    1e-19   Galdieria sulphuraria
ref|WP_035158326.1|  proton extrusion protein PcxA                    96.7    1e-19   
ref|WP_011242865.1|  MULTISPECIES: proton extrusion protein PcxA      96.7    2e-19   Synechococcus
ref|XP_005844579.1|  hypothetical protein CHLNCDRAFT_138830           96.7    2e-19   Chlorella variabilis
ref|YP_007878286.1|  chloroplast envelope membrane protein            94.7    2e-19   Calliarthron tuberculosum
ref|WP_045873730.1|  proton extrusion protein PcxA                    94.4    3e-19   
ref|WP_033334671.1|  proton extrusion protein PcxA                    94.4    3e-19   
ref|WP_017318455.1|  hypothetical protein                             95.1    5e-19   Mastigocladopsis repens
ref|WP_006529876.1|  CemA family                                      94.7    5e-19   Gloeocapsa sp. PCC 73106
ref|WP_017745965.1|  hypothetical protein                             95.1    6e-19   Scytonema hofmannii
ref|WP_026730944.1|  proton extrusion protein PcxA                    95.1    6e-19   Fischerella sp. PCC 9605
ref|YP_007627444.1|  chloroplast envelope membrane protein            93.6    7e-19   Chondrus crispus [carageen]
ref|YP_008965641.1|  heme binding protein cemA                        93.6    7e-19   Porphyridium purpureum
ref|WP_039750803.1|  proton extrusion protein PcxA                    93.2    9e-19   
ref|WP_042341833.1|  proton extrusion protein PcxA                    93.6    2e-18   
ref|WP_039726610.1|  MULTISPECIES: hypothetical protein               93.6    2e-18   Lyngbya confervoides
ref|WP_038297037.1|  proton extrusion protein PcxA, partial [         92.0    2e-18   
ref|WP_035174649.1|  proton extrusion protein PcxA                    92.0    3e-18   
ref|NP_053842.1|  envelope membrane protein                           91.7    3e-18   Porphyra purpurea
ref|WP_038315800.1|  proton extrusion protein PcxA                    91.7    3e-18   
gb|AFY31583.1|  envelope membrane protein                             93.6    3e-18   Calothrix sp. PCC 7507
ref|WP_011056595.1|  proton extrusion protein PcxA                    93.6    3e-18   Thermosynechococcus
gb|EKF06235.1|  proton extrusion protein PcxA                         92.8    4e-18   Tolypothrix sp. PCC 7601
ref|NP_849136.1|  envelope membrane protein                           91.3    4e-18   Cyanidioschyzon merolae strain 10D
ref|WP_036047283.1|  hypothetical protein                             90.9    4e-18   
ref|WP_045868774.1|  proton extrusion protein PcxA                    92.8    4e-18   Nostocales
ref|WP_010475585.1|  proton extrusion protein PcxA                    93.2    4e-18   Acaryochloris sp. CCMEE 5410
ref|WP_012164771.1|  proton extrusion protein PcxA                    93.2    4e-18   Acaryochloris marina
ref|WP_037219102.1|  proton extrusion protein PcxA                    90.9    4e-18   
ref|WP_042155139.1|  hypothetical protein                             92.8    5e-18   Planktothrix agardhii
ref|WP_016949880.1|  hypothetical protein                             92.4    5e-18   Anabaena sp. PCC 7108
gb|AFC39902.1|  envelope membrane protein                             90.9    6e-18   Porphyra umbilicalis
ref|WP_035122039.1|  proton extrusion protein PcxA                    90.9    6e-18   
ref|YP_063662.1|  envelope membrane protein                           90.5    7e-18   Gracilaria tenuistipitata var. liui
ref|WP_040957298.1|  MULTISPECIES: hypothetical protein               92.0    7e-18   Planktothrix
emb|CDN12677.1|  Membrane protein PxcA, involved in light-induced...  90.5    7e-18   Richelia intracellularis
ref|WP_043938938.1|  hypothetical protein                             92.0    7e-18   Planktothrix
ref|WP_039751973.1|  proton extrusion protein PcxA                    90.5    7e-18   
ref|WP_036831257.1|  MULTISPECIES: hypothetical protein               92.0    8e-18   Planktothrix
ref|WP_041034094.1|  proton extrusion protein PcxA                    92.0    8e-18   Tolypothrix campylonemoides
ref|WP_019503502.1|  hypothetical protein                             91.7    9e-18   Pleurocapsa sp. PCC 7319
ref|WP_019503735.1|  hypothetical protein                             91.7    1e-17   Pleurocapsa sp. PCC 7319
ref|YP_001293538.1|  chloroplast envelope membrane protein            89.7    1e-17   Rhodomonas salina
ref|WP_041555928.1|  proton extrusion protein PcxA                    90.9    1e-17   
gb|AFY50542.1|  CemA family                                           90.9    1e-17   Nostoc sp. PCC 7524
ref|WP_040689487.1|  hypothetical protein                             87.8    1e-17   
ref|WP_019490538.1|  hypothetical protein                             91.7    1e-17   Calothrix sp. PCC 7103
ref|WP_040938739.1|  hypothetical protein                             91.7    1e-17   
ref|WP_035082874.1|  proton extrusion protein PcxA                    89.4    1e-17   
ref|WP_024125675.1|  light-induced Na+-dependent proton extrusion...  91.7    1e-17   Thermosynechococcus sp. NK55a
ref|YP_007947761.1|  envelope membrane protein                        89.4    2e-17   Pyropia haitanensis
gb|AIA21261.1|  chloroplast envelope membrane protein                 89.4    2e-17   Pyropia kanakaensis
gb|AIA61270.1|  envelope membrane protein (chloroplast)               89.4    2e-17   Cyanidiaceae sp. MX-AZ01
ref|WP_008319295.1|  CemA family                                      91.3    2e-17   Leptolyngbya sp. PCC 6406
ref|WP_006515180.1|  CemA family protein                              90.9    2e-17   Leptolyngbya sp. PCC 7375
ref|NP_050853.1|  envelope membrane protein                           90.5    2e-17   Nephroselmis olivacea
ref|WP_036003193.1|  hypothetical protein                             90.9    2e-17   [Leptolyngbya] sp. JSC-1
ref|YP_536913.1|  envelope membrane protein                           89.4    2e-17   Pyropia yezoensis
ref|WP_015213960.1|  envelope membrane protein                        90.9    2e-17   Anabaena cylindrica
ref|YP_009027516.1|  chloroplast envelope membrane protein            89.4    2e-17   Pyropia perforata
ref|WP_039748867.1|  proton extrusion protein PcxA                    90.9    2e-17   
ref|WP_015120108.1|  CemA family                                      90.5    2e-17   Rivularia sp. PCC 7116
ref|WP_036533348.1|  proton extrusion protein PcxA                    90.5    2e-17   Neosynechococcus sphagnicola
ref|WP_015205923.1|  CemA family                                      90.5    3e-17   Cylindrospermum stagnale
ref|NP_050727.1|  envelope membrane protein                           89.0    3e-17   Guillardia theta
ref|WP_030007666.1|  proton extrusion protein PcxA                    90.5    3e-17   Synechococcus sp. NKBG042902
ref|WP_012308386.1|  proton extrusion protein PcxA                    90.5    3e-17   Synechococcus
ref|WP_002780162.1|  Proton extrusion protein pcxA                    90.5    3e-17   Microcystis aeruginosa
gb|AFZ47692.1|  CemA family protein                                   90.5    3e-17   Cyanobacterium stanieri PCC 7202
ref|WP_040944713.1|  hypothetical protein                             90.5    3e-17   
ref|WP_035139660.1|  proton extrusion protein PcxA                    88.6    3e-17   
ref|WP_006278436.1|  CemA                                             90.1    3e-17   Cylindrospermopsis raciborskii
ref|WP_041234828.1|  proton extrusion protein PcxA                    90.1    3e-17   
ref|WP_002796459.1|  Proton extrusion protein pcxA                    90.5    3e-17   Microcystis aeruginosa
ref|WP_008203777.1|  Proton extrusion protein pcxA                    90.5    3e-17   Microcystis sp. T1-4
gb|AFW97126.1|  CemA family membrane protein                          88.6    3e-17   Anabaena sp. 90
ref|WP_041458683.1|  proton extrusion protein PcxA                    88.6    3e-17   
ref|WP_027845399.1|  proton extrusion protein PcxA                    90.1    3e-17   Mastigocoleus testarum
ref|WP_015219411.1|  envelope membrane protein                        90.5    3e-17   Cyanobacterium aponinum
ref|WP_045358150.1|  proton extrusion protein PcxA                    90.5    3e-17   Microcystis aeruginosa
dbj|BAQ60851.1|  membrane protein PxcA                                90.1    3e-17   Geminocystis sp. NIES-3708
ref|WP_009782312.1|  proton extrusion protein PcxA                    90.5    3e-17   Lyngbya sp. PCC 8106
ref|XP_002945821.1|  hypothetical protein VOLCADRAFT_86170            89.7    3e-17   Volvox carteri f. nagariensis
ref|WP_039728950.1|  MULTISPECIES: proton extrusion protein PcxA      90.5    4e-17   Lyngbya confervoides
ref|WP_015112596.1|  envelope membrane protein                        90.1    4e-17   Nostoc sp. PCC 7107
ref|WP_026100281.1|  proton extrusion protein PcxA                    90.1    4e-17   
ref|WP_002760527.1|  Proton extrusion protein pcxA                    90.1    4e-17   Microcystis aeruginosa
ref|WP_015124892.1|  CemA family                                      90.5    4e-17   Synechococcus sp. PCC 6312
ref|WP_017717029.1|  hypothetical protein                             90.1    4e-17   Oscillatoria sp. PCC 10802
ref|WP_024545065.1|  proton extrusion protein PcxA                    90.1    4e-17   Synechococcus sp. NKBG15041c
ref|WP_002787816.1|  Proton extrusion protein pcxA                    90.1    4e-17   Microcystis aeruginosa
ref|WP_024970566.1|  proton extrusion protein PcxA                    90.1    4e-17   Microcystis aeruginosa
ref|WP_002777880.1|  Proton extrusion protein pcxA                    90.1    4e-17   Microcystis aeruginosa
ref|WP_004163632.1|  Proton extrusion protein pcxA                    90.1    4e-17   Microcystis aeruginosa
ref|WP_023065701.1|  proton extrusion protein PcxA                    90.1    4e-17   Lyngbya aestuarii
ref|WP_002745113.1|  proton extrusion protein PcxA                    90.1    5e-17   Microcystis aeruginosa
ref|YP_009033633.1|  chloroplast envelope membrane protein (chlor...  89.4    5e-17   Klebsormidium flaccidum
ref|WP_002736605.1|  proton extrusion protein PcxA                    89.7    5e-17   Microcystis aeruginosa
ref|WP_004162001.1|  Proton extrusion protein pcxA                    89.7    5e-17   Microcystis aeruginosa
ref|WP_002752174.1|  Proton extrusion protein pcxA                    89.7    5e-17   Microcystis aeruginosa
ref|YP_009057813.1|  chloroplast enveloppe membrane protein           87.8    5e-17   Picocystis salinarum
ref|WP_015226699.1|  CemA family protein                              89.7    5e-17   Halothece sp. PCC 7418
ref|WP_033336675.1|  proton extrusion protein PcxA                    89.4    5e-17   
gb|KIJ85422.1|  proton extrusion protein PcxA                         89.4    6e-17   
ref|YP_003359224.1|  envelope membrane protein                        87.8    6e-17   Cryptomonas paramecium
ref|WP_006850660.1|  proton extrusion protein PcxA                    89.0    6e-17   Synechococcus sp. WH 8109
ref|YP_008563100.1|  chloroplast envelope membrane protein            87.0    7e-17   Solanum lycopersicum
gb|AJY78786.1|  chloroplast envelope membrane protein                 87.0    7e-17   Solanum chilense
emb|CDN12673.1|  Membrane protein PxcA, involved in light-induced...  86.3    7e-17   Richelia intracellularis
ref|WP_035999028.1|  proton extrusion protein PcxA                    89.4    7e-17   [Leptolyngbya] sp. JSC-1
ref|WP_015190872.1|  envelope membrane protein                        89.0    7e-17   Gloeocapsa sp. PCC 7428
ref|YP_538860.1|  envelope membrane protein                           87.0    8e-17   Solanum bulbocastanum [ornamental nightshade]
ref|WP_015114560.1|  envelope membrane protein                        89.4    8e-17   Nostoc sp. PCC 7107
ref|WP_015126108.1|  CemA family                                      89.0    8e-17   Synechococcus sp. PCC 6312
ref|WP_002770448.1|  Proton extrusion protein pcxA                    89.4    8e-17   Microcystis aeruginosa
ref|WP_035115590.1|  MULTISPECIES: proton extrusion protein PcxA      87.4    8e-17   
ref|WP_015204817.1|  envelope membrane protein                        89.0    9e-17   Crinalium epipsammum
ref|WP_017744384.1|  hypothetical protein                             89.0    1e-16   Scytonema hofmannii
ref|WP_015163468.1|  CemA family protein                              89.4    1e-16   Pseudanabaena sp. PCC 7367
ref|YP_009019670.1|  heme binding protein cemA                        87.0    1e-16   Gracilaria salicornia
ref|YP_002600808.1|  chloroplast enveloppe membrane protein           87.0    1e-16   Pycnococcus provasolii
ref|WP_016858373.1|  proton extrusion protein PcxA                    88.6    1e-16   Fischerella muscicola
ref|YP_008144910.1|  chloroplast envelope membrane protein            86.7    1e-16   Grateloupia taiwanensis
ref|WP_028084754.1|  proton extrusion protein PcxA                    88.6    1e-16   Dolichospermum circinale
ref|WP_033378483.1|  proton extrusion protein PcxA                    86.7    2e-16   
ref|WP_023076871.1|  envelope membrane protein                        88.2    2e-16   Leptolyngbya sp. Heron Island J
ref|WP_019493888.1|  hypothetical protein                             88.2    2e-16   Calothrix sp. PCC 7103
ref|YP_009122224.1|  chloroplast envelope membrane protein            86.7    2e-16   Vertebrata lanosa
ref|WP_015192003.1|  envelope membrane protein                        88.2    2e-16   Stanieria cyanosphaera
ref|WP_026720646.1|  proton extrusion protein PcxA                    88.2    2e-16   Fischerella sp. PCC 9431
gb|ADI64819.1|  CemA family protein                                   88.2    2e-16   'Nostoc azollae' 0708
ref|NP_045051.1|  envelope membrane protein                           86.3    2e-16   Cyanidium caldarium
ref|WP_009555792.1|  CemA family protein                              88.2    2e-16   Oscillatoriales cyanobacterium JSC-12
ref|WP_041640509.1|  proton extrusion protein PcxA                    87.8    2e-16   
ref|YP_001019143.1|  chloroplast enveloppe membrane protein           85.5    2e-16   Chlorokybus atmophyticus
ref|WP_041740047.1|  proton extrusion protein PcxA                    87.4    2e-16   
ref|WP_021833203.1|  Membrane protein PxcA, involved in light-ind...  85.5    2e-16   
gb|KIE06800.1|  proton extrusion protein PcxA                         87.8    2e-16   
ref|WP_009454532.1|  envelope membrane protein                        87.8    2e-16   Fischerella thermalis
ref|WP_016871666.1|  proton extrusion protein PcxA                    87.8    3e-16   Fischerella thermalis
ref|WP_015230048.1|  CemA family                                      87.8    3e-16   Dactylococcopsis salina
ref|WP_012954141.1|  CemA family protein                              87.8    3e-16   Candidatus Atelocyanobacterium thalassa
ref|WP_013189992.1|  CemA family protein                              87.4    3e-16   Trichormus azollae
emb|CCQ60825.1|  Membrane protein PxcA, involved in light-induced...  82.8    3e-16   Crocosphaera watsonii WH 0401
gb|KIE08425.1|  proton extrusion protein PcxA                         87.4    3e-16   
ref|WP_017285735.1|  hypothetical protein                             87.8    3e-16   Leptolyngbya boryana
ref|YP_002048714.1|  proton extrusion protein PcxA                    87.0    3e-16   Paulinella chromatophora
ref|WP_040054702.1|  proton extrusion protein PcxA                    87.4    3e-16   
ref|WP_006453377.1|  CemA protein                                     87.4    3e-16   Synechococcus sp. PCC 7335
ref|WP_036047265.1|  hypothetical protein                             85.5    3e-16   
gb|AFY99184.1|  envelope membrane protein                             87.4    3e-16   Calothrix sp. PCC 6303
ref|WP_017312707.1|  MULTISPECIES: proton extrusion protein PcxA      87.4    3e-16   Hapalosiphonaceae
ref|WP_012410591.1|  proton extrusion protein PcxA                    87.4    3e-16   Nostoc punctiforme
ref|WP_015080007.1|  CemA family protein                              87.4    3e-16   Anabaena sp. 90
ref|WP_015122029.1|  CemA family                                      87.4    3e-16   Rivularia sp. PCC 7116
ref|WP_027401008.1|  proton extrusion protein PcxA                    87.4    3e-16   Aphanizomenon flos-aquae
ref|WP_039201877.1|  proton extrusion protein PcxA                    87.4    4e-16   Aphanizomenon flos-aquae
gb|AHZ20788.1|  CemA family protein                                   87.4    4e-16   Anabaena sp. Syke748
ref|WP_017651841.1|  hypothetical protein                             87.0    4e-16   Fortiea contorta
ref|WP_028947346.1|  proton extrusion protein PcxA                    87.4    4e-16   Synechocystis sp. PCC 6714
ref|YP_009106209.1|  chloroplast enveloppe membrane protein           85.9    4e-16   Planctonema lauterbornii
ref|WP_010871621.1|  proton extrusion protein PcxA                    87.0    4e-16   Synechocystis
ref|WP_028089323.1|  proton extrusion protein PcxA                    87.0    4e-16   Dolichospermum circinale
ref|WP_016867100.1|  proton extrusion protein PcxA                    87.0    4e-16   Fischerella muscicola
ref|WP_015145557.1|  CemA family                                      87.0    4e-16   Pleurocapsa minor
ref|WP_015185562.1|  CemA family                                      87.0    5e-16   Microcoleus sp. PCC 7113
ref|WP_019487168.1|  hypothetical protein                             82.4    5e-16   
ref|WP_009342279.1|  Proton extrusion protein pcxA                    86.7    5e-16   Raphidiopsis brookii
ref|WP_039710153.1|  hypothetical protein                             87.0    5e-16   
ref|WP_035113649.1|  proton extrusion protein PcxA                    84.7    5e-16   
ref|WP_017717235.1|  hypothetical protein                             87.0    6e-16   Oscillatoria sp. PCC 10802
ref|WP_015168301.1|  CemA family                                      87.0    6e-16   
ref|WP_006508439.1|  CemA family                                      87.0    6e-16   
ref|WP_006195964.1|  proton extrusion protein PcxA                    86.7    6e-16   
emb|CCQ66262.1|  Membrane protein PxcA, involved in light-induced...  84.3    6e-16   
gb|ACP52209.1|  envelope membrane protein                             84.3    7e-16   
ref|WP_027845498.1|  proton extrusion protein PcxA                    86.3    7e-16   
gb|AJO68491.1|  envelope membrane protein                             84.3    8e-16   
ref|WP_008234655.1|  Membrane protein PxcA, involved in light-ind...  86.3    8e-16   
ref|WP_039716341.1|  proton extrusion protein PcxA                    86.3    9e-16   
ref|YP_004891249.1|  putative heme-binding protein                    84.3    9e-16   
ref|WP_008228844.1|  Membrane protein PxcA, involved in light-ind...  86.3    9e-16   
ref|XP_001417080.1|  predicted protein                                82.4    1e-15   
ref|WP_015198733.1|  envelope membrane protein                        85.9    1e-15   
ref|WP_015171119.1|  CemA family protein                              85.9    1e-15   
ref|WP_044107473.1|  proton extrusion protein PcxA                    85.9    1e-15   
ref|WP_015955645.1|  proton extrusion protein PcxA                    85.9    1e-15   
ref|WP_015156142.1|  CemA family protein                              85.9    1e-15   
ref|WP_006620804.1|  CemA family protein                              85.9    1e-15   
gb|EAZ94149.1|  proton extrusion protein PcxA                         84.3    1e-15   
gb|ELS31076.1|  envelope membrane protein                             86.3    1e-15   
ref|WP_016876746.1|  hypothetical protein                             85.5    1e-15   
ref|WP_017317401.1|  hypothetical protein                             85.5    1e-15   
ref|WP_006668058.1|  CemA family protein                              85.9    1e-15   
ref|WP_022606099.1|  CemA family                                      85.9    1e-15   
ref|WP_042152744.1|  proton extrusion protein PcxA                    85.9    1e-15   
ref|WP_012626986.1|  proton extrusion protein PcxA                    85.5    2e-15   
ref|WP_006171433.1|  proton extrusion protein PcxA                    84.7    2e-15   
ref|WP_041233016.1|  proton extrusion protein PcxA                    85.5    2e-15   
gb|AFZ23934.1|  CemA family                                           85.5    2e-15   
ref|WP_015204826.1|  envelope membrane protein                        85.5    2e-15   
ref|WP_015147370.1|  CemA family                                      85.9    2e-15   
ref|WP_012626494.1|  proton extrusion protein PcxA                    85.5    2e-15   
ref|WP_019490140.1|  hypothetical protein                             85.1    2e-15   
gb|AAF43863.1|AF166114_75  chloroplast envelope membrane protein      81.6    2e-15   
ref|YP_009105198.1|  chloroplast enveloppe membrane protein           84.0    2e-15   
ref|YP_635756.1|  envelope membrane protein                           85.1    2e-15   
ref|WP_017293479.1|  hypothetical protein                             85.1    2e-15   
ref|XP_006341907.1|  PREDICTED: uncharacterized protein LOC102606154  85.9    2e-15   
ref|WP_015163008.1|  CemA family protein                              85.1    2e-15   
ref|WP_012407071.1|  proton extrusion protein PcxA                    84.7    2e-15   
ref|WP_011318027.1|  proton extrusion protein PcxA                    85.1    3e-15   
ref|YP_009105794.1|  chloroplast enveloppe membrane protein           82.8    3e-15   
ref|WP_010995842.1|  proton extrusion protein PcxA                    84.7    3e-15   
ref|WP_008189967.1|  CemA family protein                              84.7    3e-15   
gb|KIJ83384.1|  proton extrusion protein PcxA                         84.7    3e-15   
ref|WP_017320121.1|  hypothetical protein                             84.7    3e-15   
ref|WP_026735617.1|  proton extrusion protein PcxA                    84.7    3e-15   
ref|WP_011935650.1|  proton extrusion protein PcxA                    84.0    4e-15   
ref|WP_035150677.1|  proton extrusion protein PcxA                    84.3    4e-15   
ref|WP_002751395.1|  hypothetical protein                             83.6    4e-15   
ref|WP_013324659.1|  CemA family protein                              84.3    4e-15   
ref|WP_006631222.1|  envelope membrane protein                        84.3    4e-15   
ref|WP_015215148.1|  envelope membrane protein                        84.3    4e-15   
ref|WP_011364303.1|  proton extrusion protein PcxA                    83.6    4e-15   
ref|WP_015139380.1|  CemA family                                      84.3    4e-15   
dbj|BAQ63391.1|  membrane protein PxcA                                84.0    4e-15   
ref|WP_021831187.1|  Membrane protein PxcA, involved in light-ind...  84.0    4e-15   
ref|WP_029635905.1|  proton extrusion protein PcxA [                  84.0    5e-15   
ref|WP_036482526.1|  proton extrusion protein PcxA                    84.3    5e-15   
ref|WP_011432448.1|  proton extrusion protein PcxA                    84.3    5e-15   
ref|WP_002784431.1|  hypothetical protein                             83.6    5e-15   
ref|WP_015126736.1|  envelope membrane protein                        84.0    5e-15   
ref|WP_007307647.1|  CemA                                             84.0    5e-15   
ref|WP_002798265.1|  hypothetical protein                             83.6    5e-15   
gb|AET46387.1|  envelope membrane protein                             81.6    5e-15   
ref|WP_015193112.1|  envelope membrane protein                        84.0    5e-15   
ref|WP_002741998.1|  cemA family protein                              83.6    5e-15   
ref|NP_038423.2|  envelope membrane protein                           81.3    6e-15   
ref|WP_002791069.1|  hypothetical protein                             83.6    6e-15   
ref|WP_009546780.1|  MULTISPECIES: proton extrusion protein PcxA      84.0    6e-15   
ref|XP_007511993.1|  envelope membrane protein (Partial)              84.7    6e-15   
ref|YP_009033842.1|  chloroplast envelope membrane protein            83.6    6e-15   
ref|WP_017741717.1|  hypothetical protein                             84.0    6e-15   
emb|CCO66081.1|  envelope membrane protein (Partial)                  84.7    6e-15   
ref|WP_002800598.1|  hypothetical protein                             83.2    6e-15   
ref|WP_002790097.1|  hypothetical protein                             83.2    6e-15   
ref|WP_002773455.1|  hypothetical protein                             83.2    6e-15   
ref|WP_002765945.1|  hypothetical protein                             83.2    6e-15   
ref|WP_011619255.1|  proton extrusion protein PcxA                    83.2    6e-15   
ref|WP_012596915.1|  MULTISPECIES: proton extrusion protein PcxA      84.0    6e-15   
gb|AFY86167.1|  CemA family protein                                   82.0    6e-15   
ref|WP_036915140.1|  MULTISPECIES: proton extrusion protein PcxA      83.2    6e-15   
ref|WP_002762444.1|  hypothetical protein                             83.2    6e-15   
sp|Q9MUN7.2|CEMA_MESVI  RecName: Full=Chloroplast envelope membra...  81.3    7e-15   
ref|WP_016515231.1|  Proton extrusion protein PcxA                    83.2    7e-15   
ref|WP_024968864.1|  membrane protein                                 83.2    7e-15   
ref|WP_013324870.1|  CemA family protein                              83.6    7e-15   
ref|YP_004891414.1|  putative heme-binding protein                    81.3    7e-15   
gb|KIE09184.1|  proton extrusion protein PcxA                         83.6    7e-15   
ref|WP_026104442.1|  proton extrusion protein PcxA                    83.6    7e-15   
ref|WP_011612872.1|  proton extrusion protein PcxA                    83.6    8e-15   
ref|WP_039753281.1|  proton extrusion protein PcxA                    83.6    8e-15   
ref|WP_035492696.1|  proton extrusion protein PcxA                    83.6    8e-15   
ref|NP_569641.1|  envelope membrane protein                           83.2    8e-15   
ref|WP_008204851.1|  hypothetical protein                             82.8    9e-15   
ref|YP_009106439.1|  chloroplast enveloppe membrane protein           81.6    9e-15   
ref|WP_026789186.1|  proton extrusion protein PcxA                    83.2    9e-15   
ref|WP_026797281.1|  proton extrusion protein PcxA                    83.2    1e-14   
ref|WP_017297542.1|  hypothetical protein                             83.2    1e-14   
ref|WP_027254985.1|  proton extrusion protein PcxA                    83.2    1e-14   
ref|WP_027249103.1|  proton extrusion protein PcxA                    83.2    1e-14   
ref|WP_015190737.1|  envelope membrane protein                        83.2    1e-14   
ref|WP_011130126.1|  proton extrusion protein PcxA                    82.4    1e-14   
ref|WP_026794298.1|  MULTISPECIES: proton extrusion protein PcxA      83.2    1e-14   
ref|WP_006041495.1|  proton extrusion protein PcxA                    82.4    1e-14   
ref|WP_015175758.1|  envelope membrane protein                        83.2    1e-14   
ref|YP_009106283.1|  chloroplast enveloppe membrane protein           81.6    1e-14   
ref|YP_009105951.1|  chloroplast enveloppe membrane protein           81.3    1e-14   
ref|WP_035829159.1|  proton extrusion protein PcxA                    82.0    1e-14   
ref|YP_009105363.1|  chloroplast enveloppe membrane protein           80.9    1e-14   
ref|YP_009105121.1|  chloroplast enveloppe membrane protein           80.9    2e-14   
ref|WP_045870291.1|  proton extrusion protein PcxA                    82.4    2e-14   
ref|WP_011933031.1|  proton extrusion protein PcxA                    82.0    2e-14   
ref|YP_009104934.1|  chloroplast enveloppe membrane protein           82.0    2e-14   
ref|WP_038544640.1|  proton extrusion protein PcxA                    82.0    2e-14   
gb|AFS64396.1|  putative heme-binding protein                         79.7    2e-14   
ref|WP_006852533.1|  proton extrusion protein PcxA                    81.6    2e-14   
ref|WP_041035538.1|  proton extrusion protein PcxA                    82.0    2e-14   
ref|WP_045054056.1|  proton extrusion protein PcxA                    82.0    2e-14   
ref|WP_041374808.1|  proton extrusion protein PcxA                    81.6    2e-14   
sp|A2C9Q5.1|PCXA_PROM3  RecName: Full=Proton extrusion protein PcxA   81.3    2e-14   
gb|AEJ10184.1|  chloroplast envelope membrane protein                 79.7    2e-14   
ref|YP_009106017.1|  chloroplast enveloppe membrane protein           80.1    2e-14   
gb|AFS64453.1|  putative heme-binding protein                         79.7    3e-14   
gb|AEJ10149.1|  chloroplast envelope membrane protein                 79.3    3e-14   
ref|WP_025782202.1|  proton extrusion protein PcxA                    81.3    3e-14   
ref|WP_007355779.1|  MULTISPECIES: Proton extrusion protein pcxA      82.0    3e-14   
ref|WP_038554944.1|  proton extrusion protein PcxA                    81.3    3e-14   
ref|WP_045357006.1|  membrane protein                                 81.3    3e-14   
ref|WP_002735644.1|  cemA family protein                              81.3    3e-14   
ref|YP_006666466.1|  envelope membrane protein                        81.3    3e-14   
ref|YP_009105709.1|  chloroplast enveloppe membrane protein           80.9    3e-14   
ref|WP_019504446.1|  hypothetical protein                             81.6    3e-14   
ref|WP_039713320.1|  proton extrusion protein PcxA                    81.6    3e-14   
ref|YP_009113739.1|  putative heme-binding protein                    79.0    3e-14   
gb|AFR59401.1|  putative heme-binding protein                         79.0    3e-14   
gb|AIA24232.1|  chloroplast envelope membrane protein                 76.6    4e-14   
ref|WP_017710938.1|  hypothetical protein                             81.6    4e-14   
emb|CEO91023.1|  envelope membrane protein                            80.1    4e-14   
ref|YP_003227074.1|  envelope membrane protein                        79.7    4e-14   
ref|YP_004222029.1|  envelope membrane protein                        80.1    4e-14   
ref|WP_038024149.1|  proton extrusion protein PcxA                    80.5    5e-14   
ref|YP_007475716.1|  chloroplast envelope membrane protein            78.6    5e-14   
ref|YP_009033705.1|  chloroplast envelope membrane protein (chlor...  81.3    5e-14   
gb|EAU73860.1|  proton extrusion protein PcxA                         80.5    5e-14   
ref|YP_636252.1|  envelope membrane protein                           79.3    5e-14   
gb|ACQ90750.1|  chloroplast envelope membrane protein                 79.3    5e-14   
ref|WP_018399972.1|  hypothetical protein                             80.9    6e-14   
gb|AEJ10166.1|  chloroplast envelope membrane protein                 78.2    6e-14   
ref|YP_740129.1|  envelope membrane protein                           78.2    6e-14   
gb|AIA24185.1|  chloroplast envelope membrane protein                 76.6    6e-14   
ref|WP_006099852.1|  CemA protein                                     80.5    7e-14   
ref|WP_014274940.1|  proton extrusion protein PcxA                    80.9    7e-14   
ref|YP_001312215.1|  putative heme-binding protein                    78.2    7e-14   
ref|YP_009106885.1|  chloroplast enveloppe membrane protein           78.6    7e-14   
ref|YP_009113644.1|  putative heme-binding protein                    78.2    8e-14   
ref|WP_011431352.1|  proton extrusion protein PcxA                    80.5    8e-14   
gb|AFR53219.1|  putative heme-binding protein                         78.2    8e-14   
ref|YP_008854606.1|  chloroplast envelope membrane protein            77.8    8e-14   
gb|AFW78861.1|  hypothetical protein ZEAMMB73_311074                  77.8    1e-13   
ref|WP_035991412.1|  proton extrusion protein PcxA                    80.1    1e-13   
ref|WP_028952004.1|  proton extrusion protein PcxA                    79.3    1e-13   
ref|YP_009113840.1|  putative heme-binding protein                    77.4    1e-13   
ref|YP_009116178.1|  CemA                                             80.1    1e-13   
ref|WP_006617319.1|  proton extrusion protein PcxA                    79.7    1e-13   
gb|AGE93382.1|  chloroplast envelope membrane protein                 77.4    2e-13   
ref|YP_009106096.1|  chloroplast enveloppe membrane protein           79.3    2e-13   
ref|WP_015954758.1|  proton extrusion protein PcxA                    79.0    2e-13   
ref|WP_009343522.1|  CemA                                             79.3    2e-13   
ref|YP_008815762.1|  chloroplast envelope membrane protein            77.0    2e-13   
ref|YP_009033981.1|  chloroplast envelope membrane protein            76.6    2e-13   
ref|YP_004841960.1|  chloroplast envelope membrane protein            76.6    2e-13   
ref|YP_003029751.1|  CemA                                             76.6    2e-13   
ref|YP_635904.1|  envelope membrane protein                           78.6    2e-13   
ref|YP_003097587.1|  envelope membrane protein                        76.6    2e-13   
gb|AEJ10180.1|  chloroplast envelope membrane protein                 76.6    2e-13   
ref|YP_009093812.1|  envelope membrane protein                        76.6    2e-13   
gb|AFU96822.1|  CemA                                                  76.6    2e-13   
ref|WP_006277843.1|  CemA                                             79.0    2e-13   
ref|YP_009113557.1|  putative heme-binding protein                    76.6    3e-13   
gb|AJV88523.1|  chloroplast envelope membrane protein                 76.6    3e-13   
ref|YP_009053094.1|  chloroplast envelope membrane protein            76.6    3e-13   
ref|XP_003080055.1|  unnamed protein product                          77.0    3e-13   
ref|YP_009117775.1|  chloroplast envelope membrane protein            79.0    3e-13   
gb|AGE93468.1|  chloroplast envelope membrane protein                 76.3    3e-13   
ref|WP_019499643.1|  hypothetical protein                             78.6    3e-13   
ref|NP_904190.1|  envelope membrane protein                           78.6    3e-13   
ref|YP_008378795.1|  envelope membrane protein                        75.9    4e-13   
gb|AHA12936.1|  chloroplast envelope membrane protein                 75.9    4e-13   
ref|WP_011128082.1|  proton extrusion protein PcxA                    77.8    4e-13   
ref|YP_636559.1|  envelope membrane protein                           78.2    4e-13   
ref|YP_001382156.1|  envelope membrane protein                        78.2    4e-13   
ref|YP_006503701.1|  chloroplast envelope membrane protein            75.9    4e-13   
ref|WP_017304377.1|  hypothetical protein                             78.2    4e-13   
ref|YP_009092779.1|  chloroplast envelope membrane protein            75.9    4e-13   
ref|YP_007374727.1|  chloroplast envelope membrane protein            78.2    5e-13   
gb|AIQ79211.1|  chloroplast envelope membrane protein                 75.9    5e-13   
gb|AET47177.1|  envelope membrane protein                             76.3    5e-13   
ref|WP_043691151.1|  proton extrusion protein PcxA                    77.8    5e-13   
ref|YP_009114246.1|  chloroplast envelope membrane protein            75.5    5e-13   
gb|ACP52274.1|  envelope membrane protein                             75.9    5e-13   
ref|WP_010316971.1|  proton extrusion protein PcxA                    77.4    5e-13   
gb|AHZ61389.1|  chloroplast envelope membrane protein                 75.5    5e-13   
gb|AET45457.1|  envelope membrane protein                             75.9    6e-13   
gb|ACP52524.1|  envelope membrane protein                             75.9    6e-13   
ref|YP_004733256.1|  chloroplast envelope membrane protein            75.5    6e-13   
gb|ACP51843.1|  envelope membrane protein                             75.9    6e-13   
ref|WP_015108186.1|  CemA family                                      77.4    6e-13   
ref|YP_009053589.1|  chloroplast envelope membrane protein            75.5    6e-13   
ref|YP_008082271.1|  envelope membrane protein                        75.9    6e-13   
gb|AHA13022.1|  chloroplast envelope membrane protein                 75.5    6e-13   
gb|AET45529.1|  envelope membrane protein                             75.9    6e-13   
ref|NP_042402.1|  envelope membrane protein                           75.9    6e-13   
ref|YP_009072855.1|  chloroplast envelope membrane protein            75.5    6e-13   
gb|AET47824.1|  envelope membrane protein                             75.9    6e-13   
gb|ACP50845.1|  envelope membrane protein                             75.9    6e-13   
ref|WP_006911181.1|  proton extrusion protein PcxA                    77.4    6e-13   
ref|WP_009631762.1|  CemA family                                      77.8    6e-13   
ref|YP_003208198.1|  chloroplast envelope membrane protein            75.5    7e-13   
gb|AET47320.1|  envelope membrane protein                             75.9    7e-13   
gb|ACP51223.1|  envelope membrane protein                             75.9    7e-13   



>gb|KCW80777.1| hypothetical protein EUGRSUZ_C021581, partial [Eucalyptus grandis]
Length=225

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLF++LYFNQ+KV+LLKFTGYK+INN+SDTGKA LIIL+TDI
Sbjct  96   LENRRAFANIWSDMVFGISLFLILYFNQSKVALLKFTGYKIINNISDTGKAFLIILVTDI  155

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EVIVEHYG EVDQAA+TIF+C++PVVIDACVKLWLFK+LP++SPKV
Sbjct  156  FLGYHSESGWQTLLEVIVEHYGLEVDQAALTIFICLIPVVIDACVKLWLFKFLPRLSPKV  215

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  216  SNIFQEMKRH  225



>ref|XP_010278479.1| PREDICTED: chloroplast envelope membrane protein isoform X3 [Nelumbo 
nucifera]
 ref|XP_010278480.1| PREDICTED: chloroplast envelope membrane protein isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGI+LFILLYFNQ+KV+LLKFTGYKLINN+SDTGKA LIILITDI
Sbjct  298  LENRRAFANIWSDMVFGITLFILLYFNQSKVALLKFTGYKLINNISDTGKAFLIILITDI  357

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYGFEVDQ+ ITIFVC+VPVVIDACVKLWLFK+LP++SPKV
Sbjct  358  FLGYHSESGWQTLLEIIVEHYGFEVDQSVITIFVCLVPVVIDACVKLWLFKFLPRLSPKV  417

Query  399  SNIFREMKRH  370
            SNIFREMKRH
Sbjct  418  SNIFREMKRH  427



>ref|XP_010656697.1| PREDICTED: chloroplast envelope membrane protein isoform X2 [Vitis 
vinifera]
Length=361

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N R FANIWSD VFGISLF LLYFNQ++V+LLKFTGYK+INN+SDTGKA LIILITD
Sbjct  231  RLENRRAFANIWSDMVFGISLFFLLYFNQSQVALLKFTGYKIINNISDTGKAFLIILITD  290

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IFLGYHSESGWQTL EV+VEHYG EVDQ+AITIFVC++PVVIDACVKLWLFK+LP++SP+
Sbjct  291  IFLGYHSESGWQTLLEVVVEHYGLEVDQSAITIFVCLIPVVIDACVKLWLFKFLPRLSPR  350

Query  402  VSNIFREMKRH  370
            VSNIFREMKRH
Sbjct  351  VSNIFREMKRH  361



>ref|XP_010048512.1| PREDICTED: chloroplast envelope membrane protein [Eucalyptus 
grandis]
Length=418

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLF++LYFNQ+KV+LLKFTGYK+INN+SDTGKA LIIL+TDI
Sbjct  289  LENRRAFANIWSDMVFGISLFLILYFNQSKVALLKFTGYKIINNISDTGKAFLIILVTDI  348

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EVIVEHYG EVDQAA+TIF+C++PVVIDACVKLWLFK+LP++SPKV
Sbjct  349  FLGYHSESGWQTLLEVIVEHYGLEVDQAALTIFICLIPVVIDACVKLWLFKFLPRLSPKV  408

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  409  SNIFQEMKRH  418



>ref|XP_002267030.2| PREDICTED: chloroplast envelope membrane protein isoform X1 [Vitis 
vinifera]
Length=419

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLF LLYFNQ++V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  290  LENRRAFANIWSDMVFGISLFFLLYFNQSQVALLKFTGYKIINNISDTGKAFLIILITDI  349

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EV+VEHYG EVDQ+AITIFVC++PVVIDACVKLWLFK+LP++SP+V
Sbjct  350  FLGYHSESGWQTLLEVVVEHYGLEVDQSAITIFVCLIPVVIDACVKLWLFKFLPRLSPRV  409

Query  399  SNIFREMKRH  370
            SNIFREMKRH
Sbjct  410  SNIFREMKRH  419



>emb|CBI24050.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLF LLYFNQ++V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  286  LENRRAFANIWSDMVFGISLFFLLYFNQSQVALLKFTGYKIINNISDTGKAFLIILITDI  345

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EV+VEHYG EVDQ+AITIFVC++PVVIDACVKLWLFK+LP++SP+V
Sbjct  346  FLGYHSESGWQTLLEVVVEHYGLEVDQSAITIFVCLIPVVIDACVKLWLFKFLPRLSPRV  405

Query  399  SNIFREMKRH  370
            SNIFREMKRH
Sbjct  406  SNIFREMKRH  415



>ref|XP_006372256.1| proton extrusion family protein [Populus trichocarpa]
 gb|ERP50053.1| proton extrusion family protein [Populus trichocarpa]
Length=440

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFG+S+F+LLYFNQ+KV+LLKFTGYK++NNVSDTGKA LIILITDI
Sbjct  311  LENRRSFANIWSDMVFGVSIFVLLYFNQSKVALLKFTGYKILNNVSDTGKAFLIILITDI  370

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EVI EHYG EVDQ+AITIF+C+VPVVIDACVKLWLFKYLP++SPKV
Sbjct  371  FLGYHSESGWQTLLEVIFEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKYLPRLSPKV  430

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  431  ANIFREMKRH  440



>gb|KDP45838.1| hypothetical protein JCGZ_17445 [Jatropha curcas]
Length=347

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLFILL FNQ+KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  218  LENRRAFANIWSDMVFGISLFILLCFNQSKVALLKFTGYKIINNISDTGKAFLIILITDI  277

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG E DQ+AITIF+C+VPV+IDACVKLW+FK+LP++SPKV
Sbjct  278  FLGYHSESGWQTLVEIIVEHYGVEADQSAITIFICLVPVIIDACVKLWMFKFLPRLSPKV  337

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  338  ANIFREMKRH  347



>ref|XP_011078172.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Sesamum indicum]
Length=430

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG++LFILLYF QN+V+LLKFTGYKL+NNVSDTGKA LIILITDI
Sbjct  301  LENRKAFANIWSDMVFGVTLFILLYFYQNQVALLKFTGYKLVNNVSDTGKAFLIILITDI  360

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYGFEVDQAAITIFVC+VPV+IDACVKLW+FK+LP++SPKV
Sbjct  361  FLGYHSESGWQTLLEIIVEHYGFEVDQAAITIFVCLVPVIIDACVKLWMFKFLPRLSPKV  420

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  421  ANIFQEMKRH  430



>ref|XP_003516797.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Glycine max]
 ref|XP_006572915.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Glycine max]
 ref|XP_006572916.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X3 [Glycine max]
Length=433

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GISLFI+LYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  304  LENRRAFANIWSDTVYGISLFIILYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDI  363

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C++PVVIDACVKLWLFK+LP++SP+V
Sbjct  364  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLIPVVIDACVKLWLFKFLPRLSPRV  423

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  424  TNIFREMKRH  433



>gb|KHN32931.1| Chloroplast envelope membrane protein [Glycine soja]
Length=433

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GISLFI+LYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  304  LENRRAFANIWSDTVYGISLFIILYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDI  363

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C++PVVIDACVKLWLFK+LP++SP+V
Sbjct  364  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLIPVVIDACVKLWLFKFLPRLSPRV  423

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  424  TNIFREMKRH  433



>ref|XP_011019941.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Populus euphratica]
 ref|XP_011010258.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Populus euphratica]
Length=436

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGIS+FILLYFNQ+KV+LLKFTGYK++NNV+D GKA LIILITDI
Sbjct  307  LENRRSFANIWSDMVFGISIFILLYFNQSKVALLKFTGYKILNNVTDIGKAFLIILITDI  366

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL +VIVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFKYLP++SP+V
Sbjct  367  FLGYHSESGWQTLLDVIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKYLPRLSPRV  426

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  427  ANIFREMKRH  436



>emb|CDP14250.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFG+SLFILLYFNQ++V+LLKFTGYK++NNV+DTGKA LIIL+TDI
Sbjct  296  LENRRAFANIWSDIVFGVSLFILLYFNQSQVALLKFTGYKMLNNVTDTGKAFLIILVTDI  355

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQT+ E+IVEHYG EVD+AAITIFVC+VPV+IDACVKLWLFK+LP++SP+V
Sbjct  356  FLGYHSESGWQTVCEIIVEHYGLEVDEAAITIFVCLVPVIIDACVKLWLFKFLPRLSPRV  415

Query  399  SNIFREMKRH  370
            +NIFREM+RH
Sbjct  416  ANIFREMERH  425



>ref|XP_011019940.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Populus euphratica]
 ref|XP_011010257.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Populus euphratica]
Length=443

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGIS+FILLYFNQ+KV+LLKFTGYK++NNV+D GKA LIILITDI
Sbjct  314  LENRRSFANIWSDMVFGISIFILLYFNQSKVALLKFTGYKILNNVTDIGKAFLIILITDI  373

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL +VIVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFKYLP++SP+V
Sbjct  374  FLGYHSESGWQTLLDVIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKYLPRLSPRV  433

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  434  ANIFREMKRH  443



>gb|KHN24979.1| Chloroplast envelope membrane protein [Glycine soja]
Length=435

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GISLFILLYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  306  LENRRAFANIWSDTVYGISLFILLYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFK+LP++SP V
Sbjct  366  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKFLPRLSPSV  425

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  426  TNIFQEMKRH  435



>ref|XP_003532317.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Glycine max]
 ref|XP_006586275.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Glycine max]
Length=433

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GISLFILLYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  304  LENRRAFANIWSDTVYGISLFILLYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDI  363

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFK+LP++SP V
Sbjct  364  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKFLPRLSPSV  423

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  424  TNIFQEMKRH  433



>ref|XP_002309032.1| proton extrusion family protein [Populus trichocarpa]
 gb|EEE92555.1| proton extrusion family protein [Populus trichocarpa]
Length=443

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGIS+FILLYFNQ+KV+LLKFTGYK++NNV+D GKA LIILITDI
Sbjct  314  LENRRSFANIWSDMVFGISIFILLYFNQSKVALLKFTGYKILNNVTDIGKAFLIILITDI  373

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL +VIVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFKYLP++SP+V
Sbjct  374  FLGYHSESGWQTLLDVIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKYLPRLSPRV  433

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  434  ANIFREMKRH  443



>ref|XP_012079808.1| PREDICTED: chloroplast envelope membrane protein [Jatropha curcas]
Length=432

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLFILL FNQ+KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  303  LENRRAFANIWSDMVFGISLFILLCFNQSKVALLKFTGYKIINNISDTGKAFLIILITDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG E DQ+AITIF+C+VPV+IDACVKLW+FK+LP++SPKV
Sbjct  363  FLGYHSESGWQTLVEIIVEHYGVEADQSAITIFICLVPVIIDACVKLWMFKFLPRLSPKV  422

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  423  ANIFREMKRH  432



>gb|ACU19500.1| unknown [Glycine max]
Length=433

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GISLFILLYFN++KV+LLKFTGYK+INN+SDTGKA LIILIT+I
Sbjct  304  LENRRAFANIWSDTVYGISLFILLYFNKSKVALLKFTGYKIINNISDTGKAFLIILITNI  363

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C+VPVVIDACVKLWLFK+LP++SP V
Sbjct  364  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLVPVVIDACVKLWLFKFLPRLSPSV  423

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  424  TNIFQEMKRH  433



>gb|KJB53671.1| hypothetical protein B456_009G000300 [Gossypium raimondii]
Length=304

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N + FANIWSD VFGISLF++L+ NQ+KV+LLKF GYK+I+N+SDTGKA LIILITD
Sbjct  174  RLENRKAFANIWSDMVFGISLFLVLHLNQSKVALLKFAGYKIISNISDTGKAFLIILITD  233

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IFLGYHSESGWQTL E+IVEHYG +VDQ+AIT+FVC++PVVIDACVKLWLFK LP++SP+
Sbjct  234  IFLGYHSESGWQTLLEIIVEHYGLQVDQSAITVFVCLIPVVIDACVKLWLFKSLPRLSPR  293

Query  402  VSNIFREMKRH  370
            VSNIFREMKRH
Sbjct  294  VSNIFREMKRH  304



>ref|XP_009376337.1| PREDICTED: chloroplast envelope membrane protein [Pyrus x bretschneideri]
Length=428

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD +FGISLFILLY NQ+KV+L+KFTGYK+INN+SDTGKA LIILITDI
Sbjct  299  LENRKAFANIWSDMIFGISLFILLYSNQSKVALVKFTGYKIINNISDTGKAFLIILITDI  358

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTLSE+ VEHYG EVDQ+A+TIF+C++PV++DACVKLWLFK+LP++SPKV
Sbjct  359  FLGYHSESGWQTLSEIFVEHYGLEVDQSAVTIFICLIPVIMDACVKLWLFKFLPRLSPKV  418

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  419  TNIFQEMKRH  428



>ref|XP_008224570.1| PREDICTED: chloroplast envelope membrane protein [Prunus mume]
Length=410

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD +FG+SLFILLY NQ+KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  281  LENRKAFANIWSDMIFGVSLFILLYCNQSKVALLKFTGYKIINNISDTGKAFLIILITDI  340

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+ VEHYG +VDQ+AITIF+C++PVVIDACVKLWLFK+LP++SPKV
Sbjct  341  FLGYHSESGWQTLLEIFVEHYGIDVDQSAITIFICLIPVVIDACVKLWLFKFLPRLSPKV  400

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  401  ANIFREMKRH  410



>ref|XP_009338666.1| PREDICTED: chloroplast envelope membrane protein-like [Pyrus 
x bretschneideri]
 ref|XP_009339524.1| PREDICTED: chloroplast envelope membrane protein-like [Pyrus 
x bretschneideri]
Length=435

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD +FGISLFILLY NQ+KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  306  LENRNAFANIWSDMIFGISLFILLYSNQSKVALLKFTGYKIINNISDTGKAFLIILITDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+ VEHYG EVDQ+AITIF+C++PV++DACVKLWLFK+LP++SPKV
Sbjct  366  FLGYHSESGWQTLLEIFVEHYGLEVDQSAITIFICLIPVIMDACVKLWLFKFLPRLSPKV  425

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  426  TNIFREMKRH  435



>ref|XP_009787228.1| PREDICTED: chloroplast envelope membrane protein [Nicotiana sylvestris]
Length=433

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG+SLFILLYFN++KV LLKFTGYK++NNVSDTGKA LIIL+TDI
Sbjct  304  LENRKAFANIWSDFVFGVSLFILLYFNESKVKLLKFTGYKILNNVSDTGKAFLIILVTDI  363

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EV+VEHYG EVDQA ITIFVC+VPV+IDACVKLW+FK+LP++SP+V
Sbjct  364  FLGYHSESGWQTLLEVLVEHYGIEVDQAVITIFVCLVPVIIDACVKLWMFKFLPRLSPRV  423

Query  399  SNIFREMKRH  370
            SNIFREM RH
Sbjct  424  SNIFREMTRH  433



>ref|XP_011648976.1| PREDICTED: chloroplast envelope membrane protein isoform X1 [Cucumis 
sativus]
 ref|XP_011648977.1| PREDICTED: chloroplast envelope membrane protein isoform X1 [Cucumis 
sativus]
 gb|KGN61220.1| hypothetical protein Csa_2G070860 [Cucumis sativus]
Length=431

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLFILLYFNQ+KV+LLKFTGYK+I+N+SDTGKA LIILITDI
Sbjct  302  LENRKAFANIWSDMVFGISLFILLYFNQSKVALLKFTGYKIISNISDTGKAFLIILITDI  361

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+ ITIF+C+VPV++DACVKLWLFKYLP++SP+V
Sbjct  362  FLGYHSESGWQTLLEIIVEHYGLEVDQSLITIFICLVPVMMDACVKLWLFKYLPRLSPRV  421

Query  399  SNIFREMKRH  370
            SN+F+EMKRH
Sbjct  422  SNLFQEMKRH  431



>ref|XP_010095213.1| Proton extrusion protein PcxA [Morus notabilis]
 gb|EXB58674.1| Proton extrusion protein PcxA [Morus notabilis]
Length=439

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD VFG+SLFILLY NQ KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  310  LHNRSAFANIWSDMVFGVSLFILLYLNQTKVALLKFTGYKIINNISDTGKAFLIILITDI  369

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EV+VEHYGFEVDQ+ ITIF+C+VPV+IDACVKLWLFK+LP++SPKV
Sbjct  370  FLGYHSESGWQTLVEVLVEHYGFEVDQSVITIFICLVPVIIDACVKLWLFKFLPRLSPKV  429

Query  399  SNIFREMKRH  370
            +N+FREM RH
Sbjct  430  ANLFREMTRH  439



>ref|XP_010928741.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X3 [Elaeis guineensis]
Length=267

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GI+LFIL+YFN++KV+LLKFTGYKL+NN+SDTGKA LIIL+TDI
Sbjct  138  LENRKAFANIWSDMVYGIALFILIYFNKSKVALLKFTGYKLLNNISDTGKAFLIILVTDI  197

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I+EHYG EVDQAAITIF+C  PVVIDACVKLWLFK LPK+SP V
Sbjct  198  FLGYHSESGWQALVEIILEHYGLEVDQAAITIFICSFPVVIDACVKLWLFKILPKLSPNV  257

Query  399  SNIFREMKRH  370
            +NIFREM+RH
Sbjct  258  ANIFREMQRH  267



>ref|XP_008393390.1| PREDICTED: chloroplast envelope membrane protein [Malus domestica]
Length=428

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD +FGISLFILLY NQNKV+L+KFTGYK+INN+SDTGKA LIILITDI
Sbjct  299  LENRKAFANIWSDMIFGISLFILLYSNQNKVALVKFTGYKIINNISDTGKAFLIILITDI  358

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+ VEHYG EVDQ+A+T F+C++PV++DACVKLWLFK+LP++SPKV
Sbjct  359  FLGYHSESGWQTLLEIFVEHYGLEVDQSAVTFFICLIPVIMDACVKLWLFKFLPRLSPKV  418

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  419  TNIFREMKRH  428



>ref|XP_011625786.1| PREDICTED: chloroplast envelope membrane protein [Amborella trichopoda]
Length=319

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGI+LF+L++FNQ+KV+L+KFTGYK+  NVSDTGKA LIIL+TDI
Sbjct  190  LENRKAFANIWSDMVFGIALFVLIFFNQSKVALMKFTGYKIFKNVSDTGKAFLIILVTDI  249

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+I+EHYG EVDQ+AITIF+ +VPVVIDACVKLWLFK+LPK+SPKV
Sbjct  250  FLGYHSESGWQTLIEIILEHYGLEVDQSAITIFISVVPVVIDACVKLWLFKFLPKLSPKV  309

Query  399  SNIFREMKRH  370
            SNIFREM+RH
Sbjct  310  SNIFREMRRH  319



>ref|XP_007222729.1| hypothetical protein PRUPE_ppa006489mg [Prunus persica]
 gb|EMJ23928.1| hypothetical protein PRUPE_ppa006489mg [Prunus persica]
Length=409

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD +FG+SLFILLY NQ+KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  280  LENRKAFANIWSDMIFGVSLFILLYCNQSKVALLKFTGYKIINNISDTGKAFLIILITDI  339

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+ VEHYG +VDQ+AITIF+C++PVVIDACVKLWLFK+LP++SPKV
Sbjct  340  FLGYHSESGWQTLLEIFVEHYGIDVDQSAITIFICLIPVVIDACVKLWLFKFLPRLSPKV  399

Query  399  SNIFREMKRH  370
            +NIFREM+RH
Sbjct  400  ANIFREMQRH  409



>ref|XP_004296645.1| PREDICTED: chloroplast envelope membrane protein [Fragaria vesca 
subsp. vesca]
 ref|XP_011462505.1| PREDICTED: chloroplast envelope membrane protein [Fragaria vesca 
subsp. vesca]
Length=416

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFL  574
            N R FANIWSD +FGISLFILLY NQ+KV+LLKFTGYK+INN+SDTGKA LIILITDIFL
Sbjct  289  NRRAFANIWSDMLFGISLFILLYCNQSKVALLKFTGYKIINNISDTGKAFLIILITDIFL  348

Query  573  GYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSN  394
            GYHSESGWQTL E+ VEHYG ++DQ+AITIF+C++PV+IDACVKLWLFK+LP++SPKV+N
Sbjct  349  GYHSESGWQTLLEIFVEHYGLQIDQSAITIFICLIPVIIDACVKLWLFKFLPRLSPKVAN  408

Query  393  IFREMKRH  370
            IFREM+RH
Sbjct  409  IFREMQRH  416



>ref|XP_008450426.1| PREDICTED: chloroplast envelope membrane protein [Cucumis melo]
 ref|XP_008450436.1| PREDICTED: chloroplast envelope membrane protein [Cucumis melo]
 ref|XP_008450445.1| PREDICTED: chloroplast envelope membrane protein [Cucumis melo]
 ref|XP_008450451.1| PREDICTED: chloroplast envelope membrane protein [Cucumis melo]
Length=429

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLFILLYFNQ+KV+LLKFTGYK+I+N+SDTGKA LIILITDI
Sbjct  300  LENRKAFANIWSDMVFGISLFILLYFNQSKVALLKFTGYKIISNISDTGKAFLIILITDI  359

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+ ITIF+C+VPVV+DACVKLWLFK+LP++SP+V
Sbjct  360  FLGYHSESGWQTLLEIIVEHYGLEVDQSVITIFICLVPVVMDACVKLWLFKFLPRLSPRV  419

Query  399  SNIFREMKRH  370
            +N+F+EMKRH
Sbjct  420  ANLFQEMKRH  429



>ref|XP_010693714.1| PREDICTED: chloroplast envelope membrane protein [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 125/137 (91%), Gaps = 6/137 (4%)
 Frame = -1

Query  762  EVRN-WR-----GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALL  601
            E+R+ WR      FANIWSD VFGISLF+LLYFNQ+KV+LLKFTGYK+I+N+SDTGKA L
Sbjct  305  ELRDEWRLTNRIAFANIWSDMVFGISLFLLLYFNQSKVALLKFTGYKIISNISDTGKAFL  364

Query  600  IILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYL  421
            IILITDIFLGYHSESGWQT+ EVIVEHYG EVDQ+ +TIF+C+VPV++DACVKLWLFK+L
Sbjct  365  IILITDIFLGYHSESGWQTVCEVIVEHYGLEVDQSTVTIFICLVPVIMDACVKLWLFKFL  424

Query  420  PKISPKVSNIFREMKRH  370
            P++SPKVSNIF+EMKRH
Sbjct  425  PRLSPKVSNIFQEMKRH  441



>ref|XP_007153007.1| hypothetical protein PHAVU_004G178700g [Phaseolus vulgaris]
 gb|ESW25001.1| hypothetical protein PHAVU_004G178700g [Phaseolus vulgaris]
Length=436

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
             FANIWSD V+GISLFILLYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDIFLGYH
Sbjct  312  AFANIWSDTVYGISLFILLYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDIFLGYH  371

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            SESGWQTL E+IVEHYG EVDQ+A+TIFVC+VPVV+DACVKLWLFK+LP++SP+V+NIF+
Sbjct  372  SESGWQTLLEIIVEHYGLEVDQSALTIFVCLVPVVMDACVKLWLFKFLPRLSPRVTNIFQ  431

Query  384  EMKRH  370
            EM+RH
Sbjct  432  EMRRH  436



>gb|KHG26078.1| Proton extrusion PcxA [Gossypium arboreum]
Length=392

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF++L+ NQ+KV+LLKF GYK+I+N+SDTGKA LIILITDI
Sbjct  263  LENRKAFANIWSDMVFGISLFLVLHLNQSKVALLKFAGYKIISNISDTGKAFLIILITDI  322

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG +VDQ+AITIFVC++PVVIDACVKLWLFK+LP++SP+V
Sbjct  323  FLGYHSESGWQTLLEIIVEHYGLQVDQSAITIFVCLIPVVIDACVKLWLFKFLPRLSPRV  382

Query  399  SNIFREMKRH  370
            SNIFREMKRH
Sbjct  383  SNIFREMKRH  392



>ref|XP_006412637.1| hypothetical protein EUTSA_v10025215mg [Eutrema salsugineum]
 gb|ESQ54090.1| hypothetical protein EUTSA_v10025215mg [Eutrema salsugineum]
Length=442

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  313  LENRKAFANIWSDMVFGISLFVLLYANQGKVALLKFTGYKIINNISDTGKAFLIILITDI  372

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+QA +TIF+C+VPVVIDACVKLWLFK+LP++SP+V
Sbjct  373  FLGYHSESGWETLLEIIMEHYGLEVEQATVTIFICLVPVVIDACVKLWLFKFLPRLSPRV  432

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  433  SNIFQEMKRH  442



>ref|XP_004513126.1| PREDICTED: chloroplast envelope membrane protein-like [Cicer 
arietinum]
Length=437

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+G+SLFILLYFN++KV+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  308  LENRRAFANIWSDTVYGVSLFILLYFNKSKVALLKFTGYKIINNISDTGKAFLIILITDI  367

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIFVC  PV+IDACVKLWLFK+LP++SPKV
Sbjct  368  FLGYHSESGWQTLIEIIVEHYGLEVDQSAITIFVCTFPVIIDACVKLWLFKFLPRLSPKV  427

Query  399  SNIFREMKRH  370
             +IF+EMKRH
Sbjct  428  MSIFQEMKRH  437



>ref|XP_006436389.1| hypothetical protein CICLE_v10033693mg, partial [Citrus clementina]
 gb|ESR49629.1| hypothetical protein CICLE_v10033693mg, partial [Citrus clementina]
Length=196

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FAN+WSD VFGISLFILLYFNQ+KV+LLKFTGYK+INN+SD GKA LIIL+TDI
Sbjct  67   LENRKAFANLWSDLVFGISLFILLYFNQSKVALLKFTGYKIINNISDAGKAFLIILVTDI  126

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+I+EHYG E D++AI  FVC+VPV +DACVKLWLFK LP ++P+V
Sbjct  127  FLGYHSESGWQTLVEIILEHYGIEADESAIITFVCVVPVFMDACVKLWLFKKLPGLAPRV  186

Query  399  SNIFREMKRH  370
            SNIF+EM+RH
Sbjct  187  SNIFKEMRRH  196



>ref|XP_009127292.1| PREDICTED: chloroplast envelope membrane protein [Brassica rapa]
Length=436

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  307  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  366

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPVVIDACVKLWLFK+LP++SP+V
Sbjct  367  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVVIDACVKLWLFKFLPRLSPRV  426

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  427  SNIFQEMKRH  436



>emb|CDX68718.1| BnaC01g07350D [Brassica napus]
Length=435

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  306  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPVVIDACVKLWLFK+LP++SP+V
Sbjct  366  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVVIDACVKLWLFKFLPRLSPRV  425

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  426  SNIFQEMKRH  435



>emb|CDY28239.1| BnaA01g06100D [Brassica napus]
Length=434

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  305  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  364

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPVVIDACVKLWLFK+LP++SP+V
Sbjct  365  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVVIDACVKLWLFKFLPRLSPRV  424

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  425  SNIFQEMKRH  434



>ref|XP_011093931.1| PREDICTED: chloroplast envelope membrane protein [Sesamum indicum]
Length=432

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLYF Q +V+LLKFTGYK++N+++DTGKA LIILITDI
Sbjct  303  LENRKAFANIWSDVVFGISLFLLLYFYQGQVALLKFTGYKIVNSITDTGKAFLIILITDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQ+AITIF+C++PVV+DACVKLWLFK+LP++SPKV
Sbjct  363  FLGYHSESGWQTLLEIIVEHYGLEVDQSAITIFICLIPVVMDACVKLWLFKFLPRLSPKV  422

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  423  ANIFREMKRH  432



>ref|XP_010527110.1| PREDICTED: chloroplast envelope membrane protein-like [Tarenaya 
hassleriana]
Length=210

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            V N + FANIWSD VF +SLF+LLY NQ KV+LLKFTGYK++NN+SDTGKA LIILITDI
Sbjct  81   VENRKAFANIWSDTVFELSLFVLLYANQGKVALLKFTGYKILNNISDTGKAFLIILITDI  140

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLG HSESGWQTL E++VEHYG EVDQ+ +TIF+C VPVVIDACVKLWLFK+LP++SP+V
Sbjct  141  FLGCHSESGWQTLLEIMVEHYGIEVDQSVLTIFICFVPVVIDACVKLWLFKFLPRLSPRV  200

Query  399  SNIFREMKRH  370
            S+IF EMKRH
Sbjct  201  SSIFSEMKRH  210



>ref|XP_009620166.1| PREDICTED: chloroplast envelope membrane protein [Nicotiana tomentosiformis]
Length=432

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG+SLFILLYFN++KV LLKFTGYK++NNVSDTGKA LIIL+TDI
Sbjct  303  LENRKAFANIWSDFVFGVSLFILLYFNESKVKLLKFTGYKILNNVSDTGKAFLIILVTDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL EV+VEHYG EVD A IT+FVC+VPV+IDACVKLW+FK+LP++SP V
Sbjct  363  FLGYHSESGWQTLLEVLVEHYGIEVDPAMITLFVCLVPVIIDACVKLWMFKFLPRLSPSV  422

Query  399  SNIFREMKRH  370
            SNIFREM RH
Sbjct  423  SNIFREMTRH  432



>gb|ERN12584.1| hypothetical protein AMTR_s00025p00217750 [Amborella trichopoda]
Length=421

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGI+LF+L++FNQ+KV+L+KFTGYK+  NVSDTGKA LIIL+TDI
Sbjct  292  LENRKAFANIWSDMVFGIALFVLIFFNQSKVALMKFTGYKIFKNVSDTGKAFLIILVTDI  351

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+I+EHYG EVDQ+AITIF+ +VPVVIDACVKLWLFK+LPK+SPKV
Sbjct  352  FLGYHSESGWQTLIEIILEHYGLEVDQSAITIFISVVPVVIDACVKLWLFKFLPKLSPKV  411

Query  399  SNIFREMKRH  370
            SNIFREM+RH
Sbjct  412  SNIFREMRRH  421



>gb|EYU25775.1| hypothetical protein MIMGU_mgv1a026960mg, partial [Erythranthe 
guttata]
Length=389

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG+SLFILLY  QN+V+LLKFTGYK++NN++DTGKA LIILITDI
Sbjct  260  LENRKAFANIWSDMVFGVSLFILLYVYQNQVALLKFTGYKIVNNITDTGKAFLIILITDI  319

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG EVDQA ITIF+  VPVV+DACVKLW+FK+LP++SPKV
Sbjct  320  FLGYHSESGWQTLLEIIVEHYGIEVDQAVITIFISFVPVVMDACVKLWMFKFLPRLSPKV  379

Query  399  SNIFREMKRH  370
            +NIFREMKRH
Sbjct  380  ANIFREMKRH  389



>ref|XP_010928740.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X2 [Elaeis guineensis]
Length=371

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GI+LFIL+YFN++KV+LLKFTGYKL+NN+SDTGKA LIIL+TDI
Sbjct  242  LENRKAFANIWSDMVYGIALFILIYFNKSKVALLKFTGYKLLNNISDTGKAFLIILVTDI  301

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I+EHYG EVDQAAITIF+C  PVVIDACVKLWLFK LPK+SP V
Sbjct  302  FLGYHSESGWQALVEIILEHYGLEVDQAAITIFICSFPVVIDACVKLWLFKILPKLSPNV  361

Query  399  SNIFREMKRH  370
            +NIFREM+RH
Sbjct  362  ANIFREMQRH  371



>ref|XP_006282610.1| hypothetical protein CARUB_v10004828mg [Capsella rubella]
 gb|EOA15508.1| hypothetical protein CARUB_v10004828mg [Capsella rubella]
Length=440

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  311  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  370

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  371  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  430

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  431  SNIFQEMKRH  440



>ref|XP_010447624.1| PREDICTED: chloroplast envelope membrane protein-like [Camelina 
sativa]
Length=437

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  308  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  367

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  368  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  427

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  428  SNIFQEMKRH  437



>ref|XP_002867316.1| hypothetical protein ARALYDRAFT_913365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43575.1| hypothetical protein ARALYDRAFT_913365 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  310  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  369

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  370  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  429

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  430  SNIFQEMKRH  439



>dbj|BAD43985.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  309  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  368

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  369  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  428

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  429  SNIFQEMKRH  438



>dbj|BAD44317.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  309  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  368

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  369  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  428

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  429  SNIFQEMKRH  438



>gb|KJB53667.1| hypothetical protein B456_009G000300 [Gossypium raimondii]
Length=432

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF++L+ NQ+KV+LLKF GYK+I+N+SDTGKA LIILITDI
Sbjct  303  LENRKAFANIWSDMVFGISLFLVLHLNQSKVALLKFAGYKIISNISDTGKAFLIILITDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG +VDQ+AIT+FVC++PVVIDACVKLWLFK LP++SP+V
Sbjct  363  FLGYHSESGWQTLLEIIVEHYGLQVDQSAITVFVCLIPVVIDACVKLWLFKSLPRLSPRV  422

Query  399  SNIFREMKRH  370
            SNIFREMKRH
Sbjct  423  SNIFREMKRH  432



>ref|NP_567865.1| CemA-like proton extrusion protein-like protein [Arabidopsis 
thaliana]
 gb|AAL85996.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04130.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43184.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44303.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44592.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF02153.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85850.1| CemA-like proton extrusion protein-like protein [Arabidopsis 
thaliana]
Length=438

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  309  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  368

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  369  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  428

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  429  SNIFQEMKRH  438



>ref|XP_010525825.1| PREDICTED: chloroplast envelope membrane protein-like [Tarenaya 
hassleriana]
Length=422

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            V N + FANIWSD VFG+SLF+LLY NQ KV+LLKFTGYK++NN+SDTGKA LIILITDI
Sbjct  293  VENRKAFANIWSDTVFGLSLFVLLYANQGKVALLKFTGYKILNNISDTGKAFLIILITDI  352

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E++VEHYG EVDQ+ +TIF+C VPVVIDACVKLWLFK+LP++SP+V
Sbjct  353  FLGYHSESGWQTLLEIMVEHYGIEVDQSVLTIFICFVPVVIDACVKLWLFKFLPRLSPRV  412

Query  399  SNIFREMKRH  370
            S+IF EMKRH
Sbjct  413  SSIFSEMKRH  422



>gb|AAM64630.1| unknown [Arabidopsis thaliana]
Length=431

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  302  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  361

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  362  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  421

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  422  SNIFQEMKRH  431



>ref|XP_010438087.1| PREDICTED: chloroplast envelope membrane protein-like [Camelina 
sativa]
Length=443

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  314  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  373

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  374  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  433

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  434  SNIFQEMKRH  443



>ref|XP_010432908.1| PREDICTED: chloroplast envelope membrane protein-like [Camelina 
sativa]
Length=440

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  311  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGKAFLIILITDI  370

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  371  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  430

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  431  SNIFQEMKRH  440



>ref|XP_010928739.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Elaeis guineensis]
Length=429

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GI+LFIL+YFN++KV+LLKFTGYKL+NN+SDTGKA LIIL+TDI
Sbjct  300  LENRKAFANIWSDMVYGIALFILIYFNKSKVALLKFTGYKLLNNISDTGKAFLIILVTDI  359

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I+EHYG EVDQAAITIF+C  PVVIDACVKLWLFK LPK+SP V
Sbjct  360  FLGYHSESGWQALVEIILEHYGLEVDQAAITIFICSFPVVIDACVKLWLFKILPKLSPNV  419

Query  399  SNIFREMKRH  370
            +NIFREM+RH
Sbjct  420  ANIFREMQRH  429



>dbj|BAD44262.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LLY NQ +V+LLKF GYK+INN+SDTGKA LIILITDI
Sbjct  309  LENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFAGYKIINNISDTGKAFLIILITDI  368

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  369  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  428

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  429  SNIFQEMKRH  438



>ref|XP_008789722.1| PREDICTED: chloroplast envelope membrane protein-like [Phoenix 
dactylifera]
Length=436

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N + FANIWSD V+GI+ FIL+YFN+ KV+LLKFTGYKL+NN+SDTGKA LIIL+TD
Sbjct  306  RLENRKAFANIWSDMVYGIASFILIYFNKKKVALLKFTGYKLLNNISDTGKAFLIILLTD  365

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IFLGYHSESGWQ L E+I+EHYG EVDQAAITIF+C VPVV+DACVKLWLFK LPK+SP 
Sbjct  366  IFLGYHSESGWQALIEIILEHYGLEVDQAAITIFICSVPVVVDACVKLWLFKILPKLSPN  425

Query  402  VSNIFREMKRH  370
            VSNIFREM+RH
Sbjct  426  VSNIFREMQRH  436



>ref|XP_007014089.1| CemA-like proton extrusion protein-related isoform 1 [Theobroma 
cacao]
 gb|EOY31708.1| CemA-like proton extrusion protein-related isoform 1 [Theobroma 
cacao]
Length=432

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF+LL+ NQ+KV+L+KF GYK+I+N+SDTGKA LIILITDI
Sbjct  303  LENRKAFANIWSDMVFGISLFLLLHLNQSKVALMKFAGYKIISNISDTGKAFLIILITDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+IVEHYG +VDQ+AIT+FVC++PVV DACVKLWLFK+LP++SP+V
Sbjct  363  FLGYHSESGWQTLLEIIVEHYGLQVDQSAITVFVCLIPVVADACVKLWLFKFLPRLSPRV  422

Query  399  SNIFREMKRH  370
            +NIF+EMKRH
Sbjct  423  ANIFQEMKRH  432



>ref|XP_009420410.1| PREDICTED: chloroplast envelope membrane protein-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+ I+LFIL+YFN++KV+LLKFTGYKL+NN+SDTGKA LIILITDI
Sbjct  305  LENRKAFANIWSDMVYSITLFILIYFNKSKVALLKFTGYKLLNNISDTGKAFLIILITDI  364

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I+EHYG E+D+AAITIF+C VPVVIDACVKLWLF++LP++SP V
Sbjct  365  FLGYHSESGWQALIEIILEHYGLEIDKAAITIFICSVPVVIDACVKLWLFRFLPRLSPNV  424

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  425  SNIFQEMKRH  434



>ref|XP_011078171.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Sesamum indicum]
Length=455

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 123/155 (79%), Gaps = 25/155 (16%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG++LFILLYF QN+V+LLKFTGYKL+NNVSDTGKA LIILITDI
Sbjct  301  LENRKAFANIWSDMVFGVTLFILLYFYQNQVALLKFTGYKLVNNVSDTGKAFLIILITDI  360

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW------------  436
            FLGYHSESGWQTL E+IVEHYGFEVDQAAITIFVC+VPV+IDACVKLW            
Sbjct  361  FLGYHSESGWQTLLEIIVEHYGFEVDQAAITIFVCLVPVIIDACVKLWVCLLSVLILRDL  420

Query  435  -------------LFKYLPKISPKVSNIFREMKRH  370
                         +FK+LP++SPKV+NIF+EMKRH
Sbjct  421  QRFAHLTTHIVLQMFKFLPRLSPKVANIFQEMKRH  455



>gb|KFK29684.1| hypothetical protein AALP_AA7G165300 [Arabis alpina]
Length=432

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF LLY NQ +V+LLKFTG K+INN+SDTGKA LIILITDI
Sbjct  303  LENRKAFANIWSDMVFGISLFALLYANQGRVALLKFTGNKIINNISDTGKAFLIILITDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+TL E+I+EHYG EV+Q+ ITIF+C+VPV++DACVKLWLFK+LP++SP+V
Sbjct  363  FLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPRV  422

Query  399  SNIFREMKRH  370
            SNIF+EMKRH
Sbjct  423  SNIFQEMKRH  432



>ref|XP_006468098.1| PREDICTED: chloroplast envelope membrane protein-like [Citrus 
sinensis]
Length=434

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLFILLY NQ+KV+LLKFTGYK+INN+SD GKA LIIL+TDI
Sbjct  305  LENRKAFANIWSDLVFGISLFILLYLNQSKVALLKFTGYKIINNISDAGKAFLIILVTDI  364

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQTL E+I+EHYG E D++AI  FVC+VPV +DACVKLWLFK LP ++P+V
Sbjct  365  FLGYHSESGWQTLVEIILEHYGIEADESAIITFVCVVPVFMDACVKLWLFKKLPGLAPRV  424

Query  399  SNIFREMKRH  370
            SNIF+EM+RH
Sbjct  425  SNIFKEMRRH  434



>ref|XP_008781702.1| PREDICTED: chloroplast envelope membrane protein [Phoenix dactylifera]
Length=424

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GI+LFIL+YFN+ KV+LLKFTGYKL+N+ SDTG+A L+IL+TDI
Sbjct  295  LENRKTFANIWSDMVYGIALFILIYFNKCKVALLKFTGYKLLNDTSDTGRAFLVILVTDI  354

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I+EHYG EVDQAAITIF+C  PV +DACVKLWLFK+LPK+SP V
Sbjct  355  FLGYHSESGWQALIEIILEHYGLEVDQAAITIFICSFPVAVDACVKLWLFKFLPKLSPNV  414

Query  399  SNIFREMKRH  370
            +NI +EMKRH
Sbjct  415  TNILQEMKRH  424



>ref|XP_009382830.1| PREDICTED: chloroplast envelope membrane protein-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD V+GI+LF+L+YFN++KV+LLK TGYKL+NN+SDTGKA LIILITDI
Sbjct  306  LENRRAFANIWSDLVYGITLFVLIYFNKSKVALLKVTGYKLLNNISDTGKAFLIILITDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGWQ L E+I++HYG +VD+AAITIF+C  PV+IDACVKLWLFK+LP++SP V
Sbjct  366  FLGYHSESGWQVLVEIILDHYGLDVDEAAITIFICSFPVMIDACVKLWLFKFLPRLSPNV  425

Query  399  SNIFREMKRH  370
             NIFREM+RH
Sbjct  426  YNIFREMQRH  435



>gb|EEC83122.1| hypothetical protein OsI_28281 [Oryza sativa Indica Group]
 gb|EEE68254.1| hypothetical protein OsJ_26461 [Oryza sativa Japonica Group]
Length=427

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GISLF+L+YFNQ+KV++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  298  LENRKAFANIWSDMVYGISLFLLMYFNQSKVAMLKFTGYKLLNNISDSGKAFLIILVSDI  357

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW +L EVI+EHYG E DQAAIT FVC+VPV +D  +K W++KYLP++SP V
Sbjct  358  LLGYHSESGWHSLVEVILEHYGLEADQAAITFFVCLVPVALDVFIKFWVYKYLPRLSPSV  417

Query  399  SNIFREMKRH  370
             NI  E+KRH
Sbjct  418  GNILDEIKRH  427



>ref|XP_006659940.1| PREDICTED: chloroplast envelope membrane protein-like [Oryza 
brachyantha]
Length=422

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+G+SLF+L+YFNQ+KV++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  293  LENRKAFANIWSDMVYGVSLFLLMYFNQSKVAMLKFTGYKLLNNISDSGKAFLIILVSDI  352

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW +L EVI+EHYG E DQAAIT FVC+VPV +D  +K W++KYLP++SP V
Sbjct  353  LLGYHSESGWHSLVEVILEHYGLEADQAAITFFVCLVPVALDVFIKFWVYKYLPRLSPSV  412

Query  399  SNIFREMKRH  370
             NI  E+KRH
Sbjct  413  GNILDEIKRH  422



>dbj|BAD02988.1| putative heme binding protein cemA [Oryza sativa Japonica Group]
Length=461

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GISLF+L+YFNQ+KV++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  332  LENRKAFANIWSDMVYGISLFLLMYFNQSKVAMLKFTGYKLLNNISDSGKAFLIILVSDI  391

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW +L EVI+EHYG E DQAAIT FVC+VPV +D  +K W++KYLP++SP V
Sbjct  392  LLGYHSESGWHSLVEVILEHYGLEADQAAITFFVCLVPVALDVFIKFWVYKYLPRLSPSV  451

Query  399  SNIFREMKRH  370
             NI  E+KRH
Sbjct  452  GNILDEIKRH  461



>ref|XP_010278478.1| PREDICTED: uncharacterized protein LOC104612658 isoform X2 [Nelumbo 
nucifera]
Length=489

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N R FANIWSD VFGI+LFILLYFNQ+KV+LLKFTGYKLINN+SDTGKA LIILITD
Sbjct  297  RLENRRAFANIWSDMVFGITLFILLYFNQSKVALLKFTGYKLINNISDTGKAFLIILITD  356

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
            IFLGYHSESGWQTL E+IVEHYGFEVDQ+ ITIFVC+VPVVIDACVKLW
Sbjct  357  IFLGYHSESGWQTLLEIIVEHYGFEVDQSVITIFVCLVPVVIDACVKLW  405



>ref|XP_008649946.1| PREDICTED: chloroplast envelope membrane protein-like [Zea mays]
 tpg|DAA42857.1| TPA: hypothetical protein ZEAMMB73_219141 [Zea mays]
Length=436

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+L+ FNQ+KV++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  307  LENRNAFANIWSDTVYGIVLFLLMCFNQSKVAMLKFTGYKLLNNISDSGKAFLIILVSDI  366

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW TL EVI+EHYGFE D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  367  LLGYHSESGWHTLVEVILEHYGFEADEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  426

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  427  GNVLDEIKRH  436



>ref|XP_003573565.1| PREDICTED: chloroplast envelope membrane protein [Brachypodium 
distachyon]
Length=425

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+G++LF+++YFNQ+KV++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  296  LENRQAFANIWSDMVYGVTLFLIMYFNQSKVAMLKFTGYKLLNNISDSGKAFLIILVSDI  355

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSE+GW +L E+I+EHYG E DQAA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  356  LLGYHSEAGWHSLVEIILEHYGLETDQAAVTFFVCLVPVALDVFIKFWVYKYLPRLSPSV  415

Query  399  SNIFREMKRH  370
             NI  E++RH
Sbjct  416  GNILDEIRRH  425



>ref|XP_010278477.1| PREDICTED: uncharacterized protein LOC104612658 isoform X1 [Nelumbo 
nucifera]
Length=510

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N R FANIWSD VFGI+LFILLYFNQ+KV+LLKFTGYKLINN+SDTGKA LIILITD
Sbjct  297  RLENRRAFANIWSDMVFGITLFILLYFNQSKVALLKFTGYKLINNISDTGKAFLIILITD  356

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
            IFLGYHSESGWQTL E+IVEHYGFEVDQ+ ITIFVC+VPVVIDACVKLW
Sbjct  357  IFLGYHSESGWQTLLEIIVEHYGFEVDQSVITIFVCLVPVVIDACVKLW  405



>ref|XP_011078174.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X4 [Sesamum indicum]
Length=408

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFG++LFILLYF QN+V+LLKFTGYKL+NNVSDTGKA LIILITDI
Sbjct  301  LENRKAFANIWSDMVFGVTLFILLYFYQNQVALLKFTGYKLVNNVSDTGKAFLIILITDI  360

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
            FLGYHSESGWQTL E+IVEHYGFEVDQAAITIFVC+VPV+IDACVKLW
Sbjct  361  FLGYHSESGWQTLLEIIVEHYGFEVDQAAITIFVCLVPVIIDACVKLW  408



>ref|XP_011078173.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X3 [Sesamum indicum]
Length=427

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N + FANIWSD VFG++LFILLYF QN+V+LLKFTGYKL+NNVSDTGKA LIILITD
Sbjct  300  RLENRKAFANIWSDMVFGVTLFILLYFYQNQVALLKFTGYKLVNNVSDTGKAFLIILITD  359

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWL  433
            IFLGYHSESGWQTL E+IVEHYGFEVDQAAITIFVC+VPV+IDACVKLW+
Sbjct  360  IFLGYHSESGWQTLLEIIVEHYGFEVDQAAITIFVCLVPVIIDACVKLWV  409



>ref|NP_001143182.1| uncharacterized protein LOC100275682 [Zea mays]
 gb|ACG29575.1| hypothetical protein [Zea mays]
Length=432

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FAN+WSD V+G+ LF+L+ FNQ+KV++LKFTGYKL+NN+SDTGKA LIIL++DI
Sbjct  303  LENRQAFANVWSDMVYGVVLFLLICFNQSKVAMLKFTGYKLLNNISDTGKAFLIILVSDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW T+ EVI+EHYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  363  LLGYHSESGWHTMVEVILEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  422

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  423  GNVLDEIKRH  432



>ref|XP_008669837.1| PREDICTED: uncharacterized protein LOC100275682 isoform X1 [Zea 
mays]
 tpg|DAA42864.1| TPA: hypothetical protein ZEAMMB73_015938 [Zea mays]
Length=435

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FAN+WSD V+G+ LF+L+ FNQ+KV++LKFTGYKL+NN+SDTGKA LIIL++DI
Sbjct  306  LENRQAFANVWSDMVYGVVLFLLICFNQSKVAMLKFTGYKLLNNISDTGKAFLIILVSDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW T+ EVI+EHYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  366  LLGYHSESGWHTMVEVILEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  425

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  426  GNVLDEIKRH  435



>ref|XP_008658167.1| PREDICTED: uncharacterized protein LOC100216851 isoform X1 [Zea 
mays]
 gb|AFW89849.1| hypothetical protein ZEAMMB73_457840 [Zea mays]
Length=425

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+L+ FNQ+KV++LKFTGYK++NN+SD+GKA LIIL++DI
Sbjct  296  LENRNAFANIWSDTVYGIVLFLLMCFNQSKVAMLKFTGYKVLNNISDSGKAFLIILVSDI  355

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW TL EVI+EHYG E D+AA+T FVC+VPV  D  +K W++KYLP++SP V
Sbjct  356  LLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLVPVAFDVYIKYWVYKYLPRLSPSV  415

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  416  GNVLDEIKRH  425



>dbj|BAK06987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + F NIWSD V+G++LF+L+YFNQ++V++LKFTGYKL+NN+SD+GKA LIIL++DI
Sbjct  296  LENRQAFGNIWSDMVYGVALFLLMYFNQSEVAMLKFTGYKLLNNISDSGKAFLIILVSDI  355

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSE+GW +L E+I++HYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  356  LLGYHSEAGWHSLVEIILDHYGLETDEAAVTFFVCLVPVALDVFIKFWVYKYLPRLSPSV  415

Query  399  SNIFREMKRH  370
             NI  E++RH
Sbjct  416  GNILDEIRRH  425



>gb|AGT15927.1| hypothetical protein SHCRBa_040_O01_F_70 [Saccharum hybrid cultivar 
R570]
Length=426

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 108/133 (81%), Gaps = 5/133 (4%)
 Frame = -1

Query  753  NWR-----GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILI  589
            +WR      FANIWSD V+GI LF+L+ FNQ+KV++LKFTGYKL+NN+SD+GKA LII++
Sbjct  294  DWRLENRAAFANIWSDMVYGIVLFLLMCFNQSKVAMLKFTGYKLLNNISDSGKAFLIIIV  353

Query  588  TDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKIS  409
            +DI LGYHSESGW TL EVI+EHYG E D+AA+T FVC+ PV +D  +K W++KYLP++S
Sbjct  354  SDILLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLFPVALDVYIKFWVYKYLPRLS  413

Query  408  PKVSNIFREMKRH  370
            P V N+  E+KRH
Sbjct  414  PSVGNVLDEIKRH  426



>gb|AGT17438.1| hypothetical protein SHCRBa_062_F01_R_230 [Saccharum hybrid cultivar 
R570]
Length=429

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 108/133 (81%), Gaps = 5/133 (4%)
 Frame = -1

Query  753  NWR-----GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILI  589
            +WR      FANIWSD V+GI LF+L+ FNQ+KV++LKFTGYKL+NN+SD+GKA LII++
Sbjct  297  DWRLENRAAFANIWSDMVYGIVLFLLMCFNQSKVAMLKFTGYKLLNNISDSGKAFLIIIV  356

Query  588  TDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKIS  409
            +DI LGYHSESGW TL EVI+EHYG E D+AA+T FVC+ PV +D  +K W++KYLP++S
Sbjct  357  SDILLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLFPVALDVYIKFWVYKYLPRLS  416

Query  408  PKVSNIFREMKRH  370
            P V N+  E+KRH
Sbjct  417  PSVGNVLDEIKRH  429



>gb|EPS63936.1| hypothetical protein M569_10843, partial [Genlisea aurea]
Length=414

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N R FANIWSD VFGISLF+LLY  +++V+LLKFTGYK++NNV+DTGKA LIIL+TDI
Sbjct  306  LENRRAFANIWSDTVFGISLFVLLYCCRSEVALLKFTGYKILNNVTDTGKAFLIILVTDI  365

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWL  433
            FLGYHSESGWQTL EVIVEHYGFE+DQAAITIFVC +PVVIDACVKLW+
Sbjct  366  FLGYHSESGWQTLLEVIVEHYGFEIDQAAITIFVCFIPVVIDACVKLWV  414



>gb|AGT16440.1| hypothetical protein SHCRBa_062_I05_F_110 [Saccharum hybrid cultivar 
R570]
Length=435

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+L+ FNQ+KV++LKFTGYKL+NN+SD+GKA LII+++DI
Sbjct  299  LENRAAFANIWSDMVYGIVLFLLMCFNQSKVAMLKFTGYKLLNNISDSGKAFLIIIVSDI  358

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVK-------LWLFKYL  421
             LGYHSESGW TL EVI+EHYG E D+AA+T FVC+ PV +D  +K       L ++KYL
Sbjct  359  LLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLFPVALDVYIKYLVYFTMLQVYKYL  418

Query  420  PKISPKVSNIFREMKRH  370
            P++SP V N+  E+KRH
Sbjct  419  PRLSPSVGNVLDEIKRH  435



>gb|KDO37118.1| hypothetical protein CISIN_1g033027mg [Citrus sinensis]
Length=129

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -1

Query  672  KVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAA  493
            +V+LLKFTGYK+INN+SD GKA LIIL+TDIFLGYHSESGWQTL E+I+EHYG E D++A
Sbjct  29   QVALLKFTGYKIINNISDAGKAFLIILVTDIFLGYHSESGWQTLVEIILEHYGIEADESA  88

Query  492  ITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREMKRH  370
            I  FVC+VPV +DACVKLWLFK LP ++P+VSNIF+EM+RH
Sbjct  89   IITFVCVVPVFMDACVKLWLFKKLPGLAPRVSNIFKEMRRH  129



>ref|XP_004243667.1| PREDICTED: chloroplast envelope membrane protein [Solanum lycopersicum]
Length=448

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FA I+SD V G+SLFILL FN++KV LLKFTGYK++NN+SD GKA LIILI+D 
Sbjct  319  LENRKAFAYIFSDFVSGVSLFILLCFNESKVKLLKFTGYKILNNISDAGKAFLIILISDT  378

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSE GW T  E++VEHYG EVD++AITIFVCIVPV+ D  VKLW+FKYLP++S +V
Sbjct  379  LLGYHSEYGWNTALEMLVEHYGIEVDRSAITIFVCIVPVITDTFVKLWIFKYLPRLSSEV  438

Query  399  SNIFREMKRH  370
                ++MKRH
Sbjct  439  PKYIQKMKRH  448



>gb|AGT15926.1| hypothetical protein SHCRBa_040_O01_F_60 [Saccharum hybrid cultivar 
R570]
Length=428

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+LL FNQ+KV++LKFTGYKL+NN+SDTGKA LIILI+DI
Sbjct  299  LENREAFANIWSDMVYGIVLFLLLCFNQSKVAMLKFTGYKLLNNISDTGKAFLIILISDI  358

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW T+ EV++EHYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  359  LLGYHSESGWHTMVEVVLEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  418

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  419  GNVLDEIKRH  428



>gb|AGT16439.1| hypothetical protein SHCRBa_062_I05_F_100 [Saccharum hybrid cultivar 
R570]
Length=423

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+LL FNQ+KV++LKFTGYKL+NN+SDTGKA LIILI+DI
Sbjct  294  LENREAFANIWSDMVYGIVLFLLLCFNQSKVAMLKFTGYKLLNNISDTGKAFLIILISDI  353

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW T+ EV++EHYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  354  LLGYHSESGWHTMVEVVLEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  413

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  414  GNVLDEIKRH  423



>ref|XP_002466007.1| hypothetical protein SORBIDRAFT_01g049970 [Sorghum bicolor]
 gb|EER93005.1| hypothetical protein SORBIDRAFT_01g049970 [Sorghum bicolor]
Length=432

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+LL FNQ+KV++LKFTGYKL+NN+SDTGKA LIILI+DI
Sbjct  303  LENREAFANIWSDMVYGIVLFLLLCFNQSKVAMLKFTGYKLLNNISDTGKAFLIILISDI  362

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW T+ EV++EHYG E D+AA+T FVC+VPV +D  +K W++KYLP++SP V
Sbjct  363  LLGYHSESGWHTMVEVVLEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLPRLSPSV  422

Query  399  SNIFREMKRH  370
             N+  E+KRH
Sbjct  423  GNVLDEIKRH  432



>ref|XP_004972549.1| PREDICTED: chloroplast envelope membrane protein-like isoform 
X1 [Setaria italica]
Length=424

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD V+GI+LF+++ FNQ+KV++LKFTGYKL+NN+SD+GKA LIILI+DI
Sbjct  295  LENRKAFANIWSDMVYGIALFLIICFNQSKVAMLKFTGYKLLNNISDSGKAFLIILISDI  354

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSESGW TL EVI+EHYG E D+AA+T FVC+VPV  D  +K W++KYLP++SP V
Sbjct  355  LLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLVPVAFDVLIKFWVYKYLPRLSPSV  414

Query  399  SNIFREMKRH  370
             NI  E+ RH
Sbjct  415  VNILDEITRH  424



>ref|XP_001771702.1| predicted protein [Physcomitrella patens]
 gb|EDQ63485.1| predicted protein, partial [Physcomitrella patens]
Length=345

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FA++ SD + G+++ +LL FN  +V++++ TG +L  N+SDTGKA +IIL+TDI
Sbjct  216  LENRQAFASLGSDFIAGLTILLLLVFNPQQVAIMRLTGERLFTNISDTGKAFIIILLTDI  275

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            FLGYHSESGW+T+SE+++EHYG EV QAAI IFV IVPV IDAC KLW+F++   +SP  
Sbjct  276  FLGYHSESGWETVSEMVLEHYGIEVSQAAIYIFVAIVPVTIDACFKLWVFRFFRTLSPSA  335

Query  399  SNIFREMKRH  370
            S  FREM+RH
Sbjct  336  SATFREMQRH  345



>gb|AGT17439.1| hypothetical protein SHCRBa_062_F01_R_270 [Saccharum hybrid cultivar 
R570]
Length=433

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 108/136 (79%), Gaps = 6/136 (4%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N   FANIWSD V+GI LF+LL FNQ+KV++LKFTGYKL+NN+SDTGKA LIILI+DI
Sbjct  298  LENREAFANIWSDMVYGIVLFLLLCFNQSKVAMLKFTGYKLLNNISDTGKAFLIILISDI  357

Query  579  FLGY------HSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLP  418
             LGY      HSESGW T+ EV++EHYG E D+AA+T FVC+VPV +D  +K W++KYLP
Sbjct  358  LLGYLHFCRYHSESGWHTMVEVVLEHYGLESDEAAVTFFVCLVPVALDVYIKFWVYKYLP  417

Query  417  KISPKVSNIFREMKRH  370
            ++SP V N+  E+KRH
Sbjct  418  RLSPSVGNVLDEIKRH  433



>ref|XP_006353748.1| PREDICTED: chloroplast envelope membrane protein-like [Solanum 
tuberosum]
Length=446

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANI+SD VFG+SLFILL FN++KV LLKFTGYK++NN+SD GKA LIILI+DI
Sbjct  317  LENRKAFANIFSDFVFGVSLFILLCFNESKVKLLKFTGYKILNNISDAGKAFLIILISDI  376

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
             LGYHSE GW T  E++VEHYG EVD++AITIFVCIVPVV D  VKLW+FKYLP++S +V
Sbjct  377  LLGYHSEYGWTTAVEMLVEHYGIEVDRSAITIFVCIVPVVTDTFVKLWIFKYLPRLSAEV  436

Query  399  SNIFREMKRH  370
                ++MKRH
Sbjct  437  PKYIQKMKRH  446



>emb|CAN72886.1| hypothetical protein VITISV_019713 [Vitis vinifera]
Length=1504

 Score =   157 bits (398),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  669  VSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAI  490
            V+LLKFTGYK+INN+SDTGKA LIILITDIFLGYHSESGWQTL EV+VEHYG EVDQ+AI
Sbjct  86   VALLKFTGYKIINNISDTGKAFLIILITDIFLGYHSESGWQTLLEVVVEHYGLEVDQSAI  145

Query  489  TIFVCIVPVVIDACVKLWLFKYL  421
            TIFVC++PVVIDACVKLW F Y+
Sbjct  146  TIFVCLIPVVIDACVKLWSFVYI  168



>ref|XP_001771874.1| predicted protein [Physcomitrella patens]
 gb|EDQ63303.1| predicted protein [Physcomitrella patens]
Length=726

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFL  574
            N + FA+IWSD   G+++ +LL  N  +V++++ TG +L  N+SDTGKA +IIL+TDIFL
Sbjct  526  NRQAFASIWSDFAAGLTILLLLILNPKQVAIMQLTGERLFTNISDTGKAFIIILLTDIFL  585

Query  573  GYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
            GYHSESGW+T+SE+++EHYGFEV QAAI  FV IVPV IDAC KLW
Sbjct  586  GYHSESGWETVSEMVLEHYGFEVSQAAIYTFVAIVPVTIDACFKLW  631



>ref|NP_001061276.2| Os08g0224300 [Oryza sativa Japonica Group]
 dbj|BAF23190.2| Os08g0224300 [Oryza sativa Japonica Group]
Length=107

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  672  KVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAA  493
            +V++LKFTGYKL+NN+SD+GKA LIIL++DI LGYHSESGW +L EVI+EHYG E DQAA
Sbjct  18   QVAMLKFTGYKLLNNISDSGKAFLIILVSDILLGYHSESGWHSLVEVILEHYGLEADQAA  77

Query  492  ITIFVCIVPVVIDACVKLW  436
            IT FVC+VPV +D  +K W
Sbjct  78   ITFFVCLVPVALDVFIKFW  96



>ref|XP_002466009.1| hypothetical protein SORBIDRAFT_01g049976 [Sorghum bicolor]
 gb|EER93007.1| hypothetical protein SORBIDRAFT_01g049976, partial [Sorghum bicolor]
Length=96

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  615  GKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
            GKA LII+++DI LGYHSESGW TL +VI+EHYG E D+AA+T FVC+ PV +D  +K W
Sbjct  15   GKAFLIIIVSDILLGYHSESGWHTLVQVILEHYGLEADEAAVTFFVCLFPVALDVYIKFW  74

Query  435  LFKYLPKISPKVSNIFREMKRH  370
            ++KYLP++SP V N+  E+KRH
Sbjct  75   VYKYLPRLSPSVGNVLDEIKRH  96



>emb|CDY13408.1| BnaA03g51260D [Brassica napus]
Length=308

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWSD VFGISLF LLY NQ +V+LLKFTGYK+INN+SDTGK  LIILITDI
Sbjct  224  LENRKAFANIWSDMVFGISLFALLYANQGRVALLKFTGYKIINNISDTGKTFLIILITDI  283

Query  579  FLGYHSESGWQTL  541
            FLGYHSESGW+TL
Sbjct  284  FLGYHSESGWETL  296



>ref|XP_005642727.1| hypothetical protein COCSUDRAFT_26464 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18183.1| hypothetical protein COCSUDRAFT_26464 [Coccomyxa subellipsoidea 
C-169]
Length=258

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFL  574
            N     N+ SD+   ++ F LL  N +    L  T  +L++  SDT KA LII  TDI L
Sbjct  131  NRTALLNLLSDSTTALTGFALLLRNSDGRGALFRTIGRLLSGFSDTAKAFLIIASTDILL  190

Query  573  GYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSN  394
            GYHSE GW     ++  HYG EV++A I IFV IVPV +DA  KLW+F+ L +++P  + 
Sbjct  191  GYHSEEGWTAAIHLLTGHYGLEVEEAPIYIFVAIVPVTMDAFFKLWIFQGLNRVNPAAAV  250

Query  393  IFREMKRH  370
              R M RH
Sbjct  251  TLRSMDRH  258



>ref|XP_011399168.1| Chloroplast envelope membrane protein [Auxenochlorella protothecoides]
 gb|KFM26272.1| Chloroplast envelope membrane protein [Auxenochlorella protothecoides]
Length=315

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 0/141 (0%)
 Frame = -1

Query  792  SESVRNAG*AEVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTG  613
            +E+ R  G  +  N     N+ SD+V G  +F  L  N ++ ++L  T  ++++ +SDT 
Sbjct  175  AEAKRIQGEYKAYNRAALTNLVSDSVTGSLIFAALLQNNSQRTILFRTIGRILSGLSDTA  234

Query  612  KALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWL  433
            KA LIIL+TD  LGYHSE GW   +++  +HYGF   + +I IFV IVPV +D+  K W+
Sbjct  235  KAFLIILVTDTLLGYHSEEGWTAAAQLFTQHYGFHPSEDSIQIFVSIVPVCLDSYFKYWI  294

Query  432  FKYLPKISPKVSNIFREMKRH  370
            F  L K  P  +   R M RH
Sbjct  295  FVGLNKQDPAAAVTLRNMDRH  315



>emb|CDX72287.1| BnaC07g43090D [Brassica napus]
Length=236

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 3/69 (4%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            + N + FANIWS  VFGISLF LLY NQ   +LLKFTGYK+INN+SDTGKA LIILITDI
Sbjct  171  LENRKAFANIWSGMVFGISLFALLYANQ---ALLKFTGYKIINNISDTGKAFLIILITDI  227

Query  579  FLGYHSESG  553
            FLGYHSESG
Sbjct  228  FLGYHSESG  236



>ref|WP_026732237.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=464

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 74/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
            G  N+ +D +  +S   L+YFN++K++ ++    +   ++ D  K  L ILITD+F+G+H
Sbjct  341  GIKNLLADGIALVSFAGLVYFNRSKLAAIRNFSNRTFLSLGDPTKVFLFILITDMFVGFH  400

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW  L +    H+G   ++AA+  F+  VPV+ID+C+K W+F YL + SP  S I+ 
Sbjct  401  SAEGWDVLLQSFTHHFGLPENEAAVKTFIATVPVIIDSCIKFWIFSYLTRFSPSASAIYE  460

Query  384  EM  379
             M
Sbjct  461  RM  462



>ref|XP_011078175.1| PREDICTED: uncharacterized protein LOC105161981 isoform X5 [Sesamum 
indicum]
Length=381

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
             + N + FANIWSD VFG++LFILLYF QN+V+LLKFTGYKL+NNVSDTGKA LIILITD
Sbjct  300  RLENRKAFANIWSDMVFGVTLFILLYFYQNQVALLKFTGYKLVNNVSDTGKAFLIILITD  359

Query  582  IFLG  571
            IFLG
Sbjct  360  IFLG  363



>ref|WP_040630852.1| proton extrusion protein PcxA, partial [Microchaete sp. PCC 7126]
Length=259

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            ++++     N+++D +  I+L IL+   + ++S+L      +  ++SD+ KA LIIL TD
Sbjct  130  KIKSINAVTNVFTDILTAITLIILILTGKQQLSILMSFAGDITYSLSDSAKAFLIILSTD  189

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GWQ + E   +HYG   +++  ++F+  VPV++D   K W+F+YL + SP 
Sbjct  190  IFVGFHSPYGWQIIIENTFQHYGLPENKSLTSLFIATVPVIMDTVFKYWIFRYLNRSSPS  249

Query  402  VSNIFREM  379
                +R M
Sbjct  250  AVATYRNM  257



>ref|WP_042466382.1| proton extrusion protein PcxA, partial [Anabaena cylindrica]
Length=259

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            ++ +     N+++D +  I+L IL+   + ++S+L      +  ++SD+ KA LIIL TD
Sbjct  130  KIESINAVTNVFTDILTAITLIILILTGKQQLSILMSFAGDITYSLSDSAKAFLIILSTD  189

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GWQ + E   +HYG   +++  ++F+  VPV++D   K W+F+YL + SP 
Sbjct  190  IFVGFHSPYGWQIIIESAFQHYGLPENKSLTSLFIATVPVIMDTVFKYWIFRYLNRSSPS  249

Query  402  VSNIFREM  379
                +R M
Sbjct  250  AVATYRNM  257



>ref|WP_015132959.1| envelope membrane protein [Leptolyngbya sp. PCC 7376]
 gb|AFY37179.1| envelope membrane protein [Leptolyngbya sp. PCC 7376]
Length=433

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 78/126 (62%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R++  + NI++D     +  ++L F+Q ++++LK    ++I  +SD+ KA LIIL TDIF
Sbjct  306  RSFNAYENIFADICSFFAFVVVLIFSQREIAVLKSFLDEVIYGLSDSAKAFLIILFTDIF  365

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +GYHS  GW+ + E + +H+G    +    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  366  VGYHSPHGWEIVLESVAKHFGIAESRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  425

Query  396  NIFREM  379
              +R M
Sbjct  426  ATYRNM  431



>ref|WP_036532828.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF72788.1| hypothetical protein DO97_04700 [Neosynechococcus sphagnicola 
sy1]
Length=452

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+  G+ N+ SD V  ++   L+Y  ++K+  L+    +   ++SD  K  L IL+TD+F
Sbjct  325  RSLDGWKNLLSDGVSLMAFAGLVYLGRDKLMGLRRFSNQTFLSLSDPAKVFLFILVTDMF  384

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E  + H+G    +  I +F+  +PV++D+C+K W+F YL + SP  S
Sbjct  385  VGFHSAEGWEVILEGTLRHFGLPESKGFIYLFIATIPVIMDSCIKFWIFNYLTRFSPSTS  444

Query  396  NIFREM  379
             I+  M
Sbjct  445  AIYERM  450



>ref|YP_009051128.1| chloroplast envelope membrane protein [Galdieria sulphuraria]
 ref|XP_005705041.1| [pt] chloroplast envelope protein [Galdieria sulphuraria]
 gb|EME28521.1| [pt] chloroplast envelope protein [Galdieria sulphuraria]
 gb|AIG92571.1| chloroplast envelope membrane protein [Galdieria sulphuraria]
Length=278

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI +D    I++ IL+   + ++++LK    +L+  +SDT KA LIIL TDIF+G+HS  
Sbjct  158  NILADISSVIAIAILMILGRRQITILKSFLDELVYGLSDTAKAFLIILFTDIFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E I+ H+G   ++  I +F+   PV++D   K W+F+YL ++SP     +R M
Sbjct  218  GWEVIIEAILRHFGLPENRDFIFLFIATFPVLLDTVFKYWIFRYLNRVSPSAVATYRNM  276



>ref|WP_035158326.1| proton extrusion protein PcxA [Calothrix sp. 336/3]
 gb|KFB82029.1| proton extrusion protein PcxA [Calothrix sp. 336/3]
Length=420

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -1

Query  747  RGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGY  568
            +  +NI++D++  ++  I++  N+ +++++K    +++  +SD+ KA +IIL TD+F+G+
Sbjct  296  QAISNIFADSLSLLAFAIIIITNKKQIAVVKLFMDEIVYGLSDSAKAFIIILCTDVFVGF  355

Query  567  HSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIF  388
            HS  GW+ L E + EH G   +++AI +F+   PV++D   K W+F+YL ++SP     F
Sbjct  356  HSPHGWEVLLEGLGEHLGIAPERSAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATF  415

Query  387  REM  379
            +EM
Sbjct  416  KEM  418



>ref|WP_011242865.1| MULTISPECIES: proton extrusion protein PcxA [Synechococcus]
 sp|Q5N4M6.1|PCXA_SYNP6 RecName: Full=Proton extrusion protein PcxA [Synechococcus elongatus 
PCC 6301]
 sp|Q31PJ8.1|PCXA_SYNE7 RecName: Full=Proton extrusion protein PcxA [Synechococcus elongatus 
PCC 7942]
 dbj|BAD78743.1| cytoplasmic membrane protein [Synechococcus elongatus PCC 6301]
 gb|ABB57021.1| cytoplasmic membrane protein [Synechococcus elongatus PCC 7942]
 gb|AJD58458.1| proton extrusion protein PcxA [Synechococcus sp. UTEX 2973]
Length=421

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D +   +  ILL  +Q ++ LLK    +++  +SD+ KA +IIL TDIF+G+HS  
Sbjct  301  NIFADLISAAAFAILLISSQEEIQLLKSFIDEVVYGISDSAKAFIIILFTDIFVGFHSPH  360

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E I  H+G   +++ I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  361  GWEVILESISRHFGIPENRSFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNM  419



>ref|XP_005844579.1| hypothetical protein CHLNCDRAFT_138830 [Chlorella variabilis]
 gb|EFN52477.1| hypothetical protein CHLNCDRAFT_138830 [Chlorella variabilis]
Length=453

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 67/128 (52%), Gaps = 0/128 (0%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFL  574
            N R   N+ SD       F++L     +  +L  T  ++   +SDT KA LIIL TDI L
Sbjct  326  NKRAMLNVVSDTTSATVFFVMLARQVPQRQILFRTIGRVFTGLSDTAKAFLIILTTDILL  385

Query  573  GYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSN  394
            GYHSE GW     +   HYG E +  ++ IFV  VPV  D+  K+W+F  L K  P  + 
Sbjct  386  GYHSEEGWTAFLRIFSGHYGLEAEGESLKIFVATVPVFFDSLFKVWIFIGLNKQDPAAAV  445

Query  393  IFREMKRH  370
              ++M RH
Sbjct  446  TLKQMDRH  453



>ref|YP_007878286.1| chloroplast envelope membrane protein (chloroplast) [Calliarthron 
tuberculosum]
 gb|AGA63897.1| chloroplast envelope membrane protein (chloroplast) [Calliarthron 
tuberculosum]
Length=278

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 0/124 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
               NI SD V  I+  +++   + +VS+LK    ++I  +SDT KA LIIL TDIF+G+H
Sbjct  155  AIKNIISDIVSIITFLLIISTTKRQVSILKSFINQVIYGLSDTAKAFLIILFTDIFVGFH  214

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + EV++ H G    +  I IF+   PVV+D   K W+F+YL KISP     + 
Sbjct  215  SPHGWEVVIEVMLRHLGLPESRDFIFIFISTFPVVLDTIFKYWIFRYLNKISPSAVATYH  274

Query  384  EMKR  373
             M  
Sbjct  275  SMNE  278



>ref|WP_045873730.1| proton extrusion protein PcxA, partial [Tolypothrix sp. PCC 7601]
 gb|EKE97927.1| CemA protein [Tolypothrix sp. PCC 7601]
Length=271

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            ++++     N+++D +  I+L IL+   + ++S++      +  ++SD+ KA LIIL TD
Sbjct  142  KIKSINAVTNVFTDILTAITLIILILTGKQQLSIIMSFAGDITYSLSDSAKAFLIILSTD  201

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GWQ + E   +HYG   +++  ++F+  VPV++D   K W+F+YL +  P 
Sbjct  202  IFVGFHSPYGWQIIIESTFQHYGLPENKSLTSLFIATVPVIMDTVFKYWIFRYLNRSYPS  261

Query  402  VSNIFREM  379
                +R M
Sbjct  262  AVATYRNM  269



>ref|WP_033334671.1| proton extrusion protein PcxA, partial [Scytonema hofmanni]
Length=260

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D +   +  IL+   + ++S+LK        ++SD+ KA LIIL TDIF+GYHS  
Sbjct  140  NIFADVLTAFAFIILILTAKQQLSILKSFVSDTTYSLSDSAKAFLIILFTDIFVGYHSPY  199

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + + I+ H+G   +++ I++F+  VPV++D  VK W+F+YL + SP     +R M
Sbjct  200  GWEIIFKNILIHFGLPENKSFISLFIATVPVIMDTIVKYWIFRYLNRSSPSAVATYRNM  258



>ref|WP_017318455.1| hypothetical protein [Mastigocladopsis repens]
Length=422

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +N+++D V   +  ++L F +  +++LK     ++  +SD+ KA  IIL TDIF
Sbjct  295  KSHSAVSNVFADIVALFAFALVLLFRRQDIAVLKSFIDNIVYGLSDSAKAFAIILTTDIF  354

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H G   +++AI++F+  VPVV D  VK W+F+ L ++SP   
Sbjct  355  VGFHSPHGWEVLLESLAAHLGVAANRSAISLFIATVPVVADTMVKYWIFRSLSRMSPSTM  414

Query  396  NIFREM  379
               +EM
Sbjct  415  ATLKEM  420



>ref|WP_006529876.1| CemA family [Gloeocapsa sp. PCC 73106]
 gb|ELR97299.1| CemA family [Gloeocapsa sp. PCC 73106]
Length=401

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            ANI++D +  +S  I+L F+Q +++++K     +   +SD+ KA LIIL+TDIF+G+HS 
Sbjct  280  ANIFADILSLVSFTIVLVFSQKEIAIVKSFINDIAYGLSDSAKAFLIILVTDIFVGFHSP  339

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E I  H+G   ++    +F+   PV++D  +K W+F+YL +ISP     +R M
Sbjct  340  HGWEVILEGIGRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYRNM  399



>ref|WP_017745965.1| hypothetical protein [Scytonema hofmanni]
Length=425

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  ++  ++L F +  +++LK     ++  +SD+ KA  IIL TDIF+G+H
Sbjct  302  AISNVFADIMALVAFALVLLFRRQDIAVLKSFIDNIVYGLSDSAKAFAIILTTDIFVGFH  361

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E +  H G   +++AI++F+  VPV++D  VK WLF+ L ++SP      +
Sbjct  362  SPHGWEVLLEGLAGHLGVAANRSAISLFIATVPVIVDTMVKYWLFRSLSRMSPSTLATVK  421

Query  384  EM  379
            EM
Sbjct  422  EM  423



>ref|WP_026730944.1| proton extrusion protein PcxA [Fischerella sp. PCC 9605]
Length=434

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 78/126 (62%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +N+++D V  ++  ++L F +  +++LK     +++ +SD+ K+  IIL TDIF
Sbjct  307  KSSSALSNVFADIVALVAFALVLLFRRQDIAVLKSFIDNIVSGLSDSAKSFAIILTTDIF  366

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H G   +++AI++F+  VPV+ D  VK W+F+ L ++SP   
Sbjct  367  VGFHSPHGWEVLLESLSAHLGIAPNKSAISLFIATVPVIADTMVKYWIFRSLSRMSPSTV  426

Query  396  NIFREM  379
               +EM
Sbjct  427  ATLKEM  432



>ref|YP_007627444.1| chloroplast envelope membrane protein [Chondrus crispus]
 emb|CCP38191.1| chloroplast envelope membrane protein [Chondrus crispus]
Length=278

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI +D + G     +L  ++ + S+LK    +LI  +SDT KA LIIL TD+F+G+HS  
Sbjct  158  NILADFLSGTIFISILIISRRQFSILKSFINELIYGLSDTAKAFLIILFTDMFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E+I+ H+G    +  I +F+   PVV+D   K W+F+YL KISP     +  M
Sbjct  218  GWEVIIEIILRHFGLPESRDFIFVFISTFPVVLDTIFKYWIFRYLNKISPSAVATYHNM  276



>ref|YP_008965641.1| heme binding protein cemA (chloroplast) [Porphyridium purpureum]
 dbj|BAO23617.1| heme binding protein cemA (chloroplast) [Porphyridium purpureum]
Length=278

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D   G+ L  L+ + +  +S+LK    +LI  +SDT KA LIIL TD+F+G+HS  
Sbjct  158  NIFADLTSGLVLITLILWKKRYISILKSFINELIYGLSDTAKAFLIILFTDMFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E ++ H+G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  218  GWEVIIESMLRHFGLAESRDFIFVFISTFPVILDTVFKYWIFRYLNRVSPSAVATYHNM  276



>ref|WP_039750803.1| proton extrusion protein PcxA, partial [Chlorogloeopsis fritschii]
Length=276

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 75/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +NI++D +  I+  +++  N+  + ++K    ++I  +SD+ KA LIIL TDIF+G+H
Sbjct  153  AISNIFADILSLIAFALVVVTNKESIEVVKSFIDEIIYGLSDSAKAFLIILFTDIFVGFH  212

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E + EH G   ++ AI +F+   PV++D   K W+F+YL ++SP      +
Sbjct  213  SPHGWEIILEGLAEHLGLPANREAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLK  272

Query  384  EM  379
            EM
Sbjct  273  EM  274



>ref|WP_042341833.1| proton extrusion protein PcxA [Calothrix sp. PCC 7507]
Length=424

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +NI++D +  I+  I+++ ++ ++ ++K     ++  +SD+ KA LIIL TD+F+G+H
Sbjct  301  AISNIFADIISLITFGIIIFMSKREIVIVKSFIDNVVYGLSDSAKAFLIILFTDVFVGFH  360

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E + EH G   +++ I +F+   PV++D  VK W+F+YL ++SP      +
Sbjct  361  SPHGWEILLEGLGEHLGLSANRSVIFLFIATFPVILDTIVKYWIFRYLSRLSPSALATLK  420

Query  384  EM  379
            EM
Sbjct  421  EM  422



>ref|WP_039726610.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF14794.1| hypothetical protein QP59_29755 [Aphanocapsa montana BDHKU210001]
 gb|KIF39717.1| hypothetical protein QQ91_22680 [Lyngbya confervoides BDU141951]
Length=434

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 72/122 (59%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
            G  N+ +D +  +S+ +LL   + +V+L++    +   ++ D  K  L IL+TDIF+G+H
Sbjct  311  GLKNLLADLMAFLSVVVLLLIGRRQVALIRTVANRTFLSLRDPVKVFLFILVTDIFVGFH  370

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ +     +H+G   +Q  I  F+  VPV+IDAC+K W+F +L + SP  S I+ 
Sbjct  371  SAEGWEVILVATFQHFGVPENQFFINGFIATVPVIIDACIKFWIFNFLTRYSPATSAIYE  430

Query  384  EM  379
             M
Sbjct  431  RM  432



>ref|WP_038297037.1| proton extrusion protein PcxA, partial [[Scytonema hofmanni] 
UTEX B 1581]
Length=286

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D +  I+  +++  ++ ++ ++K    +++  +SD+ KA LIIL TDIF+G+HS 
Sbjct  165  SNVFADLISLIAFGVVIATSKREIVMIKSFMDEIVYGLSDSAKAFLIILFTDIFVGFHSP  224

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E + EH G   +++AI +F+   PV++D   K W+F+YL ++SP      +EM
Sbjct  225  HGWEVVLEGLSEHLGLAANRSAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLKEM  284



>ref|WP_035174649.1| proton extrusion protein PcxA, partial [Calothrix sp. PCC 7103]
Length=298

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNV----SDTGKALLIILITDIF  577
              ANI++D +   +  IL+   + ++  +K    +LI+N+    SD+GKA +IIL+TDIF
Sbjct  175  AIANIFADMISLATFTILIIIGKQQLGAVK----ELIDNIFYGISDSGKAFIIILLTDIF  230

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +GYHS  GW+ + E  ++H+G    ++ I++F+  VPVV+D+  K W+F+YL + SP   
Sbjct  231  VGYHSPFGWEIILENTLKHFGLPEQKSLISLFIATVPVVMDSIFKYWIFRYLNRSSPSAV  290

Query  396  NIFREM  379
              +  M
Sbjct  291  ATYHSM  296



>ref|NP_053842.1| envelope membrane protein [Porphyra purpurea]
 sp|P51232.1|CEMA_PORPU RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Porphyra purpurea]
 gb|AAC08118.1| hypothetical chloroplast ORF 10 (chloroplast) [Porphyra purpurea]
Length=278

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFN-QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI SD +  I++FILL    Q ++S++K    ++I  +SDT KA LIIL TD+F+G+HS 
Sbjct  158  NILSD-ILSIAVFILLMITGQRQISIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSP  216

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  217  HGWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNM  276



>ref|WP_038315800.1| proton extrusion protein PcxA, partial [cyanobacterium PCC 7702]
Length=303

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 75/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D    I+L +++  N+  + ++K    +++  +SD+ KA LIIL TD+F+G+H
Sbjct  180  AISNVFADMFSLIALALVVVTNKKAMEIVKSFLDEIVYGLSDSAKAFLIILFTDMFVGFH  239

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E + EH G   ++ AI +F+   PV++D   K W+F+YL ++SP      +
Sbjct  240  SPHGWEVILEGLAEHLGLPANREAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLK  299

Query  384  EM  379
            EM
Sbjct  300  EM  301



>gb|AFY31583.1| envelope membrane protein [Calothrix sp. PCC 7507]
Length=470

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +NI++D +  I+  I+++ ++ ++ ++K     ++  +SD+ KA LIIL TD+F+G+HS 
Sbjct  349  SNIFADIISLITFGIIIFMSKREIVIVKSFIDNVVYGLSDSAKAFLIILFTDVFVGFHSP  408

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ L E + EH G   +++ I +F+   PV++D  VK W+F+YL ++SP      +EM
Sbjct  409  HGWEILLEGLGEHLGLSANRSVIFLFIATFPVILDTIVKYWIFRYLSRLSPSALATLKEM  468



>ref|WP_011056595.1| proton extrusion protein PcxA [Thermosynechococcus elongatus]
 ref|NP_681537.1| proton extrusion protein PcxA [Thermosynechococcus elongatus 
BP-1]
 sp|P59112.1|PCXA_THEEB RecName: Full=Proton extrusion protein PcxA [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08299.1| proton transport protein [Thermosynechococcus elongatus BP-1]
Length=461

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFN-QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI SDA+ G ++F+ L F  Q +++++K    +++  +SD+ KA +IIL TD+F+G+HS 
Sbjct  341  NILSDAL-GFTVFLALVFTGQRQLAIVKTFLDEVVYGLSDSAKAFMIILFTDVFVGFHSP  399

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ L    +EH+GF  ++  I +F+   PV++D   K W+F+YL +ISP     ++ M
Sbjct  400  HGWEVLVNNTLEHFGFPRNEDFINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYKNM  459



>gb|EKF06235.1| proton extrusion protein PcxA [Tolypothrix sp. PCC 7601]
Length=431

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  ++  I++  ++ +++++K     ++  +SD+ KA LIIL TDIF+G+H
Sbjct  308  AISNVFADLISLVAFAIVVATSKREIAIVKSFIDDIVYGLSDSAKAFLIILFTDIFVGFH  367

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E   EH G   +++AI +F+   PV++D   K W+F+YL ++SP      +
Sbjct  368  SPHGWEVLLEGFAEHLGLPANESAIYLFIATFPVILDTIFKYWIFRYLSRLSPSALATMK  427

Query  384  EM  379
            EM
Sbjct  428  EM  429



>ref|NP_849136.1| envelope membrane protein [Cyanidioschyzon merolae strain 10D]
 sp|Q85FP7.1|CEMA_CYAME RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Cyanidioschyzon merolae]
 dbj|BAC76298.1| chloroplast envelope protein (chloroplast) [Cyanidioschyzon merolae 
strain 10D]
Length=276

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+ +D+    S   L+ F + ++S+ +    + I  +SDT KA  IIL TD+F+G+HS  
Sbjct  156  NVLADSASVASFLALMRFGKRQLSVFQSFVNEFIYGLSDTAKAFFIILFTDMFIGFHSPH  215

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ L E ++ H+G   ++  I +F+   PV +D   K W+F+YL ++SP     +  M
Sbjct  216  GWEVLMEAVLRHFGLPENRDFIFLFIATFPVALDTVFKYWIFRYLNRVSPSAVATYHNM  274



>ref|WP_036047283.1| hypothetical protein, partial [Leptolyngbya boryana]
Length=249

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 75/131 (57%), Gaps = 2/131 (2%)
 Frame = -1

Query  765  AEVR--NWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIIL  592
            A VR  N +  +NI +D +  I   + +   Q +  LLK     L + +SD+ KA LIIL
Sbjct  117  ASVRQENVQVLSNIVADLLSAIVFIVFVLKTQPQFKLLKQFLSDLADGLSDSAKAFLIIL  176

Query  591  ITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKI  412
            +TD+F+G+HS  GW+ L + + +HYG   ++A   +F+   PV++DA  K W+F+YL + 
Sbjct  177  VTDVFVGFHSSYGWEILLKTVFDHYGLAENRAFTGLFIATFPVILDAIGKYWIFRYLNRN  236

Query  411  SPKVSNIFREM  379
            SP     +  M
Sbjct  237  SPSAVATYHRM  247



>ref|WP_045868774.1| proton extrusion protein PcxA [Tolypothrix sp. PCC 7601]
Length=428

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  ++  I++  ++ +++++K     ++  +SD+ KA LIIL TDIF+G+H
Sbjct  305  AISNVFADLISLVAFAIVVATSKREIAIVKSFIDDIVYGLSDSAKAFLIILFTDIFVGFH  364

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E   EH G   +++AI +F+   PV++D   K W+F+YL ++SP      +
Sbjct  365  SPHGWEVLLEGFAEHLGLPANESAIYLFIATFPVILDTIFKYWIFRYLSRLSPSALATMK  424

Query  384  EM  379
            EM
Sbjct  425  EM  426



>ref|WP_010475585.1| proton extrusion protein PcxA [Acaryochloris sp. CCMEE 5410]
Length=482

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N  SD    ++L I    N+ K+++LK    ++I  +SD+ KA +IIL TD+F+G+HS  
Sbjct  362  NAISDLFSLVALAIYFVLNRQKIAVLKSFFDEIIYGLSDSAKAFIIILFTDVFVGFHSPH  421

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E ++ H+G   D+  I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  422  GWEVIVESVLSHFGLPQDRNFINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYRNM  480



>ref|WP_012164771.1| proton extrusion protein PcxA [Acaryochloris marina]
 sp|B0CG09.1|PCXA_ACAM1 RecName: Full=Proton extrusion protein PcxA [Acaryochloris marina 
MBIC11017]
 gb|ABW29456.1| CemA family protein, putative [Acaryochloris marina MBIC11017]
Length=482

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N  SD    ++L I    N+ K+++LK    ++I  +SD+ KA +IIL TD+F+G+HS  
Sbjct  362  NAISDLFSLVALAIYFVLNRQKIAVLKSFFDEIIYGLSDSAKAFIIILFTDVFVGFHSPH  421

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E ++ H+G   D+  I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  422  GWEVIVESVLSHFGLPQDRNFINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYRNM  480



>ref|WP_037219102.1| proton extrusion protein PcxA, partial [Richelia intracellularis]
Length=265

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            ANI++D V  I+  +++  ++ ++++ K     ++  +SD+ KA LIIL TD+F+G+HS 
Sbjct  144  ANIYADIVSLITFAVVIIKSKREIAIAKCFLDDIVYGLSDSAKAFLIILFTDVFVGFHSP  203

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + + I EH G   ++  I IF+   PV++D   K W+F+YL ++SP     F+EM
Sbjct  204  HGWEVIVKNISEHLGIVFEKNIIGIFIATFPVILDTIFKYWVFRYLSRLSPSALATFKEM  263



>ref|WP_042155139.1| hypothetical protein [Planktothrix agardhii]
 gb|KEI67891.1| hypothetical protein A19Y_3060 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=434

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+    +NI++D V  I+  +++ FN+  ++ LK     ++ ++SD+ KA +IIL+TDIF
Sbjct  307  RSSEAISNIFADFVGLIAFALVIAFNRQGLAALKSLLDTVMYDLSDSAKAFIIILLTDIF  366

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E    H G   +++ I +F+   PV++D  +K W+F+YL +ISP   
Sbjct  367  VGFHSPHGWEVLLEGFSNHLGIAPNRSFIFLFIATFPVILDTIMKYWIFRYLSRISPSAV  426

Query  396  NIFREM  379
               R M
Sbjct  427  ATLRNM  432



>ref|WP_016949880.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=420

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D V  ++  I++  ++  +  LK+   ++I  +SD+ KA LIIL TDIF+G+HS 
Sbjct  299  SNVFADLVSLVAFAIVIVLSKKDIVFLKYLIDEIIYGLSDSAKAFLIILFTDIFVGFHSP  358

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ L E + EH G    ++ I +F+   PV+++   K W+F+YL ++SP      +EM
Sbjct  359  HGWEILLEGLAEHLGLPASRSGIFLFIATFPVILNTIFKYWIFRYLSRLSPSALATLKEM  418



>gb|AFC39902.1| envelope membrane protein [Porphyra umbilicalis]
Length=278

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFN-QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            N+ SD +  I++FILL    Q ++S++K    ++I  +SDT KA LIIL TD+F+G+HS 
Sbjct  158  NLLSD-ILSIAVFILLMITGQRQISIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSP  216

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  217  HGWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNM  276



>ref|WP_035122039.1| proton extrusion protein PcxA, partial [Fischerella sp. PCC 9431]
Length=292

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            E RN    +N+++D V  ++   ++  ++ ++ ++K    ++I  +SD+ KA LIIL TD
Sbjct  165  ESRN--AISNVFADLVSLVAFAFVIVTSKREIVIVKSFMDEIIYGLSDSAKAFLIILSTD  222

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GW+ + E I EH G   ++  I +F+   PV++D   K W+F+YL ++SP 
Sbjct  223  IFVGFHSPHGWEVILEGIAEHLGLPANRDPIFLFIATFPVILDTIFKYWIFRYLSRLSPS  282

Query  402  VSNIFREM  379
                 +EM
Sbjct  283  ALATLKEM  290



>ref|YP_063662.1| envelope membrane protein [Gracilaria tenuistipitata var. liui]
 sp|Q6B8P8.1|CEMA_GRATL RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Gracilaria tenuistipitata var. liui]
 gb|AAT79737.1| heme binding protein cemA [Gracilaria tenuistipitata var. liui]
Length=278

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGY  568
               NI +D +  I++FI +L  ++ + S+LK    +LI ++SDT KA LIIL TD+F+G+
Sbjct  155  AITNILAD-LLSIAIFISILISSKRQFSILKSFLNELIYSLSDTAKAFLIILFTDMFVGF  213

Query  567  HSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIF  388
            HS  GW+ + E+I+ H G    +  I +F+   PV++D   K W+F+YL KISP     +
Sbjct  214  HSPHGWEVIIEIILRHLGLPESRDFIFVFISTFPVILDTIFKYWIFRYLNKISPSAVATY  273

Query  387  REM  379
              M
Sbjct  274  HNM  276



>ref|WP_040957298.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=434

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+    +NI++D V  I+  +++ FN+  ++ LK     ++ ++SD+ KA +IIL+TDIF
Sbjct  307  RSSEAISNIFADFVGLIAFALVIIFNRQGLASLKSLLDTVMYDLSDSAKAFIIILLTDIF  366

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E    H G   +++ I +F+   PV++D  +K W+F+YL +ISP   
Sbjct  367  VGFHSPHGWEVLLEGFSNHLGIAPNRSFIFLFIATFPVILDTIMKYWIFRYLSRISPSAV  426

Query  396  NIFREM  379
               R M
Sbjct  427  ATLRNM  432



>emb|CDN12677.1| Membrane protein PxcA, involved in light-induced proton extrusion 
[Richelia intracellularis]
Length=288

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            ANI++D V  I+  +++  ++ ++++ K     ++  +SD+ KA LIIL TD+F+G+HS 
Sbjct  167  ANIYADIVSLITFAVVIIKSKREIAIAKCFLDDIVYGLSDSAKAFLIILFTDVFVGFHSP  226

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + + I EH G   ++  I IF+   PV++D   K W+F+YL ++SP     F+EM
Sbjct  227  HGWEVIVKNISEHLGIVFEKNIIGIFIATFPVILDTIFKYWVFRYLSRLSPSALATFKEM  286



>ref|WP_043938938.1| hypothetical protein [Planktothrix prolifica]
Length=434

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+    +NI++D V  I+  +++ FN+  ++ LK     ++ ++SD+ KA +IIL+TDIF
Sbjct  307  RSSEAISNIFADFVGLIAFALVIIFNRQGLASLKSLLDTVMYDLSDSAKAFIIILLTDIF  366

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E    H G   +++ I +F+   PV++D  +K W+F+YL +ISP   
Sbjct  367  VGFHSPHGWEVLLEGFSNHLGIAPNRSFIFLFIATFPVILDTIMKYWIFRYLSRISPSAV  426

Query  396  NIFREM  379
               R M
Sbjct  427  ATLRNM  432



>ref|WP_039751973.1| proton extrusion protein PcxA, partial [Chlorogloeopsis fritschii]
Length=271

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 73/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D +   +  +L+   + ++S+++     +  ++SD+ KA LIIL TDIF+G+HS  
Sbjct  151  NIFADILTAATFIVLILTGKQQLSIIRSFAGDITYSLSDSAKAFLIILSTDIFVGFHSPY  210

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ +    + HYG   +++ I++F+  VPV++D   K W+F+YL + SP     +R M
Sbjct  211  GWEIILGSTLNHYGLPENKSLISLFIATVPVIMDTIFKYWIFRYLNRSSPSAVATYRNM  269



>ref|WP_036831257.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=434

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+    +NI++D V  I+  +++ FN+  ++ LK     ++ ++SD+ KA +IIL+TDIF
Sbjct  307  RSSEAISNIFADFVGLIAFALVIIFNRQGLASLKSLLDTVMYDLSDSAKAFIIILLTDIF  366

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E    H G   +++ I +F+   PV++D  +K W+F+YL +ISP   
Sbjct  367  VGFHSPHGWEVLLEGFSNHLGIAPNRSFIFLFIATFPVILDTIMKYWIFRYLSRISPSAV  426

Query  396  NIFREM  379
               R M
Sbjct  427  ATLRNM  432



>ref|WP_041034094.1| proton extrusion protein PcxA [Tolypothrix campylonemoides]
 gb|KIJ77963.1| proton extrusion protein PcxA [Tolypothrix campylonemoides VB511288]
Length=431

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D +  I+  +++  ++ +++++K     LI  +SD+ KA +IIL TDIF+G+HS 
Sbjct  310  SNVFADVMSLIAFALVIVTSKREIAIVKSFIDDLIYGLSDSAKAFIIILFTDIFVGFHSP  369

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E   EH G    Q+ I++F+   PV++D   K W+F+YL ++SP      +EM
Sbjct  370  HGWEVILEGFAEHLGLPAKQSVISLFIATFPVILDTISKYWIFRYLSRLSPSALATLKEM  429



>ref|WP_019503502.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=424

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            +N    +N+++D V   +  ++L   +  +  LK     +I  +SD+ KA  IIL TD+F
Sbjct  297  KNINSISNVFADFVGLFAFALVLLIRRRDIETLKSFVDNIIYGLSDSAKAFAIILFTDMF  356

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H G   + +AI++F+  VPVV+D  VK W+F+YL ++S    
Sbjct  357  VGFHSPHGWEVLLESMANHLGVAANHSAISLFIATVPVVMDTIVKYWIFRYLSQMSASTV  416

Query  396  NIFREM  379
               +EM
Sbjct  417  ATLKEM  422



>ref|WP_019503735.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=424

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            +N    +N+++D V   +  ++L   +  +  LK     +I  +SD+ KA  IIL TD+F
Sbjct  297  KNINSISNVFADFVGLFAFALVLLIRRRDIETLKSFVDNIIYGLSDSAKAFAIILFTDMF  356

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H G   + +AI++F+  VPVV+D  VK W+F+YL ++S    
Sbjct  357  VGFHSPHGWEVLLESMANHLGVAANHSAISLFIATVPVVMDTIVKYWIFRYLSQMSASTV  416

Query  396  NIFREM  379
               +EM
Sbjct  417  ATLKEM  422



>ref|YP_001293538.1| chloroplast envelope membrane protein [Rhodomonas salina]
 sp|A6MVV9.1|CEMA_RHDSA RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Rhodomonas salina]
 gb|ABO70824.1| chloroplast envelope membrane protein [Rhodomonas salina]
Length=278

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
               N+ +D +  ++   L+   + ++S+LK    +LI  +SDT KA LIIL TDIF+G+H
Sbjct  155  AMKNLLADVLAFVTFVYLIVTGRRQISVLKSFVNELIYGLSDTAKAFLIILFTDIFVGFH  214

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E  + H+G   ++  I +F+   PVV+D   K W+F+YL ++SP     ++
Sbjct  215  STHGWEVVLENGLRHFGLPENRDLIFLFIATFPVVLDTVFKYWIFRYLNQVSPSAVATYK  274

Query  384  EM  379
            +M
Sbjct  275  DM  276



>ref|WP_041555928.1| proton extrusion protein PcxA, partial [Nostoc sp. PCC 7524]
Length=391

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D    I+  +++ +++ +++++K     ++  +SD+ KA LIIL TDIF+G+H
Sbjct  268  AISNLFADVTSLIAFALVITYSKREIAVVKDFMDHMVYGLSDSAKAFLIILFTDIFVGFH  327

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E + +H+G    + AI +F+   PV+++   K W+F+YL ++SP      +
Sbjct  328  SPHGWEILLEGLADHFGMPASRNAIFLFIATFPVILNTIFKYWIFRYLSRLSPSALATLK  387

Query  384  EM  379
            EM
Sbjct  388  EM  389



>gb|AFY50542.1| CemA family [Nostoc sp. PCC 7524]
Length=392

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D    I+  +++ +++ +++++K     ++  +SD+ KA LIIL TDIF+G+H
Sbjct  269  AISNLFADVTSLIAFALVITYSKREIAVVKDFMDHMVYGLSDSAKAFLIILFTDIFVGFH  328

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E + +H+G    + AI +F+   PV+++   K W+F+YL ++SP      +
Sbjct  329  SPHGWEILLEGLADHFGMPASRNAIFLFIATFPVILNTIFKYWIFRYLSRLSPSALATLK  388

Query  384  EM  379
            EM
Sbjct  389  EM  390



>ref|WP_040689487.1| hypothetical protein, partial [Pseudanabaena biceps]
Length=169

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 69/124 (56%), Gaps = 0/124 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
            G  N+ SD       ++ L   + +++ +K    +++ +++D  KA LII+ TD F+G+H
Sbjct  46   GIKNLLSDITAAFVFYLFLLSGRKELATIKEFLDEILYSLNDNAKAFLIIISTDTFVGFH  105

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW  L  V+ EH+G   ++     F+  VPV +D   K W+F+YL + SP  + I+R
Sbjct  106  SSEGWDALLTVLFEHFGLPENKILAQSFISTVPVFLDGLFKFWIFQYLTQASPATATIYR  165

Query  384  EMKR  373
            EM  
Sbjct  166  EMNE  169



>ref|WP_019490538.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=441

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 75/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +NI++D    ++  +++  ++ ++ +LK     ++  +SD+ KA LIIL TDIF+G+H
Sbjct  318  AISNIFADMFSLVAFAVVVATSKREIVILKAFIDDVVYGLSDSAKAFLIILFTDIFVGFH  377

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E + EH G   +++AI +F+   PVV+D   K W+F+YL ++SP      +
Sbjct  378  SPHGWEILLEGMAEHLGLPPNRSAIFLFIATFPVVLDTIFKYWIFRYLSRLSPSALATLK  437

Query  384  EM  379
            EM
Sbjct  438  EM  439



>ref|WP_040938739.1| hypothetical protein [Prochloron didemni]
Length=444

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = -1

Query  738  ANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
            ANI++D VF +  F  +++F +  + +LK     +I  +SD+ KA LIIL TDIF+GYHS
Sbjct  323  ANIFAD-VFSLMAFAGVIWFRKKDIVVLKSFMDDIIYGLSDSAKAFLIILFTDIFVGYHS  381

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW+ + E +  H+G    +  I IF+   PV++D  +K W+F+YL +ISP     +R 
Sbjct  382  PHGWEIILEGLSRHWGIAESREYIFIFIATFPVILDTMLKYWIFRYLNRISPSAVATYRN  441

Query  381  M  379
            M
Sbjct  442  M  442



>ref|WP_035082874.1| proton extrusion protein PcxA, partial [Aphanizomenon flos-aquae]
Length=263

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +NI++D +  I+  +++ F+   +  L+    +++  +SD+ KA LIIL TD+F
Sbjct  136  KSTNAISNIFADIIALIAFALVIVFSTKDIISLQHFIDQVVYGLSDSAKAFLIILSTDVF  195

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E   EH G   ++  I +F+   PV++D  VK W+F+YL ++SP   
Sbjct  196  VGFHSPHGWEVILEGFTEHLGLPANRNYIFMFIATFPVILDTIVKYWIFRYLSRLSPSAL  255

Query  396  NIFREM  379
               +EM
Sbjct  256  ATLKEM  261



>ref|WP_024125675.1| light-induced Na+-dependent proton extrusion protein PcxA [Thermosynechococcus 
sp. NK55a]
 gb|AHB89297.1| light-induced Na+-dependent proton extrusion protein PcxA [Thermosynechococcus 
sp. NK55a]
Length=461

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFN-QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI SDA+ G ++F+ L F  Q +++++K    +++  +SD+ KA +IIL TD+F+G+HS 
Sbjct  341  NILSDAL-GFAVFLGLVFTGQRQLAIVKAFLDEVVYGLSDSAKAFVIILFTDVFVGFHSP  399

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ L    +EH+GF  ++  I +F+   PV++D   K W+F+YL +ISP     ++ M
Sbjct  400  HGWEVLVNNTLEHFGFPRNEDFINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYKNM  459



>ref|YP_007947761.1| envelope membrane protein (chloroplast) [Pyropia haitanensis]
 gb|AGG37010.1| envelope membrane protein (chloroplast) [Pyropia haitanensis]
Length=278

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFN-QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI SD V  I +FILL    Q +++++K    ++I  +SDT KA LIIL TD+F+G+HS 
Sbjct  158  NILSDIV-SIFVFILLMITGQRQIAIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSP  216

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  217  HGWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTVFKYWIFRYLNQVSPSAVATYHNM  276



>gb|AIA21261.1| chloroplast envelope membrane protein [Pyropia kanakaensis]
Length=278

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI SD V  +   +L+   Q +++++K    ++I  +SDT KA LIIL TD+F+G+HS  
Sbjct  158  NILSDIVSILVFILLMITGQRQIAIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  218  GWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNM  276



>gb|AIA61270.1| envelope membrane protein (chloroplast) (chloroplast) [Cyanidiaceae 
sp. MX-AZ01]
Length=276

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+ +D+    S   L+   + ++S+ +    + I  +SDT KA LIIL TD+F+G+HS  
Sbjct  156  NVLADSASVASFLALIRLGKRQLSVFQSFINEFIYGLSDTAKAFLIILFTDMFIGFHSPH  215

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ L E ++ H+G   ++  I +F+   PV +D   K W+F+YL ++SP     +  M
Sbjct  216  GWEVLMEALLRHFGLPENRDFIFLFIATFPVALDTVFKYWIFRYLNRVSPSAVATYHNM  274



>ref|WP_008319295.1| CemA family [Leptolyngbya sp. PCC 6406]
Length=456

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+     N++SD +  I+   LL   + +V+ LK    +++  +SD+ KA +IIL TD+F
Sbjct  329  RSADAVKNVFSDILAAIAFAGLLVARKREVAALKGFMDEVVYGLSDSAKAFIIILFTDVF  388

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H GF  ++  I +F+   PV++D   K W+F+YL +ISP   
Sbjct  389  VGFHSPHGWEILLEGLSRHLGFAANRDFIFLFIATFPVILDTVFKYWIFRYLNRISPSAV  448

Query  396  NIFREM  379
              ++ M
Sbjct  449  ATYKNM  454



>ref|WP_006515180.1| CemA family protein [Leptolyngbya sp. PCC 7375]
 gb|EKV00775.1| CemA family protein [Leptolyngbya sp. PCC 7375]
Length=429

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  756  RNWRGFANIWSD--AVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            R+     N+++D  AVF  SL  LL   + +V+ LK    +++  +SD+ KA +IIL TD
Sbjct  302  RSADSVKNVFADIFAVFAFSL--LLSTCKRQVATLKAFIDEIVYGLSDSAKAFIIILFTD  359

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GW+ L E +  H GF  ++  I +F+   PV++D   K W+F+YL +ISP 
Sbjct  360  IFVGFHSPHGWEVLLEGLSRHLGFPANRDFIFLFIATFPVILDTVFKYWIFRYLNRISPS  419

Query  402  VSNIFREM  379
                ++ M
Sbjct  420  AVATYKNM  427



>ref|NP_050853.1| envelope membrane protein (chloroplast) [Nephroselmis olivacea]
 sp|Q9TKZ2.1|CEMA_NEPOL RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Nephroselmis olivacea]
 gb|AAD54824.1|AF137379_47 chloroplast envelope membrane protein (chloroplast) [Nephroselmis 
olivacea]
Length=392

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              AN+ SD +  + L  +L   + K+++LK    +LI +++D  KA  +IL+TD+F+G+H
Sbjct  269  SLANLGSDILACLILLAMLSLEKTKIAVLKSFLDELIYSLNDATKAFFLILVTDVFVGFH  328

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E++  H+GF   +  I +FV   PV++D   K W+F+YL  ISP    ++ 
Sbjct  329  STHGWEVILELLFAHFGFPESKKFIFMFVATFPVLLDTVFKYWIFRYLNHISPSTVAVYH  388

Query  384  EM  379
             M
Sbjct  389  NM  390



>ref|WP_036003193.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=426

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 2/130 (2%)
 Frame = -1

Query  762  EVRNW--RGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILI  589
            E RN    G  N+ +D V  +    L+YFN+N++  L+    +    +SD  K  + IL+
Sbjct  295  ESRNQALNGLKNVIADFVALVVFGGLVYFNRNQLLTLRSVTNRTFLGLSDPIKVFMFILV  354

Query  588  TDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKIS  409
            TD+F+G+HS  GW+ + E    H+G    +  I  F+  VPV+IDA +K W+F YL + S
Sbjct  355  TDLFVGFHSAEGWEVILEGAARHFGLPESKFLINGFIATVPVMIDAVIKFWIFSYLTRYS  414

Query  408  PKVSNIFREM  379
            P  S I+  M
Sbjct  415  PSASAIYERM  424



>ref|YP_536913.1| envelope membrane protein [Pyropia yezoensis]
 sp|Q1XDQ5.1|CEMA_PYRYE RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92356.1| unnamed protein product [Pyropia yezoensis]
 gb|AGH27557.1| envelope membrane protein (chloroplast) [Pyropia yezoensis]
 gb|AIA21467.1| chloroplast envelope membrane protein [Pyropia fucicola]
Length=278

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI SD V  +   +L+   Q +++++K    ++I  +SDT KA LIIL TD+F+G+HS  
Sbjct  158  NILSDLVSILVFILLMITGQRQIAVVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  218  GWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNM  276



>ref|WP_015213960.1| envelope membrane protein [Anabaena cylindrica]
 gb|AFZ57312.1| envelope membrane protein [Anabaena cylindrica PCC 7122]
Length=420

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 74/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  IS  I++ FN+  +   +    +++  +SD+ KA LIIL+TD+F+G+H
Sbjct  297  AISNVFADLISLISFAIVVAFNKKNIIFFQSFIDEIVYGLSDSAKAFLIILLTDMFVGFH  356

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E I +H G    ++ I +F+   PV+++   K W+F+YL ++SP      +
Sbjct  357  SPHGWEILLEGIAKHLGLSATRSGIFLFIATFPVILNTIFKYWIFRYLSRLSPSALATLK  416

Query  384  EM  379
            EM
Sbjct  417  EM  418



>ref|YP_009027516.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AGQ17063.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AHB35010.1| chloroplast envelope membrane protein (chloroplast) [Pyropia 
perforata]
 gb|AHB35219.1| chloroplast envelope membrane protein (chloroplast) [Pyropia 
perforata]
 gb|AIA19381.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA19590.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA19799.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA20008.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA20217.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA20426.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA20635.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA20844.1| chloroplast envelope membrane protein [Pyropia perforata]
 gb|AIA21053.1| chloroplast envelope membrane protein [Pyropia perforata]
Length=278

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI SD V  +   +L+   Q +++++K    ++I  +SDT KA LIIL TD+F+G+HS  
Sbjct  158  NILSDIVSILIFILLMVTGQRQIAIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + EVI+ H G    +  I +F+   PV++D   K W+F+YL ++SP     +  M
Sbjct  218  GWEVIIEVILRHLGLPESRDFIFLFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNM  276



>ref|WP_039748867.1| proton extrusion protein PcxA [Hassallia byssoidea]
 gb|KIF33115.1| proton extrusion protein PcxA [Hassallia byssoidea VB512170]
Length=436

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  I+  +++  ++ ++ ++K    +++  +SD+ KA LIIL TDIF+G+H
Sbjct  313  AISNVFADLISLIAFGVVIATSKREIVIVKSFMDEIVYGLSDSAKAFLIILFTDIFVGFH  372

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E + EH G   +++AI +F+   PV++D   K W+F+YL ++SP      +
Sbjct  373  SPHGWEVILEGLSEHLGLPANRSAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLK  432

Query  384  EM  379
            EM
Sbjct  433  EM  434



>ref|WP_015120108.1| CemA family [Rivularia sp. PCC 7116]
 gb|AFY56546.1| CemA family [Rivularia sp. PCC 7116]
Length=422

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            +N    +N+++D +  I    ++  ++ +V++L+      +  +SD+ KA LIIL+TD+F
Sbjct  295  KNNSAISNVFADIISLIVFAFIIATSKREVAILQLFIDDTVYGLSDSAKAFLIILLTDMF  354

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E I +H G    +  I +F+   PV++D   K W+F+YL +ISP   
Sbjct  355  VGFHSPHGWEVLLEGIAKHLGITPTRDVIFLFIATFPVILDTICKYWIFRYLSRISPSAL  414

Query  396  NIFREM  379
              F+EM
Sbjct  415  ATFKEM  420



>ref|WP_036533348.1| proton extrusion protein PcxA [Neosynechococcus sphagnicola]
 gb|KGF72591.1| proton extrusion protein PcxA [Neosynechococcus sphagnicola sy1]
Length=440

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 2/130 (2%)
 Frame = -1

Query  762  EVRNWRGFA--NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILI  589
            E R   G A  NI+SD    I+    + FN+  V+ LK    +++  +SD+ KA +IIL 
Sbjct  309  EFRQQGGGAVKNIFSDLASVIAFGAFIVFNKRDVATLKSFIDEIVYGLSDSAKAFIIILF  368

Query  588  TDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKIS  409
            TDIF+G+HS  GW+ + E   +H G   ++  I IF+   PV++D   K W+F+YL ++S
Sbjct  369  TDIFVGFHSTHGWEVILEGAAKHLGLPENRDFIFIFIATFPVILDTVFKYWIFRYLNRVS  428

Query  408  PKVSNIFREM  379
            P      R M
Sbjct  429  PSAVATLRNM  438



>ref|WP_015205923.1| CemA family [Cylindrospermum stagnale]
 gb|AFZ22665.1| CemA family [Cylindrospermum stagnale PCC 7417]
Length=419

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  I+  +++  N+ ++ ++K    +++  +SD+ KA +IIL+TD+F+G+H
Sbjct  296  AISNVFADFISLITFGMIIALNKKEIVIVKSFLDEIVYGLSDSAKAFIIILLTDVFVGFH  355

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L E + EH G    ++AI  F+   PV+++   K W+F+YL ++SP      +
Sbjct  356  SPHGWEILLEGLAEHLGLPASRSAIFTFIATFPVILNTIFKYWIFRYLSRLSPSALATLK  415

Query  384  EM  379
            EM
Sbjct  416  EM  417



>ref|NP_050727.1| envelope membrane protein (chloroplast) [Guillardia theta]
 sp|O78470.1|CEMA_GUITH RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Guillardia theta]
 gb|AAC35661.1| heme binding protein cemA (chloroplast) [Guillardia theta]
Length=278

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+ +D +  I+   L++    ++++LK    +LI  +SDT KA LIIL TDIF+G+HS  
Sbjct  158  NLLADILAFITFAYLIFTGGRQIAVLKSFINELIYGLSDTAKAFLIILFTDIFVGFHSTH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E  + H+G   ++  I +F+   PVV+D   K W+F+YL ++SP     + EM
Sbjct  218  GWEVVLENGLRHFGLPENRDLIFLFIATFPVVLDTVFKYWIFRYLNQVSPSAVATYHEM  276



>ref|WP_030007666.1| proton extrusion protein PcxA [Synechococcus sp. NKBG042902]
Length=428

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++  + NI+SD +F    F+ +L  ++ ++++LK    +++  +SD+ KA LIIL TDIF
Sbjct  302  SYNAYENIFSD-IFSFFAFVGILLISKREIAMLKGFLDEIVYGLSDSAKAFLIILFTDIF  360

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +GYHS  GW+ + E + +H+G    +    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  361  VGYHSPHGWEIILENVAKHFGIAESRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  420

Query  396  NIFREM  379
              +R M
Sbjct  421  ATYRNM  426



>ref|WP_012308386.1| proton extrusion protein PcxA [Synechococcus sp. PCC 7002]
 sp|B1XN58.1|PCXA_SYNP2 RecName: Full=Proton extrusion protein PcxA [Synechococcus sp. 
PCC 7002]
 gb|ACB00768.1| proton extrusion protein [Synechococcus sp. PCC 7002]
Length=429

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = -1

Query  753  NWRGFANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++  + NI+SD +F    F+ +L  ++ ++++LK    +++  +SD+ KA LIIL TDIF
Sbjct  303  SYNAYENIFSD-IFSFFAFVGILLISKREIAMLKGFLDEIVYGLSDSAKAFLIILFTDIF  361

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +GYHS  GW+ + E + +H+G    +    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  362  VGYHSPHGWEIILENVAKHFGIAESRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  421

Query  396  NIFREM  379
              +R M
Sbjct  422  ATYRNM  427



>ref|WP_002780162.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI12762.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9806]
Length=445

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVIAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>gb|AFZ47692.1| CemA family protein [Cyanobacterium stanieri PCC 7202]
Length=429

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = -1

Query  759  VRNWR-----GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLII  595
             +N+R        NI+SD +  I+  I+L  ++ ++ +LK    +LI  +SD+ KA LII
Sbjct  295  AQNYRRQSANAIKNIFSDILAFIAFAIILVSSRQELQILKSFLDELIYGLSDSAKAFLII  354

Query  594  LITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPK  415
            L TDIF+G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +
Sbjct  355  LFTDIFVGFHSPHGWEIVLESVARHFGLAENRDFNFLFIATFPVILDTVLKYWIFRYLNR  414

Query  414  ISPKVSNIFREM  379
            ISP     ++ M
Sbjct  415  ISPSAVATYKNM  426



>ref|WP_040944713.1| hypothetical protein [Prochloron didemni]
Length=444

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = -1

Query  738  ANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
            ANI++D +F +  F  +++F +  + +LK     +I  +SD+ KA LIIL TDIF+GYHS
Sbjct  323  ANIFAD-IFSLMAFAGVIWFRKKDIVVLKSFMDDIIYGLSDSAKAFLIILFTDIFVGYHS  381

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW+ + E +  H+G    +  I IF+   PV++D  +K W+F+YL ++SP     +R 
Sbjct  382  PHGWEIILEGVSRHWGIAESREFIFIFIATFPVILDTVLKYWIFRYLNRVSPSAVATYRS  441

Query  381  M  379
            M
Sbjct  442  M  442



>ref|WP_035139660.1| proton extrusion protein PcxA, partial [Fischerella sp. PCC 9605]
Length=272

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +NI++D +   +  +++  ++ ++ ++K    ++I  +SD+ KA LIIL TDIF+G+HS 
Sbjct  151  SNIFADMLSLFAFALVIVTSKKEIVIVKSFIDEIIYGLSDSAKAFLIILFTDIFVGFHSP  210

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E + EH G      AI +F+   PV++D   K W+F+YL ++SP      +EM
Sbjct  211  HGWEVILEGLAEHLGLPASHNAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLKEM  270



>ref|WP_006278436.1| CemA [Cylindrospermopsis raciborskii]
 gb|EFA68598.1| CemA [Cylindrospermopsis raciborskii CS-505]
Length=423

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
               NI++D +  IS  I++ + +  + +++    K+   +SD+ KA LIILITDIF+G+H
Sbjct  300  AIGNIFADVISLISFAIIIGWRKKDIEVVRSLLDKIAYGLSDSAKAFLIILITDIFVGFH  359

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E + EH G   ++  I +F+   PV+++   K W+F+YL ++SP      +
Sbjct  360  SPHGWEIILESLAEHLGLPANRNVIFLFIATFPVILNTIFKYWIFRYLSRLSPSALATLK  419

Query  384  EM  379
            EM
Sbjct  420  EM  421



>ref|WP_041234828.1| proton extrusion protein PcxA [Cyanobacterium stanieri]
Length=425

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = -1

Query  759  VRNWR-----GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLII  595
             +N+R        NI+SD +  I+  I+L  ++ ++ +LK    +LI  +SD+ KA LII
Sbjct  291  AQNYRRQSANAIKNIFSDILAFIAFAIILVSSRQELQILKSFLDELIYGLSDSAKAFLII  350

Query  594  LITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPK  415
            L TDIF+G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +
Sbjct  351  LFTDIFVGFHSPHGWEIVLESVARHFGLAENRDFNFLFIATFPVILDTVLKYWIFRYLNR  410

Query  414  ISPKVSNIFREM  379
            ISP     ++ M
Sbjct  411  ISPSAVATYKNM  422



>ref|WP_002796459.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI23483.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9809]
Length=445

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVIAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_008203777.1| Proton extrusion protein pcxA [Microcystis sp. T1-4]
 emb|CCI33373.1| Proton extrusion protein pcxA [Microcystis sp. T1-4]
Length=445

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVIAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>gb|AFW97126.1| CemA family membrane protein [Anabaena sp. 90]
Length=278

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +NI++D +  I+  +++ F+   +  L+    +++  +SD+ KA LIIL TD+F
Sbjct  151  KSANAISNIFADIIALITFALVIVFSAKDIISLQHFVDQIVYGLSDSAKAFLIILSTDVF  210

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E   EH G    +  I +F+   PV++D  VK W+F+YL ++SP   
Sbjct  211  VGFHSPHGWEIILEGFAEHLGLPASRNYIFMFIATFPVILDTIVKYWIFRYLSRLSPSAL  270

Query  396  NIFREM  379
               +EM
Sbjct  271  ATLKEM  276



>ref|WP_041458683.1| proton extrusion protein PcxA, partial [Anabaena sp. 90]
Length=263

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +NI++D +  I+  +++ F+   +  L+    +++  +SD+ KA LIIL TD+F
Sbjct  136  KSANAISNIFADIIALITFALVIVFSAKDIISLQHFVDQIVYGLSDSAKAFLIILSTDVF  195

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E   EH G    +  I +F+   PV++D  VK W+F+YL ++SP   
Sbjct  196  VGFHSPHGWEIILEGFAEHLGLPASRNYIFMFIATFPVILDTIVKYWIFRYLSRLSPSAL  255

Query  396  NIFREM  379
               +EM
Sbjct  256  ATLKEM  261



>ref|WP_027845399.1| proton extrusion protein PcxA [Mastigocoleus testarum]
Length=422

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -1

Query  741  FANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
            FA++++  VFGI   + L   ++ + L  F    L+  +SDT KA ++IL TDIF+G+HS
Sbjct  304  FADMFALVVFGI---VALVRRKDFIVLKSFLD-DLVYGLSDTAKAFILILFTDIFVGFHS  359

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW  L E I  H G E +++AI +F+   PV++D   K W+F+YL +ISP      ++
Sbjct  360  PHGWDVLLEGIAGHLGVEPNRSAINLFIATFPVILDTIFKYWVFRYLSRISPSAVATLKD  419

Query  381  M  379
            M
Sbjct  420  M  420



>ref|WP_015219411.1| envelope membrane protein [Cyanobacterium aponinum]
 gb|AFZ53684.1| envelope membrane protein [Cyanobacterium aponinum PCC 10605]
Length=446

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D    I+  I++YF++ ++ +LK    + I  +SD+ KA LIIL TD+F+G+HS  
Sbjct  325  NIFADVFSLIAFGIVIYFSKRELQILKSFIDETIYGLSDSAKAFLIILFTDMFVGFHSPH  384

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E I  H+G   ++    +F+   PV++D  +K W+F+YL +ISP     ++ M
Sbjct  385  GWEVILESISRHFGLPENRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYKNM  443



>ref|WP_045358150.1| proton extrusion protein PcxA [Microcystis aeruginosa]
 dbj|GAL92343.1| membrane protein PxcA [Microcystis aeruginosa NIES-44]
Length=445

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>dbj|BAQ60851.1| membrane protein PxcA [Geminocystis sp. NIES-3708]
Length=440

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 83/137 (61%), Gaps = 6/137 (4%)
 Frame = -1

Query  789  ESVRNAG*AEVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGK  610
            ++ RN     ++N   FA+I+S   FG+    +L ++++++S+LK    + +  +SD+ K
Sbjct  307  QNFRNQSSNAIKNI--FADIFSFIAFGL----ILVYSKSELSILKSFIDETVYGLSDSAK  360

Query  609  ALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLF  430
            A LIIL TDIF+G+HS  GW+ + E I  H+G   ++    +F+   PV++D  +K W+F
Sbjct  361  AFLIILFTDIFVGFHSPHGWEIILENIARHFGLPENRDFNFLFIATFPVILDTVLKYWIF  420

Query  429  KYLPKISPKVSNIFREM  379
            +YL +ISP     ++ M
Sbjct  421  RYLNRISPSAVATYKNM  437



>ref|WP_009782312.1| proton extrusion protein PcxA [Lyngbya sp. PCC 8106]
 gb|EAW39352.1| proton extrusion protein PcxA [Lyngbya sp. PCC 8106]
Length=473

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D    I+  I++Y N+ ++ +LK     LI  +SD+ KA +IIL+TD+F+G+HS  
Sbjct  353  NIFADLFSIITFGIIIYTNKRELEILKSFLGDLIYGLSDSAKAFIIILLTDMFVGFHSPH  412

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E I  H+G   ++    +F+   PV++DA  K W+F+YL + SP   + ++ M
Sbjct  413  GWEVILESISRHFGLPENRDFNFLFIATFPVILDAVFKYWIFRYLNRSSPSAVSTYKTM  471



>ref|XP_002945821.1| hypothetical protein VOLCADRAFT_86170 [Volvox carteri f. nagariensis]
 gb|EFJ52816.1| hypothetical protein VOLCADRAFT_86170 [Volvox carteri f. nagariensis]
Length=395

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 0/122 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N  SD++  ++   +L         +  T  +L   +SD  KA++IIL+ D  LGYHSE 
Sbjct  274  NAVSDSISFLTFVGILSQPTRSRDAMYNTMARLFYGLSDIAKAVMIILVADTLLGYHSEE  333

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREMK  376
            GW  L E+++ HYG E  +  + IFV IVPVVID   K W+F  L +ISP      +++ 
Sbjct  334  GWHGLIELVLGHYGVEPSEEGVVIFVGIVPVVIDVLFKYWIFIGLNRISPGAVVTIKQVD  393

Query  375  RH  370
            RH
Sbjct  394  RH  395



>ref|WP_039728950.1| MULTISPECIES: proton extrusion protein PcxA [Oscillatoriophycideae]
 gb|KIF16443.1| proton extrusion protein PcxA [Aphanocapsa montana BDHKU210001]
 gb|KIF41368.1| proton extrusion protein PcxA [Lyngbya confervoides BDU141951]
Length=463

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGY--KLINNVSDTGKALLIILITD  583
            R+     N++SD +  +  F+LL  NQ K  +L    +  +++  +SD+ KA +IIL TD
Sbjct  336  RSADSVKNVFSD-MLAVGAFVLLLVNQ-KSGILTLKSFMDEIVYGLSDSAKAFIIILFTD  393

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            +F+G+HS  GW+ L E +  H GF  ++  I +F+   PV++D   K W+F+YL +ISP 
Sbjct  394  MFVGFHSPHGWEVLLEGLSRHLGFPANREFIFLFIATFPVILDTVFKYWIFRYLNRISPS  453

Query  402  VSNIFREM  379
                ++ M
Sbjct  454  AVATYKNM  461



>ref|WP_015112596.1| envelope membrane protein [Nostoc sp. PCC 7107]
 gb|AFY42375.1| envelope membrane protein [Nostoc sp. PCC 7107]
Length=423

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +NI++D +  ++  +++   + +++ +K    ++I  +SD+ KA +IIL TDIF+G+H
Sbjct  300  AISNIFADFISLVAFAVVVANGKREIAAIKSFMDEIIFGLSDSAKAFVIILFTDIFVGFH  359

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E + EH G   +++ I +F+   PV++D  VK W+F+YL ++SP     ++
Sbjct  360  SPHGWEVILEGLAEHLGVAPNESLIFLFIATFPVILDTVVKYWIFRYLSRLSPSALATYK  419

Query  384  EM  379
            EM
Sbjct  420  EM  421



>ref|WP_026100281.1| proton extrusion protein PcxA [Microchaete sp. PCC 7126]
Length=421

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            ++    +NI++D +  I+   ++  ++ ++ ++K     L+  +SD+ KA LIIL TDIF
Sbjct  294  KSRDAISNIFADIISLIAFAGVIANSKREIVIVKSFIDNLVYGLSDSAKAFLIILFTDIF  353

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L + + EH G   +++ I +F+   PV++D  VK W+F+YL ++SP   
Sbjct  354  VGFHSPHGWEVLLDGLAEHLGLPANRSVIFLFIATFPVILDTIVKYWIFRYLSRLSPSAL  413

Query  396  NIFREM  379
               +EM
Sbjct  414  ATLKEM  419



>ref|WP_002760527.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCH97832.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9717]
Length=445

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_015124892.1| CemA family [Synechococcus sp. PCC 6312]
 gb|AFY61349.1| CemA family [Synechococcus sp. PCC 6312]
Length=475

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLF-ILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI SD++ G+S F +LL  N+ ++++LK    +++  +SD+ KA +IIL TD+F+G+HS 
Sbjct  355  NILSDSL-GVSAFTLLLLLNRPQIAILKTFMDEVVYGLSDSAKAFIIILFTDVFVGFHSP  413

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW  +    +EH+G   ++  I +F+   PV++D   K W+F+YL +ISP     ++ M
Sbjct  414  HGWTVIVNNTLEHFGLPQNEDFIDMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYKNM  473



>ref|WP_017717029.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=455

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = -1

Query  792  SESVRNAG*AEVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTG  613
            +E  R  G + ++N   FA++ S AVF   +F     ++ ++++LK    ++I  +SD+ 
Sbjct  322  AEEYRAEGNSAIKNV--FADLISAAVFATVVFT----SKREIAILKSFMDEIIYGLSDSA  375

Query  612  KALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWL  433
            KA +IIL+TDIF+G+HS  GW+ + E I  H G    +    +F+   PV++D   K W+
Sbjct  376  KAFIIILLTDIFVGFHSPHGWEVILEGISRHLGLPESRDFNFLFIATFPVILDTIFKYWI  435

Query  432  FKYLPKISPKVSNIFREM  379
            F+YL +ISP     +R M
Sbjct  436  FRYLSRISPSAVATYRNM  453



>ref|WP_024545065.1| proton extrusion protein PcxA [Synechococcus sp. NKBG15041c]
Length=428

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGY  568
             + NI++D +F    F+ +L  +Q ++++LK    +++  +SD+ KA LIIL TDIF+GY
Sbjct  305  AYGNIFAD-IFSFFAFVGVLLVSQREIAMLKGFLDEVVYGLSDSAKAFLIILFTDIFVGY  363

Query  567  HSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIF  388
            HS  GW+ + E + +H+G    +    +F+   PV++D  +K W+F+YL +ISP     +
Sbjct  364  HSPHGWEVILENVAKHFGIAESRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATY  423

Query  387  REM  379
            R M
Sbjct  424  RNM  426



>ref|WP_002787816.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 sp|B0JI44.1|PCXA_MICAN RecName: Full=Proton extrusion protein PcxA [Microcystis aeruginosa 
NIES-843]
 dbj|BAG05606.1| Proton extrusion protein [Microcystis aeruginosa NIES-843]
 emb|CCI17908.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9807]
Length=445

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_024970566.1| proton extrusion protein PcxA [Microcystis aeruginosa]
Length=445

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_002777880.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI08168.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 7941]
 gb|EPF20004.1| Proton extrusion protein PcxA [Microcystis aeruginosa SPC777]
Length=445

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_004163632.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI35202.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9701]
Length=445

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_023065701.1| proton extrusion protein PcxA [Lyngbya aestuarii]
 gb|ERT08110.1| proton extrusion protein PcxA [Lyngbya aestuarii BL J]
Length=473

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            NI++D    I+  I++Y N+ ++ +LK     LI  +SD+ KA +IIL+TD+F+G+HS  
Sbjct  353  NIFADLFSVITFVIIIYTNKRELEILKSFLGDLIYGLSDSAKAFIIILLTDMFVGFHSPH  412

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E I  H+G   ++    +F+   PV++DA  K W+F+YL + SP   + ++ M
Sbjct  413  GWEVILESISRHFGLPENRDFNFLFIATFPVILDAVFKYWIFRYLNRSSPSAVSTYKTM  471



>ref|WP_002745113.1| proton extrusion protein PcxA [Microcystis aeruginosa]
 emb|CAO91349.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47153.1| proton extrusion protein PcxA [Microcystis aeruginosa DIANCHI905]
Length=445

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|YP_009033633.1| chloroplast envelope membrane protein (chloroplast) (chloroplast) 
[Klebsormidium flaccidum]
 gb|AHZ11015.1| chloroplast envelope membrane protein (chloroplast) (chloroplast) 
[Klebsormidium flaccidum]
Length=392

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 74/124 (60%), Gaps = 1/124 (1%)
 Frame = -1

Query  747  RGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINN-VSDTGKALLIILITDIFLG  571
            +    + +D +F  +L +LL F++ KVSL +    ++  + + DT KA LI+L TD+ +G
Sbjct  267  QALVQLCTDGIFVCTLLLLLAFSRRKVSLAQMRAVRIKRSYLLDTMKAFLILLFTDLLIG  326

Query  570  YHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNI  391
            +HS  GW+ L E  + + GF  +Q  +++FV   PV++D   K W+F++L ++SP +   
Sbjct  327  FHSPHGWEILIESFMTYLGFAPNQYVVSLFVSTFPVIVDTVFKYWIFRHLNRVSPSIVVT  386

Query  390  FREM  379
            +  M
Sbjct  387  YHTM  390



>ref|WP_002736605.1| proton extrusion protein PcxA [Microcystis aeruginosa]
 gb|ELP54134.1| proton extrusion protein PcxA [Microcystis aeruginosa TAIHU98]
Length=445

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_004162001.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI20739.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9808]
Length=445

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_002752174.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCH91113.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9432]
Length=445

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TDIF
Sbjct  318  RGLNAIANIFADICSLIAFGCVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDIF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|YP_009057813.1| chloroplast enveloppe membrane protein (chloroplast) [Picocystis 
salinarum]
 gb|AID67585.1| chloroplast enveloppe membrane protein (chloroplast) [Picocystis 
salinarum]
Length=261

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
             N+++D+   I  F L    + ++++LK    +L+  +SDT KA  IILITDIF+G+HS 
Sbjct  140  TNLFTDSSRIIFFFTLCNVQKRQIAVLKSFVDELLYRLSDTTKAFCIILITDIFVGFHSP  199

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ +    + H GF    + + +FV   PV++D   K W+F+YL +I+P     F  M
Sbjct  200  HGWEVVLTSWIHHLGFPESSSFVMLFVATFPVILDTAFKYWIFRYLNQIAPSAVATFHNM  259

Query  378  KR  373
              
Sbjct  260  NE  261



>ref|WP_015226699.1| CemA family protein [Halothece sp. PCC 7418]
 gb|AFZ44826.1| CemA family protein [Halothece sp. PCC 7418]
Length=437

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+     NI +D +  I+   ++YF++ ++++LK    + I  +SD+ KA +IIL TD+F
Sbjct  310  RSTNAIENIIADFLSVIAFGAVIYFSKEQIAVLKSFIDEFIYGLSDSAKAFIIILSTDMF  369

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +GYHS  GW+ + E I  H+G    +    +F+   PV++D   K W+F+YL +ISP   
Sbjct  370  VGYHSPHGWEVILEEIGRHFGLPESREFNFLFIATFPVILDTIFKYWIFRYLNRISPSAV  429

Query  396  NIFREM  379
              +R M
Sbjct  430  ATYRNM  435



>ref|WP_033336675.1| proton extrusion protein PcxA [Scytonema hofmanni]
Length=414

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            AN++SD +  I+   ++  N+  ++ +K    +++  +SD+ KA +IIL+TDIF+G+HS+
Sbjct  293  ANVFSDLLGLIAFAGVIVTNRRGIAAIKSFLNEIVYGLSDSAKAFIIILVTDIFVGFHSQ  352

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E    H G   D+  I +F+   PV++D  VK W+F+YL +ISP      + M
Sbjct  353  HGWEVILESTASHLGVPADRNMIFLFIATFPVLLDTIVKYWIFRYLNQISPSAVATLKNM  412



>gb|KIJ85422.1| proton extrusion protein PcxA [Scytonema tolypothrichoides VB-61278]
Length=427

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 75/120 (63%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D +  I+   ++  ++ ++ ++K     +I  +SD+ KA LIIL TDIF+G+HS 
Sbjct  306  SNVFADLLSLIAFAWVIVTSKREIVIVKSFIDDVIYGLSDSAKAFLIILFTDIFVGFHSP  365

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E   EH G   +++AI+IF+   PV++D   K W+F+YL ++SP      +EM
Sbjct  366  HGWEVILEGFAEHLGLPAEKSAISIFIATFPVILDTIFKYWIFRYLSRLSPSALATMKEM  425



>ref|YP_003359224.1| envelope membrane protein [Cryptomonas paramecium]
 gb|ACT46760.1| envelope membrane protein [Cryptomonas paramecium]
Length=278

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+ SD +   +   L+   + ++S+LK    ++I  +SDT KA LIIL T++F+G+HS  
Sbjct  158  NLLSDIMSFTTFTYLIITGRRQISVLKSFINEIIYELSDTAKAFLIILFTNVFVGFHSTH  217

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ L E  + H+G   ++ AI +F+   PV +D   K W+F+YL ++SP     + EM
Sbjct  218  GWEVLLENGLRHFGLPENRDAIFLFIATFPVFLDTMFKYWIFRYLNQVSPSAVATYHEM  276



>ref|WP_006850660.1| proton extrusion protein PcxA [Synechococcus sp. WH 8109]
 gb|AHF63697.1| CemA family protein [Synechococcus sp. WH 8109]
Length=382

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 72/120 (60%), Gaps = 0/120 (0%)
 Frame = -1

Query  765  AEVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILIT  586
            A+  + +   N++SD    I+  ++ + +++++ +L+    + +  +SD+ KA  IIL T
Sbjct  250  ADEESLKAIKNVFSDLAGLIAFAVVCFMSRDELRVLRGFIDEAVYGLSDSAKAFAIILFT  309

Query  585  DIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISP  406
            DIF+GYHS  GWQ L E I  H+G    Q+ + +F+   PVV+    K W+F+YL ++SP
Sbjct  310  DIFVGYHSPEGWQVLLEGIAGHFGLPSSQSFVNLFIATFPVVLATIFKYWIFRYLNRVSP  369



>ref|YP_008563100.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
lycopersicum]
 ref|AP_004940.1| potential heme-binding protein (chloroplast) [Solanum lycopersicum]
 sp|Q2MI88.1|CEMA_SOLLC RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Solanum lycopersicum]
 gb|ABC56312.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
lycopersicum]
 emb|CAJ32405.1| potential heme-binding protein [Solanum lycopersicum]
 gb|AJO25124.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
lycopersicum]
 gb|AJY78703.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
cheesmaniae]
 gb|AJY78869.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
galapagense]
 gb|AJY78952.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
habrochaites]
 gb|AJY79035.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
lycopersicum]
 gb|AJY79118.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
neorickii]
 gb|AJY79284.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
pimpinellifolium]
Length=229

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  678  QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQ  499
            + K+ +L     + + N+SDT KAL I+L+++ FLGYHS  GW+ +   I    G   ++
Sbjct  128  KEKLVILNSWAQEFLYNLSDTAKALCILLVSEFFLGYHSPPGWEFVIRSIYNEVGVVANE  187

Query  498  AAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
              ITI VCI+PV+ D C K WLF+YL  +SP +
Sbjct  188  QTITILVCILPVIFDTCFKYWLFRYLTSLSPSI  220



>gb|AJY78786.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
chilense]
 gb|AJY79201.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
peruvianum]
Length=229

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  678  QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQ  499
            + K+ +L     + + N+SDT KAL I+L+++ FLGYHS  GW+ +   I    G   ++
Sbjct  128  KEKLVILNSWAQEFLYNLSDTAKALCILLVSEFFLGYHSPPGWEFVIRSIYNEVGVVANE  187

Query  498  AAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
              ITI VCI+PV+ D C K WLF+YL  +SP +
Sbjct  188  QTITILVCILPVIFDTCFKYWLFRYLTSLSPSI  220



>emb|CDN12673.1| Membrane protein PxcA, involved in light-induced proton extrusion 
[Richelia intracellularis]
Length=187

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 73/128 (57%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            +  ++    N+++D +   +   LL  ++  +++LK     ++  +SD+ KA ++IL TD
Sbjct  58   QRESYNAIKNVFADILSVFTFIWLLIVSKKDIAVLKDFFDNIVYGLSDSAKAFILILFTD  117

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            IF+G+HS  GW+ + E +  H+G   +   I +F+   PVV+D   K W+F+YL +ISP 
Sbjct  118  IFVGFHSPHGWEVILEGVSRHWGLPANHEFIFLFIATFPVVLDTIFKYWIFRYLNRISPS  177

Query  402  VSNIFREM  379
                +R M
Sbjct  178  AVATYRNM  185



>ref|WP_035999028.1| proton extrusion protein PcxA [Leptolyngbya sp. JSC-1]
Length=446

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 73/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N++SD +  ++  +++  ++ ++++LK     LI  +SD+ KA +IIL TDIF+G+HS  
Sbjct  326  NVFSDLLGLLAFVVVIATSKREIAVLKSFMDTLIYGLSDSAKAFIIILFTDIFVGFHSPH  385

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ L E +  H G   ++  I +F+   PV++D   K W+F+YL ++SP     +R M
Sbjct  386  GWEVLLESVSRHLGLPANRDFIFLFIATFPVILDTIFKYWIFRYLNRVSPSAVATYRNM  444



>ref|WP_015190872.1| envelope membrane protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ33005.1| envelope membrane protein [Gloeocapsa sp. PCC 7428]
Length=418

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 72/122 (59%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +   +   +L  ++ ++  LK    +++  +SD+ KA +IIL TDIF+G+H
Sbjct  295  AISNVFADLIAVTAFIFVLLISKKQIIALKSFMDEIVYGLSDSAKAFIIILFTDIFVGFH  354

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E I  H G   +++AI +F+   PV++D   K W+F+YL +ISP      R
Sbjct  355  SPHGWEVILEGISSHLGIAANRSAIFLFIATFPVILDTIFKYWIFRYLSRISPSAVATLR  414

Query  384  EM  379
             M
Sbjct  415  NM  416



>ref|YP_538860.1| envelope membrane protein [Solanum bulbocastanum]
 ref|YP_635651.1| envelope membrane protein [Solanum tuberosum]
 sp|Q2MIH5.1|CEMA_SOLBU RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Solanum bulbocastanum]
 sp|Q2VEG5.1|CEMA_SOLTU RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Solanum tuberosum]
 gb|ABB90053.1| potential heme-binding protein [Solanum tuberosum]
 gb|ABC56225.1| chloroplast envelope membrane protein [Solanum bulbocastanum]
 gb|ABD47069.1| chloroplast envelope membrane protein [Solanum tuberosum]
 gb|AEB72151.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
tuberosum]
 gb|AEB72237.1| chloroplast envelope membrane protein (chloroplast) [Solanum 
tuberosum]
Length=229

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  678  QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQ  499
            + K+ +L     + + N+SDT KAL ++L+T+ FLGYHS  GW+     I    G   ++
Sbjct  128  KEKLVILNSWAQEFLYNLSDTAKALCLLLVTEFFLGYHSPPGWEFAIRSIYNEVGVVANE  187

Query  498  AAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
              ITI VCI+PV+ D C K WLF+YL  +SP +
Sbjct  188  QTITILVCILPVIFDTCFKYWLFRYLTSLSPSI  220



>ref|WP_015114560.1| envelope membrane protein [Nostoc sp. PCC 7107]
 gb|AFY44358.1| envelope membrane protein [Nostoc sp. PCC 7107]
Length=442

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            N+++D +F +  F+ LL  ++  +S+LK     L+  +SD+ KA +IIL TD+F+G+HS 
Sbjct  322  NVFAD-IFSVVAFVWLLLVSKQSISVLKDFFDNLVYGLSDSAKAFIIILFTDVFVGFHSP  380

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E I  H+G   ++  I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  381  HGWEVILEGISRHWGLPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNM  440



>ref|WP_015126108.1| CemA family [Synechococcus sp. PCC 6312]
 gb|AFY62571.1| CemA family [Synechococcus sp. PCC 6312]
Length=409

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 75/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query  795  SSESVRNAG*AEVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDT  616
            + E  R AG    R   G  NI++D +   S  +L+Y  + ++  L+    +   +++DT
Sbjct  272  AEELYRQAG---YRTLDGLKNIFADIISLASFVLLVYGGRRQLQALRMFFGRTFTSLNDT  328

Query  615  GKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLW  436
             K  L+IL+TD+F+GYHS  GW+ +   I  H+G    +     F+  VPV++D+  K W
Sbjct  329  TKVFLVILVTDLFVGYHSPEGWEVILGGIASHFGLPESRTFNNSFIATVPVIMDSWFKFW  388

Query  435  LFKYLPKISPKVSNIFREMKR  373
            +F YL + SP    I  +M +
Sbjct  389  VFNYLTRTSPSSVAILEKMNQ  409



>ref|WP_002770448.1| Proton extrusion protein pcxA [Microcystis aeruginosa]
 emb|CCI04013.1| Proton extrusion protein pcxA [Microcystis aeruginosa PCC 9443]
Length=445

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R     ANI++D    I+   ++ F++ ++ ++K     ++ N+SD+ KA LIIL TD+F
Sbjct  318  RGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYNLSDSAKAFLIILFTDMF  377

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ + E +  H+G   ++    +F+   PV++D  +K W+F+YL +ISP   
Sbjct  378  VGFHSPHGWEVILEGLSRHFGLPENREFNFLFIATFPVILDTVLKYWIFRYLNRISPSAV  437

Query  396  NIFREM  379
              +R M
Sbjct  438  ATYRNM  443



>ref|WP_035115590.1| MULTISPECIES: proton extrusion protein PcxA, partial [Stigonematales]
Length=279

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D V  ++   ++  ++ ++ ++K     +I  +SD+ KA LIIL TDIF+G+HS 
Sbjct  158  SNVFADLVSLVAFAFVIATSKREIVIVKSFIDDIIYGLSDSAKAFLIILFTDIFVGFHSP  217

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E +  H G   ++ AI +F+   PV++D   K W+F+YL ++SP      +EM
Sbjct  218  HGWEVILEGVAAHLGLPANRNAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLKEM  277



>ref|WP_015204817.1| envelope membrane protein [Crinalium epipsammum]
 gb|AFZ14717.1| envelope membrane protein [Crinalium epipsammum PCC 9333]
Length=424

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = -1

Query  738  ANIWSDAVFGISLF-ILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
            +NI++D   G++ F +++  ++ ++  +KF   +++  +SD+ KA +IIL TDIF+G+HS
Sbjct  303  SNIFAD-FLGLAAFGVVIATSKREIVTVKFFMDEIVYGLSDSAKAFIIILCTDIFVGFHS  361

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW+ + E    H G   +Q+ I++F+  VPV++D   K W+F+YL ++SP      R 
Sbjct  362  PHGWEVILEGFAGHLGLAANQSLISLFIATVPVILDTFFKYWIFRYLSRVSPSAVATLRN  421

Query  381  M  379
            M
Sbjct  422  M  422



>ref|WP_017744384.1| hypothetical protein [Scytonema hofmanni]
Length=429

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            + ++    +N+++D +  I+  +++  +Q ++ ++K     +I  +SD+ KA LIIL TD
Sbjct  300  QAKSNSAISNVFADLLSLIAFALVIVTSQKEILVVKAFLDNIIYGLSDSAKAFLIILFTD  359

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
             F+G+HS  GW+ + + + EH G   +Q+ I++F+   PV++D   K W+F+YL ++SP 
Sbjct  360  TFVGFHSPHGWEVILDGLAEHIGLPANQSLISLFIATFPVILDTIFKYWIFRYLSRLSPS  419

Query  402  VSNIFREM  379
                +++M
Sbjct  420  ALATYKDM  427



>ref|WP_015163468.1| CemA family protein [Pseudanabaena sp. PCC 7367]
 gb|AFY68494.1| CemA family protein [Pseudanabaena sp. PCC 7367]
Length=481

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 70/122 (57%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
            G  N ++D       + L+Y  ++++ ++K      +  +SD  KA LII+ TD F+GYH
Sbjct  358  GIRNFFADTCAFFVFYALIYIRRDQLIVIKKFLDDTLYGLSDNAKAFLIIVATDTFVGYH  417

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ L  V+++H+    ++  +  F+  VPV +D   K W+F+YL + SP  S I+R
Sbjct  418  SSDGWEALLGVLLQHFSIPENKTFLLTFIATVPVFLDGLFKFWIFQYLRQASPSTSAIYR  477

Query  384  EM  379
            EM
Sbjct  478  EM  479



>ref|YP_009019670.1| heme binding protein cemA (chloroplast) [Gracilaria salicornia]
 gb|AHH24638.1| heme binding protein cemA (chloroplast) [Gracilaria salicornia]
Length=278

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -1

Query  678  QNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVDQ  499
            + + S+L+    +LI ++SDT KA LIIL TD+F+G+HS  GW+ + E+I+ H G    +
Sbjct  177  KRQFSILRSFLNELIYSLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEIILRHLGLPESR  236

Query  498  AAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
              I +F+   PVV+D   K W+F+YL KISP     +  M
Sbjct  237  DFIFVFISTFPVVLDTIFKYWIFRYLNKISPSAVATYHNM  276



>ref|YP_002600808.1| chloroplast enveloppe membrane protein (chloroplast) [Pycnococcus 
provasolii]
 gb|ACK36791.1| chloroplast enveloppe membrane protein (chloroplast) [Pycnococcus 
provasolii]
Length=270

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 68/112 (61%), Gaps = 1/112 (1%)
 Frame = -1

Query  711  GISLFILL-YFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSE  535
              SLF+LL   +Q ++S+L+    + +  +SD  KA L+IL+TDIF+G+HS  GW+   +
Sbjct  157  SFSLFVLLARRDQARLSILRSFLDESLYGLSDATKAFLLILLTDIFVGFHSPKGWEVFLD  216

Query  534  VIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
              +E +G      ++ +F+ + PVV+D   K W+F+YL ++SP     +R M
Sbjct  217  KALEQFGLSSHTPSVMLFIAVFPVVLDTIFKYWIFRYLNRLSPSAVATYRNM  268



>ref|WP_016858373.1| proton extrusion protein PcxA [Fischerella muscicola]
Length=436

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 72/122 (59%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
               N+++D +  ++   LL  ++ ++++LK     ++  +SD+ KA +IIL TDIF+G+H
Sbjct  313  ALKNVFADILSVVAFVFLLLMSKREIAILKSFFDNIVYGLSDSAKAFIIILFTDIFVGFH  372

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E +  H+G   +   I +F+   PV++D   K W+F+YL +ISP     +R
Sbjct  373  SPHGWEVILEGVSRHWGLPANHDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYR  432

Query  384  EM  379
             M
Sbjct  433  NM  434



>ref|YP_008144910.1| chloroplast envelope membrane protein [Grateloupia taiwanensis]
 gb|AGO19754.1| chloroplast envelope membrane protein [Grateloupia taiwanensis]
Length=278

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = -1

Query  681  NQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVD  502
            ++ ++S+L+     +I  +SDT KA LIIL TD+F+G+HS  GW+ + EVI+ H+G    
Sbjct  176  SKRQLSILRSFINDVIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHFGLPES  235

Query  501  QAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            +  I +F+   PVV+D   K W+F+YL +ISP     +  M
Sbjct  236  RDFIFVFISTFPVVLDTIFKYWIFRYLNRISPSAVATYHNM  276



>ref|WP_028084754.1| proton extrusion protein PcxA [Dolichospermum circinale]
Length=437

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 74/123 (60%), Gaps = 8/123 (7%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNV----SDTGKALLIILITDIFLGY  568
            N+++D    IS  +LL  +++ +++LK    + I+NV    SD+ KA +IIL TD+F+G+
Sbjct  317  NVFADICAVISFTVLLLMSKSSIAVLK----EFIDNVVYGLSDSAKAFIIILFTDVFVGF  372

Query  567  HSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIF  388
            HS  GW+ L E I  H+G   ++  I +F+   PV++D   K W+F+YL +ISP     +
Sbjct  373  HSPHGWEVLLEGISRHWGLPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATY  432

Query  387  REM  379
              M
Sbjct  433  HNM  435



>ref|WP_033378483.1| proton extrusion protein PcxA, partial [Fischerella muscicola]
Length=281

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N++++ V  I+   ++  ++ ++ ++K     +I  +SD+ KA LIIL TDIF+G+HS 
Sbjct  160  SNVFANLVSLIAFAFVIATSKREIVIVKSFIDDMIYGLSDSAKAFLIILFTDIFVGFHSP  219

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E +  H G   ++ AI +F+   PV++D   K W+F+YL ++SP      +EM
Sbjct  220  HGWEVILEGVAAHLGLPANRNAIFLFIATFPVILDTIFKYWIFRYLSRLSPSALATLKEM  279



>ref|WP_023076871.1| envelope membrane protein [Leptolyngbya sp. Heron Island J]
 gb|ESA32276.1| envelope membrane protein [Leptolyngbya sp. Heron Island J]
Length=430

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = -1

Query  756  RNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIF  577
            R+     N+++D    ++  ILL   + +V+ LK    +++  +SD+ KA +IIL TDIF
Sbjct  303  RSADSVKNVFADIFAVLAFSILLSTCKRQVATLKAFIDEIVYGLSDSAKAFIIILFTDIF  362

Query  576  LGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVS  397
            +G+HS  GW+ L E +  H GF  ++  I +F+   PV++D   K W+F+YL +ISP   
Sbjct  363  VGFHSPHGWEVLLEGMSRHLGFPANRDFIFLFIATFPVILDTVFKYWIFRYLNRISPSAV  422

Query  396  NIFREM  379
              ++ M
Sbjct  423  ATYKNM  428



>ref|WP_019493888.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=439

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -1

Query  759  VRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDI  580
            V +     N++SD    ++   LL  ++ ++S+LK     ++  +SD+ KA +IIL TDI
Sbjct  311  VESSNAIKNVFSDMTSVVAFTWLLLVSKREISVLKDFFDHIVYGLSDSAKAFIIILFTDI  370

Query  579  FLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKV  400
            F+G+HS  GW+ + E I  H+G   + + I +F+   PV++D   K W+F+YL ++SP  
Sbjct  371  FVGFHSPHGWEVILEGISRHWGLPGNHSFIFLFIATFPVILDTIFKYWIFRYLNRVSPSA  430

Query  399  SNIFREM  379
               +R M
Sbjct  431  VATYRNM  437



>ref|YP_009122224.1| chloroplast envelope membrane protein [Vertebrata lanosa]
 gb|AJH65982.1| chloroplast envelope membrane protein [Vertebrata lanosa]
Length=278

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 61/101 (60%), Gaps = 0/101 (0%)
 Frame = -1

Query  681  NQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSESGWQTLSEVIVEHYGFEVD  502
            N+ ++S+L     + I  +SDT KA LIIL TDIF+G+HS  GW+ + E I+ H+G    
Sbjct  176  NKRQLSILTSFINESIYGLSDTAKAFLIILFTDIFVGFHSPHGWEIVIEAILRHFGLPES  235

Query  501  QAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            +  I IF+   PVV+D   K W+F+YL +ISP     +  M
Sbjct  236  RDFIFIFISTFPVVLDTIFKYWIFRYLNRISPSAVATYHNM  276



>ref|WP_015192003.1| envelope membrane protein [Stanieria cyanosphaera]
 gb|AFZ34330.1| envelope membrane protein [Stanieria cyanosphaera PCC 7437]
Length=432

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 74/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +N+++D +  I+   ++  NQ  +  +K     +I N+SD+ KA +II++TDIF+G+H
Sbjct  309  AISNVFADLLGLIAFAGVVLTNQQGIIAVKSFLDSMIYNLSDSAKAFIIIMLTDIFVGFH  368

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E +  H G + +++AI +F+   PV++D   K W+F+YL +ISP      +
Sbjct  369  SPHGWEIIMEGVANHLGIQPNRSAIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATLK  428

Query  384  EM  379
             M
Sbjct  429  NM  430



>ref|WP_026720646.1| proton extrusion protein PcxA [Fischerella sp. PCC 9431]
Length=437

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 72/122 (59%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
               N+++D +  ++   LL  ++ ++++LK     ++  +SD+ KA +IIL TDIF+G+H
Sbjct  314  ALKNVFADILSVVAFVFLLLMSKREIAVLKGFFDNIVYGLSDSAKAFIIILFTDIFVGFH  373

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + E +  H+G   +   I +F+   PV++D   K W+F+YL +ISP     +R
Sbjct  374  SPHGWEVILEGVSRHWGLPANHDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYR  433

Query  384  EM  379
             M
Sbjct  434  NM  435



>gb|ADI64819.1| CemA family protein ['Nostoc azollae' 0708]
Length=433

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            N+++D +F ++ FI LL+ +++ +S+LK     ++  +SD+ KA +IIL TD+F+G+HS 
Sbjct  313  NVFAD-IFSVAAFIWLLFISKSSISVLKDFLDHIVYGLSDSAKAFIIILFTDVFVGFHSP  371

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E +  H+G   ++  I +F+   PV++D   K W+F+YL +ISP     +  M
Sbjct  372  HGWEVILEGLSRHWGLPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYHNM  431



>ref|NP_045051.1| envelope membrane protein [Cyanidium caldarium]
 sp|Q9TM16.1|CEMA_CYACA RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Cyanidium caldarium]
 gb|AAF12995.1|AF022186_167 unknown [Cyanidium caldarium]
Length=278

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFILL-YFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            NI +D++  IS+FILL    + +  +LK    +++  +SDT KA LIIL TD+F+G+HS 
Sbjct  158  NILADSI-SISVFILLIVLGKRQTFVLKSFLNEIVYGLSDTAKAFLIILFTDMFIGFHSP  216

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E ++ H+G   ++  I +F+   PV +D   K W+F+YL ++SP     +  M
Sbjct  217  HGWEVVIESLLRHFGLPENRDFIFLFIATFPVSLDTVFKYWIFRYLNQVSPSAVATYHNM  276



>ref|WP_009555792.1| CemA family protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ71136.1| CemA family protein [Oscillatoriales cyanobacterium JSC-12]
Length=447

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N++SD +  I+  ++L  N+  + +LK    + +  +SD+ KA +IIL TD+F+G+HS  
Sbjct  326  NVFSDLISVIAFVVVLMTNREGLEILKSFIDETVYGLSDSAKAFIIILFTDMFVGFHSPH  385

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ L E + +H G   ++  I +F+   PV++D   K W+F+YL +ISP     ++ M
Sbjct  386  GWEVLLEGLAKHLGLPANRNFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYKNM  444



>ref|WP_041640509.1| proton extrusion protein PcxA [Trichormus azollae]
Length=437

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  735  NIWSDAVFGISLFI-LLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            N+++D +F ++ FI LL+ +++ +S+LK     ++  +SD+ KA +IIL TD+F+G+HS 
Sbjct  317  NVFAD-IFSVAAFIWLLFISKSSISVLKDFLDHIVYGLSDSAKAFIIILFTDVFVGFHSP  375

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E +  H+G   ++  I +F+   PV++D   K W+F+YL +ISP     +  M
Sbjct  376  HGWEVILEGLSRHWGLPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYHNM  435



>ref|YP_001019143.1| chloroplast enveloppe membrane protein [Chlorokybus atmophyticus]
 sp|Q19V69.2|CEMA_CHLAT RecName: Full=Chloroplast envelope membrane protein (chloroplast) 
[Chlorokybus atmophyticus]
 gb|ABD62176.2| chloroplast enveloppe membrane protein [Chlorokybus atmophyticus]
Length=236

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 2/123 (2%)
 Frame = -1

Query  738  ANIWSDAVFGISLFIL-LYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
            AN+++D +  + +F+L L   + +++++K     LI +++D  K+  IIL TDIF+G+HS
Sbjct  115  ANVFAD-LLSLCIFVLALLLGKKEIAVIKNLVNTLIYSLTDATKSFFIILFTDIFVGFHS  173

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW+ L EV ++H G   ++  I +FV   PVV+D   K W+F YL KISP     F  
Sbjct  174  SHGWEILIEVFLKHLGLPENKDFIFLFVATFPVVLDTVFKYWIFLYLNKISPSAVATFHN  233

Query  381  MKR  373
            M  
Sbjct  234  MNE  236



>ref|WP_041740047.1| proton extrusion protein PcxA [Calothrix parietina]
Length=397

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 72/120 (60%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
            +N+++D +  ++  +++  N+  +  +K    +++  +SD+ KA LIIL TDIF+G+HS 
Sbjct  276  SNVFADVMSLVAFAVVIATNRRAIQFVKDFMDEIVYTLSDSAKAFLIILFTDIFVGFHSP  335

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ L +   +H G   +Q+ I  F+   PV+++   K W+F+YL ++SP      +EM
Sbjct  336  HGWEVLLDSFAKHLGLPANQSVIFFFIATFPVILNTIFKYWIFRYLSRLSPSALATLKEM  395



>ref|WP_021833203.1| Membrane protein PxcA, involved in light-induced proton extrusion 
[Crocosphaera watsonii]
 emb|CCQ56486.1| Membrane protein PxcA, involved in light-induced proton extrusion 
[Crocosphaera watsonii WH 0005]
Length=227

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 72/123 (59%), Gaps = 2/123 (2%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNK-VSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHS  562
             N+++D +F I  F L+  +  K + +LK    +++  +SD  KA LIIL TD+F+G+HS
Sbjct  106  GNVFAD-LFSIGAFALVIVSSRKEIEVLKSFLDEILYGLSDPAKAFLIILFTDMFVGFHS  164

Query  561  ESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFRE  382
              GW+ + E +  H+G   +Q    +F+   PV++D  +K W+F+YL +ISP     ++ 
Sbjct  165  PHGWEVILEGVAHHFGLPENQEFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYKN  224

Query  381  MKR  373
            M  
Sbjct  225  MNE  227



>gb|KIE06800.1| proton extrusion protein PcxA [Tolypothrix bouteillei VB521301]
Length=430

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 75/122 (61%), Gaps = 0/122 (0%)
 Frame = -1

Query  744  GFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYH  565
              +NI++D +  I+  +++  +Q ++ ++K     +I  +SD+ KA LIIL TD F+G+H
Sbjct  307  AISNIFADLLALIAFALVIVTSQKEILVVKAFLDNIIYGLSDSAKAFLIILFTDTFVGFH  366

Query  564  SESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFR  385
            S  GW+ + +   +H G   +Q+ I++F+   PV++D   K W+F+YL ++SP     ++
Sbjct  367  SPHGWEVILDSFAKHLGLPANQSLISLFIATFPVILDTIFKYWIFRYLSRLSPSALATYK  426

Query  384  EM  379
            +M
Sbjct  427  DM  428



>ref|WP_009454532.1| envelope membrane protein [Fischerella sp. JSC-11]
 gb|EHC18565.1| envelope membrane protein [Fischerella sp. JSC-11]
Length=436

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+++D +  I+   LL  ++ ++++LK     ++  +SD+ KA +IIL TDIF+G+HS  
Sbjct  316  NVFADILSVIAFVFLLVTSKREITVLKGFFDNIVYGLSDSAKAFIIILFTDIFVGFHSPH  375

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E +  H+G   +   I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  376  GWEVILEGVSRHWGLPANHDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNM  434



>ref|WP_016871666.1| proton extrusion protein PcxA [Fischerella thermalis]
Length=436

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  735  NIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSES  556
            N+++D +  I+   LL  ++ ++++LK     ++  +SD+ KA +IIL TDIF+G+HS  
Sbjct  316  NVFADILSVIAFVFLLVTSKREIAVLKGFFDNIVYGLSDSAKAFIIILFTDIFVGFHSPH  375

Query  555  GWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
            GW+ + E +  H+G   +   I +F+   PV++D   K W+F+YL +ISP     +R M
Sbjct  376  GWEVILEGVSRHWGLPANHDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNM  434



>ref|WP_015230048.1| CemA family [Dactylococcopsis salina]
 gb|AFZ51058.1| CemA family [Dactylococcopsis salina PCC 8305]
Length=434

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 73/128 (57%), Gaps = 0/128 (0%)
 Frame = -1

Query  762  EVRNWRGFANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITD  583
            + R      NI +D    I+  +++Y ++ ++++LK    + I  +SD+ KA +IIL TD
Sbjct  305  QSRGKNAIQNIIADLCSVIAFAVIIYVSKKEIAVLKSFIDEFIYGLSDSAKAFIIILSTD  364

Query  582  IFLGYHSESGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPK  403
            +F+GYHS  GW+ + E I  H+G    +    +F+   PV++D   K W+F+YL +ISP 
Sbjct  365  MFVGYHSPHGWEVILEEIGRHFGLPESREFNFLFIATFPVILDTIFKYWIFRYLNRISPS  424

Query  402  VSNIFREM  379
                +R M
Sbjct  425  AVATYRNM  432



>ref|WP_012954141.1| CemA family protein [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95454.1| CemA family [Candidatus Atelocyanobacterium thalassa isolate 
ALOHA]
Length=442

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  738  ANIWSDAVFGISLFILLYFNQNKVSLLKFTGYKLINNVSDTGKALLIILITDIFLGYHSE  559
             N+++D    I+  +++ F++ ++ +LK    +++  +SD  KA LIIL TD+F+G+HS 
Sbjct  321  GNVFADLFSVIAFMVVVGFSRKEIEILKAFLDEILYGLSDPAKAFLIILFTDMFVGFHSP  380

Query  558  SGWQTLSEVIVEHYGFEVDQAAITIFVCIVPVVIDACVKLWLFKYLPKISPKVSNIFREM  379
             GW+ + E I  H+G   +Q    +F+   PV++D  +K W+F+YL +ISP     ++ M
Sbjct  381  HGWEVILEGISHHFGLPENQEFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYKNM  440



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272