BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4219

Length=848
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626552.1|  PREDICTED: pre-rRNA-processing protein las1        157   3e-40   Nicotiana tomentosiformis
ref|XP_006357653.1|  PREDICTED: uncharacterized protein LOC102599...    154   4e-39   Solanum tuberosum [potatoes]
ref|XP_006357654.1|  PREDICTED: uncharacterized protein LOC102599...    154   4e-39   Solanum tuberosum [potatoes]
ref|XP_010323905.1|  PREDICTED: uncharacterized protein LOC101262...    144   3e-35   Solanum lycopersicum
ref|XP_004243580.1|  PREDICTED: uncharacterized protein LOC101262...    143   3e-35   Solanum lycopersicum
ref|XP_002314010.1|  las1-like family protein                           142   6e-35   
ref|XP_011036402.1|  PREDICTED: uncharacterized protein LOC105133938    142   7e-35   Populus euphratica
ref|XP_009762963.1|  PREDICTED: uncharacterized protein LOC104214933    141   2e-34   Nicotiana sylvestris
ref|XP_008227626.1|  PREDICTED: uncharacterized protein LOC103327116    139   1e-33   Prunus mume [ume]
ref|XP_007040711.1|  Las1-like family protein, putative isoform 2       133   4e-32   
ref|XP_008347960.1|  PREDICTED: uncharacterized protein LOC103411083    127   1e-31   
ref|XP_010271772.1|  PREDICTED: uncharacterized protein LOC104607...    133   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010271771.1|  PREDICTED: uncharacterized protein LOC104607...    133   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010271773.1|  PREDICTED: uncharacterized protein LOC104607...    133   1e-31   Nelumbo nucifera [Indian lotus]
emb|CBI17902.3|  unnamed protein product                                132   1e-31   Vitis vinifera
ref|XP_007040710.1|  Las1-like family protein, putative isoform 1       133   1e-31   
ref|XP_010656891.1|  PREDICTED: pre-rRNA-processing protein las1        132   3e-31   Vitis vinifera
ref|XP_007214532.1|  hypothetical protein PRUPE_ppa003033mg             131   5e-31   
gb|ABK93614.1|  unknown                                                 127   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011082168.1|  PREDICTED: uncharacterized protein LOC105164994    129   5e-30   Sesamum indicum [beniseed]
ref|XP_008357643.1|  PREDICTED: uncharacterized protein LOC103421...    126   1e-29   
ref|XP_009353741.1|  PREDICTED: uncharacterized protein LOC103944...    127   1e-29   
ref|XP_009353740.1|  PREDICTED: uncharacterized protein LOC103944...    127   2e-29   Pyrus x bretschneideri [bai li]
gb|KJB21154.1|  hypothetical protein B456_003G185300                    127   2e-29   Gossypium raimondii
ref|XP_002298459.2|  las1-like family protein                           127   2e-29   
gb|KJB21153.1|  hypothetical protein B456_003G185300                    127   2e-29   Gossypium raimondii
ref|XP_008357641.1|  PREDICTED: uncharacterized protein LOC103421...    126   4e-29   
ref|XP_008357642.1|  PREDICTED: uncharacterized protein LOC103421...    126   4e-29   
ref|XP_008339382.1|  PREDICTED: uncharacterized protein LOC103402...    125   6e-29   
ref|XP_008339381.1|  PREDICTED: uncharacterized protein LOC103402...    125   7e-29   
ref|XP_008339380.1|  PREDICTED: uncharacterized protein LOC103402...    125   8e-29   
ref|XP_008449642.1|  PREDICTED: pre-rRNA-processing protein las1        125   9e-29   Cucumis melo [Oriental melon]
ref|XP_008339379.1|  PREDICTED: uncharacterized protein LOC103402...    125   9e-29   
ref|XP_007198899.1|  hypothetical protein PRUPE_ppa003025mg             124   2e-28   Prunus persica
gb|KHG08373.1|  Ribosomal biogenesis LAS1L                              124   2e-28   Gossypium arboreum [tree cotton]
ref|XP_010031719.1|  PREDICTED: uncharacterized protein LOC104421464    121   2e-27   Eucalyptus grandis [rose gum]
ref|XP_011024993.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   1e-26   Populus euphratica
ref|XP_010097924.1|  hypothetical protein L484_009358                   119   2e-26   
ref|XP_006470523.1|  PREDICTED: uncharacterized protein LOC102625...    118   4e-26   Citrus sinensis [apfelsine]
ref|XP_006470524.1|  PREDICTED: uncharacterized protein LOC102625...    117   4e-26   
ref|XP_009355292.1|  PREDICTED: uncharacterized protein LOC103946...    117   6e-26   
ref|XP_009355290.1|  PREDICTED: uncharacterized protein LOC103946...    117   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_012065836.1|  PREDICTED: uncharacterized protein LOC105628...    116   1e-25   Jatropha curcas
ref|XP_012065835.1|  PREDICTED: uncharacterized protein LOC105628...    116   2e-25   Jatropha curcas
gb|KEH28372.1|  Las1 family protein, putative                           114   2e-25   Medicago truncatula
ref|XP_004140277.1|  PREDICTED: pre-rRNA-processing protein las1        115   2e-25   Cucumis sativus [cucumbers]
gb|KGN48087.1|  hypothetical protein Csa_6G430640                       115   4e-25   Cucumis sativus [cucumbers]
ref|XP_011464875.1|  PREDICTED: protein LAS1 isoform X2                 115   4e-25   Fragaria vesca subsp. vesca
ref|XP_004299975.1|  PREDICTED: uncharacterized protein LOC101296...    115   4e-25   Fragaria vesca subsp. vesca
ref|XP_003617221.1|  LAS1-like protein                                  114   5e-25   
gb|KHN38396.1|  hypothetical protein glysoja_004061                     107   1e-23   Glycine soja [wild soybean]
ref|XP_002530843.1|  conserved hypothetical protein                     110   2e-23   
ref|XP_006575620.1|  PREDICTED: uncharacterized protein LOC100818...    108   5e-23   Glycine max [soybeans]
ref|XP_006575619.1|  PREDICTED: uncharacterized protein LOC100818...    108   5e-23   Glycine max [soybeans]
ref|XP_006446315.1|  hypothetical protein CICLE_v10014592mg             106   3e-22   Citrus clementina [clementine]
ref|XP_006446316.1|  hypothetical protein CICLE_v10014592mg             106   3e-22   
ref|XP_010519821.1|  PREDICTED: pre-rRNA-processing protein las1        105   5e-22   Tarenaya hassleriana [spider flower]
ref|XP_003545166.1|  PREDICTED: uncharacterized protein LOC100775513    102   8e-21   Glycine max [soybeans]
gb|KHN12038.1|  Ribosomal biogenesis protein LAS1L                      102   8e-21   Glycine soja [wild soybean]
ref|XP_007141512.1|  hypothetical protein PHAVU_008G202300g             102   1e-20   Phaseolus vulgaris [French bean]
ref|XP_004491236.1|  PREDICTED: uncharacterized protein LOC101503...    100   3e-20   
ref|XP_004491237.1|  PREDICTED: uncharacterized protein LOC101503...    100   3e-20   Cicer arietinum [garbanzo]
ref|XP_010673777.1|  PREDICTED: uncharacterized protein LOC104890...  95.5    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673778.1|  PREDICTED: uncharacterized protein LOC104890...  95.5    2e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37440.1|  hypothetical protein MIMGU_mgv11b003028mg             95.1    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_010491978.1|  PREDICTED: uncharacterized protein LOC104769459  93.6    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010419810.1|  PREDICTED: uncharacterized protein LOC104705493  92.4    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010543390.1|  PREDICTED: uncharacterized protein LOC104816...  91.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_010543391.1|  PREDICTED: uncharacterized protein LOC104816...  91.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_010453287.1|  PREDICTED: uncharacterized protein LOC104735237  91.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006399738.1|  hypothetical protein EUTSA_v10012989mg           89.7    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010922079.1|  PREDICTED: uncharacterized protein LOC105045481  89.0    3e-16   
ref|XP_008788499.1|  PREDICTED: uncharacterized protein LOC103706229  85.9    3e-15   Phoenix dactylifera
ref|NP_196783.2|  las1-like family protein                            85.9    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190293.1|  las1-like family protein                         85.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10040.1|  unnamed protein product                              85.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287306.1|  hypothetical protein CARUB_v10000499mg           84.0    1e-14   Capsella rubella
gb|EMT32865.1|  hypothetical protein F775_28198                       82.8    2e-14   
ref|XP_002871519.1|  hypothetical protein ARALYDRAFT_488065           82.0    4e-14   
gb|AAL91200.1|  unknown protein                                       80.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131263.1|  PREDICTED: uncharacterized protein LOC103855960  80.1    2e-13   Brassica rapa
gb|KDO54755.1|  hypothetical protein CISIN_1g008111mg                 79.7    2e-13   Citrus sinensis [apfelsine]
gb|KDO54753.1|  hypothetical protein CISIN_1g008111mg                 79.7    3e-13   Citrus sinensis [apfelsine]
gb|KDO54752.1|  hypothetical protein CISIN_1g008111mg                 79.3    3e-13   Citrus sinensis [apfelsine]
emb|CDX78473.1|  BnaA03g03850D                                        79.0    5e-13   
emb|CDX70455.1|  BnaC03g05390D                                        78.2    7e-13   
gb|KFK25498.1|  hypothetical protein AALP_AA8G122400                  78.2    8e-13   Arabis alpina [alpine rockcress]
emb|CDM84627.1|  unnamed protein product                              77.4    1e-12   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ98227.1|  predicted protein                                    75.9    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006832836.1|  PREDICTED: uncharacterized protein LOC18426107   72.0    8e-11   Amborella trichopoda
ref|XP_004970301.1|  PREDICTED: uncharacterized protein LOC101771511  70.1    3e-10   
ref|XP_009384357.1|  PREDICTED: uncharacterized protein LOC103971923  69.7    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001066337.1|  Os12g0189900                                     69.3    7e-10   
gb|EPS61111.1|  hypothetical protein M569_13688                       68.9    8e-10   Genlisea aurea
gb|EEC68976.1|  hypothetical protein OsI_37725                        68.9    8e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_002458656.1|  hypothetical protein SORBIDRAFT_03g037530        67.8    2e-09   Sorghum bicolor [broomcorn]
ref|XP_006663879.1|  PREDICTED: uncharacterized protein LOC102721786  67.0    4e-09   
emb|CDY69624.1|  BnaAnng31020D                                        64.7    2e-08   Brassica napus [oilseed rape]
ref|XP_010232471.1|  PREDICTED: uncharacterized protein LOC100831838  59.3    2e-06   Brachypodium distachyon [annual false brome]
ref|NP_001145840.1|  uncharacterized protein LOC100279349             58.5    3e-06   Zea mays [maize]
tpg|DAA57195.1|  TPA: hypothetical protein ZEAMMB73_455150            58.5    3e-06   
ref|NP_001044572.2|  Os01g0807800                                     51.2    1e-04   
gb|EEC71671.1|  hypothetical protein OsI_04138                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]



>ref|XP_009626552.1| PREDICTED: pre-rRNA-processing protein las1 [Nicotiana tomentosiformis]
Length=631

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 144/227 (63%), Gaps = 19/227 (8%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            SH N QLM S++V+A++MG++SL +KL  L  LSVF +++  SD     SESFL SR E+
Sbjct  410  SHTNNQLMDSALVIAQIMGRSSLFHKLNKLCSLSVFDSEIIHSDPFTNISESFLLSRGED  469

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL QA +KL+LIK + +K N V KT + AG R  WVV + W+PCPIGM+PH F S+GRLP
Sbjct  470  SLRQAAQKLELIKCRVVKGNNV-KTAD-AGSR--WVVAEAWKPCPIGMLPHTFGSTGRLP  525

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDN-SHHKKMRAETESSHE---  322
            ILD   +  EV+KSS+  E   +++   KR A SAIECLD+    KKMR   E       
Sbjct  526  ILDFVDDSAEVAKSSD-NEIPETDKCGCKRDASSAIECLDDHPSIKKMRKTEEPGDSNND  584

Query  321  ---------LDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
                      DD    G +G L+IGG WKKV+ +ELQ IA SV++L+
Sbjct  585  RDSLSDKNGNDDMPLEGSKGHLLIGGVWKKVSTEELQDIARSVKILI  631



>ref|XP_006357653.1| PREDICTED: uncharacterized protein LOC102599960 isoform X1 [Solanum 
tuberosum]
Length=643

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 142/226 (63%), Gaps = 21/226 (9%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            S+ N QLM S++V+A+++G+NS + KL  L  LSVF +++  SD    +SE FL SR+E+
Sbjct  419  SNNNNQLMKSALVIAQMIGRNSFIVKLNKLCSLSVFDSEIIHSDPSTNNSERFLLSREED  478

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL +A +KL+LI  + +K N +N T   +    QWVV   W+ CPIGM+PHAF S+GRLP
Sbjct  479  SLRKAAQKLELIMRRVVKGNNMNTTDTGS----QWVVAKTWKACPIGMLPHAFGSTGRLP  534

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMR------------  346
            ILD   +  EV+KSS+  E   +N+   KR A SAIECLD+ + KKMR            
Sbjct  535  ILDFVDDSAEVAKSSD-NEIPETNKCGCKREAASAIECLDDPNTKKMRKTEEPGDNQYTE  593

Query  345  -AETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
              E E+ H  +D    G +G LMI G WKKV+ +EL+ IA++V++ 
Sbjct  594  NMEIENGH--NDVPLEGSKGQLMIDGVWKKVSIEELRDIAAAVKIF  637



>ref|XP_006357654.1| PREDICTED: uncharacterized protein LOC102599960 isoform X2 [Solanum 
tuberosum]
Length=638

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 142/226 (63%), Gaps = 21/226 (9%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            S+ N QLM S++V+A+++G+NS + KL  L  LSVF +++  SD    +SE FL SR+E+
Sbjct  414  SNNNNQLMKSALVIAQMIGRNSFIVKLNKLCSLSVFDSEIIHSDPSTNNSERFLLSREED  473

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL +A +KL+LI  + +K N +N T   +    QWVV   W+ CPIGM+PHAF S+GRLP
Sbjct  474  SLRKAAQKLELIMRRVVKGNNMNTTDTGS----QWVVAKTWKACPIGMLPHAFGSTGRLP  529

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMR------------  346
            ILD   +  EV+KSS+  E   +N+   KR A SAIECLD+ + KKMR            
Sbjct  530  ILDFVDDSAEVAKSSD-NEIPETNKCGCKREAASAIECLDDPNTKKMRKTEEPGDNQYTE  588

Query  345  -AETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
              E E+ H  +D    G +G LMI G WKKV+ +EL+ IA++V++ 
Sbjct  589  NMEIENGH--NDVPLEGSKGQLMIDGVWKKVSIEELRDIAAAVKIF  632



>ref|XP_010323905.1| PREDICTED: uncharacterized protein LOC101262228 isoform X1 [Solanum 
lycopersicum]
Length=647

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 138/224 (62%), Gaps = 20/224 (9%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            S+ N QLM S +V+A+++G+NS ++KL  L  LSVF +++  SD    +SESFL SR+E+
Sbjct  426  SNNNNQLMKSGLVIAQMIGRNSFIDKLNKLCSLSVFDSEIIHSDPSTNNSESFLLSREED  485

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL +A +KL+LI  + +K NK+N T   +    QWVV   W+ CPIGM+PHAF S+GRLP
Sbjct  486  SLRKAAQKLELIMRRVVKGNKMNTTDTGS----QWVVAKTWKACPIGMLPHAFGSTGRLP  541

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL---  319
            ILD   +  EV+KSS+  E   +N+   KR A SA ECL+    KKMR   E        
Sbjct  542  ILDFVDDSAEVAKSSD-NEIPETNKCGCKREAASANECLN---PKKMRKTEEPGDNQYTE  597

Query  318  --------DDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
                    +D    G +G LMI G WKKV+ +EL+ IA++V++ 
Sbjct  598  NMEIGNGHNDVPLEGSKGHLMIDGVWKKVSIEELRDIAAAVKIF  641



>ref|XP_004243580.1| PREDICTED: uncharacterized protein LOC101262228 isoform X2 [Solanum 
lycopersicum]
Length=642

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 138/224 (62%), Gaps = 20/224 (9%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            S+ N QLM S +V+A+++G+NS ++KL  L  LSVF +++  SD    +SESFL SR+E+
Sbjct  421  SNNNNQLMKSGLVIAQMIGRNSFIDKLNKLCSLSVFDSEIIHSDPSTNNSESFLLSREED  480

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL +A +KL+LI  + +K NK+N T   +    QWVV   W+ CPIGM+PHAF S+GRLP
Sbjct  481  SLRKAAQKLELIMRRVVKGNKMNTTDTGS----QWVVAKTWKACPIGMLPHAFGSTGRLP  536

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL---  319
            ILD   +  EV+KSS+  E   +N+   KR A SA ECL+    KKMR   E        
Sbjct  537  ILDFVDDSAEVAKSSD-NEIPETNKCGCKREAASANECLN---PKKMRKTEEPGDNQYTE  592

Query  318  --------DDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
                    +D    G +G LMI G WKKV+ +EL+ IA++V++ 
Sbjct  593  NMEIGNGHNDVPLEGSKGHLMIDGVWKKVSIEELRDIAAAVKIF  636



>ref|XP_002314010.1| las1-like family protein [Populus trichocarpa]
 gb|EEE87965.1| las1-like family protein [Populus trichocarpa]
Length=617

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 135/223 (61%), Gaps = 11/223 (5%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++ LA+LMG +S+++KLK LSLL++   +V +  SP +   SFL++Q++S
Sbjct  396  SYGNKQLMGSALHLAQLMGDSSVMDKLKKLSLLALSDPEVTQEKSPPLSLNSFLTQQDQS  455

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + QA KKL  +KL   KS    +T    G   +W+V  +W PCPIGM+P    SSG LP+
Sbjct  456  IHQATKKLDFVKLCRTKSKVAKRTDGDVGSSGRWIVAKSWNPCPIGMLPRDLGSSGCLPV  515

Query  486  LDCNANCTEVSKSSNPKECQLSNENH-------SKRVAESAIECLDNSHHKKMRAETESS  328
            LDC+ +  +   +S  K+     + +       SKR A+S I  LD +  KKMR ET  S
Sbjct  516  LDCDDDGKKSVHASERKQIWELKQYYTSVERTGSKREADSDIYLLDKASVKKMR-ETADS  574

Query  327  HELDDTS---AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             E +  +   +   +GCLMI G WKKV  +EL AI S VR+LV
Sbjct  575  FESEGENVLLSKDDKGCLMINGVWKKVGEEELLAIMSDVRILV  617



>ref|XP_011036402.1| PREDICTED: uncharacterized protein LOC105133938 [Populus euphratica]
Length=634

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 134/236 (57%), Gaps = 24/236 (10%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++ LARLMG +S+++KLK LSLL++   DV +  SP +   SFL++Q++S
Sbjct  400  SYGNKQLMGSALHLARLMGDSSVIDKLKKLSLLALSDPDVTQEKSPPLSLNSFLTQQDQS  459

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + QA KKL  +KL   KS    +T    G   +WVV  +W PCPIGM+P    SSG LP+
Sbjct  460  IHQATKKLDFVKLCRTKSKVAKRTDGDVGSSGRWVVAKSWNPCPIGMLPRDLGSSGCLPV  519

Query  486  LDCN------ANCTEVSKSSNPKECQLS--------------NENHSKRVAESAIECLDN  367
            LDC+       + +E  +    K+C +                   SKR A S I  LD 
Sbjct  520  LDCDDDGKKPVHASERKQIWEQKQCSIREPGVDIPLSDYTGVERTGSKREAGSDIYLLDK  579

Query  366  SHHKKMRAETESSHELDDTS---AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            S  KKMR ET  S E +  +   +   +GCLMI G WKK+  +EL AI S VR+LV
Sbjct  580  SSVKKMR-ETADSFESEGENLLLSKDDQGCLMINGVWKKIGEEELLAIMSDVRILV  634



>ref|XP_009762963.1| PREDICTED: uncharacterized protein LOC104214933, partial [Nicotiana 
sylvestris]
Length=645

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 19/227 (8%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFL-SRQEE  670
            SH N QLM S +V+A++MG+NSL +KL  L  LSVF +++  SD     SESFL S+ E+
Sbjct  424  SHTNNQLMDSVLVIAQIMGRNSLFHKLNKLCSLSVFDSEIIHSDPSTSSSESFLLSKGED  483

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            SL QA +KL+LIK + +K N V KT + AG R  WVV + W+PCP GM+PH F S+GRLP
Sbjct  484  SLRQAAQKLELIKHQVVKGNNV-KTAD-AGSR--WVVAEAWKPCPTGMLPHTFGSTGRLP  539

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDN-SHHKKMRAETESS-----  328
            ILD   +  EV+KSS+  +   +++   KR A SAIECLD+  + KKMR   E       
Sbjct  540  ILDFVDDSAEVAKSSD-NDIPETDKCGCKRDASSAIECLDDHPNMKKMRKTEEPGDSNND  598

Query  327  -------HELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
                   ++ DD    G +G L+IGG W+KV+ +EL  IA +V++L+
Sbjct  599  RDFLSDKNDNDDMPLEGSKGHLLIGGVWRKVSKEELHDIARAVKILI  645



>ref|XP_008227626.1| PREDICTED: uncharacterized protein LOC103327116 [Prunus mume]
 ref|XP_008227627.1| PREDICTED: uncharacterized protein LOC103327116 [Prunus mume]
Length=640

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 124/215 (58%), Gaps = 10/215 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N QLM S++ LA+L G N LL KL  LS L     DV E D    HS +    ++ES+S
Sbjct  411  ANNQLMDSAVHLAQLTGDNYLLGKLNKLSSLVSSNLDVTEEDDSLKHSTNVFKNEDESIS  470

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL++IK + MKS  V +T   AG   +WV+  +W PCPIGM+P A  SSG LP+LD
Sbjct  471  EAAKKLEMIKQRKMKSKVVKRTDGDAGNTSRWVLAKSWNPCPIGMLPQAVGSSGCLPVLD  530

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE------SSHEL  319
             N    +VS+    KE    N+   KR A S I+ LDN   KK+R ETE      S H L
Sbjct  531  FNTAPEKVSQLLGRKENWELNQCSGKREASSDIQLLDNRCVKKLR-ETEDGCVSDSEHVL  589

Query  318  DDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRM  214
               S   + G LMIGG WKKV  +EL AI S+VR+
Sbjct  590  ---STEDVSGHLMIGGVWKKVGEEELLAIKSAVRI  621



>ref|XP_007040711.1| Las1-like family protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY25212.1| Las1-like family protein, putative isoform 2, partial [Theobroma 
cacao]
Length=454

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFG-ADVNESDSPNVHSESFLSRQEE  670
            + GNK LM S++ LA+L+G + L+ KL  L  L +    D+ E+ S  +     + +++E
Sbjct  243  AFGNKHLMDSALHLAQLVGNSVLMEKLNKLRSLGLSSTGDIGENSSLEISKT--VRQEQE  300

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            S +QA KKL+L+KL+ MKS  V KT +      +WVV  +W PCP+GM+P A  SSGR+P
Sbjct  301  SANQAAKKLELVKLRRMKSTFV-KTADDVRNSNRWVVAKSWNPCPLGMLPRALGSSGRMP  359

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL--D  316
            +LDC+ +C   ++    KE +  N    KR A   I+ LD S  KK++ ET  +HE   +
Sbjct  360  VLDCHNDCQRDTELVEGKENRELNPCSGKRKASDDIQLLDLSSPKKVK-ETIGNHESGGE  418

Query  315  DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            D S+    G LM+ G WKKV   ELQ+I+S+VR+LV
Sbjct  419  DVSSPDTSGLLMMDGVWKKVAQTELQSISSAVRILV  454



>ref|XP_008347960.1| PREDICTED: uncharacterized protein LOC103411083 [Malus domestica]
Length=220

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 118/211 (56%), Gaps = 4/211 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LARL G + L+ KL  LS      +D  E ++  ++S     +QEES+S
Sbjct  14   ANKKLMDSAAHLARLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINSTDQFKKQEESIS  73

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V    +      +WV+  +W PCPIGM+P A   SG LP+LD
Sbjct  74   HAAEKLELIKRRIRKSKAVKTADDDVRNTNRWVLAKSWNPCPIGMLPRAVGPSGCLPVLD  133

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA +E     D  S  
Sbjct  134  VNNVPEKVPEVLGRKELWELNQCSFKR-PSSEMQLLDNPCVKKMRATSEGE---DVLSPE  189

Query  300  GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++G LMIGG WKKV  +EL AI S+VRML+
Sbjct  190  DVDGHLMIGGAWKKVGEEELLAIKSAVRMLI  220



>ref|XP_010271772.1| PREDICTED: uncharacterized protein LOC104607775 isoform X2 [Nelumbo 
nucifera]
Length=639

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 131/221 (59%), Gaps = 11/221 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GN  L  S+++LA ++G +SL+ +LK L LL +   D  + +S ++  E+FL +QEE + 
Sbjct  420  GNSLLTDSALILAEIIGNDSLVEQLKKLLLLRLPDFDFTDENSSSLDPENFLLQQEEFIV  479

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQ---WVVTDNWRPCPIGMIPHAFSSSGRLP  490
            QA  KL+L+K++  KS  VN T  + G+ ++   W +  +W PCPIGM+PHA SSSG LP
Sbjct  480  QAAAKLKLLKIQQKKSKMVNSTPINTGMEKKTNTWTLVKSWNPCPIGMLPHALSSSGVLP  539

Query  489  ILDCN----ANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHE  322
            +LD         + V      + C+L N +  KR A   +E L+N++  K   ++     
Sbjct  540  VLDSTNDHKVQDSLVGSFEEKENCEL-NRSIGKRDASCGVESLENTNAMKKMKQSVDDVG  598

Query  321  LD---DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            LD   D S+ GI G L+I G WKKV  +ELQAI S++R+LV
Sbjct  599  LDGQSDLSSGGITGRLLIDGFWKKVGEEELQAIGSAIRILV  639



>ref|XP_010271771.1| PREDICTED: uncharacterized protein LOC104607775 isoform X1 [Nelumbo 
nucifera]
Length=640

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 131/221 (59%), Gaps = 11/221 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GN  L  S+++LA ++G +SL+ +LK L LL +   D  + +S ++  E+FL +QEE + 
Sbjct  421  GNSLLTDSALILAEIIGNDSLVEQLKKLLLLRLPDFDFTDENSSSLDPENFLLQQEEFIV  480

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQ---WVVTDNWRPCPIGMIPHAFSSSGRLP  490
            QA  KL+L+K++  KS  VN T  + G+ ++   W +  +W PCPIGM+PHA SSSG LP
Sbjct  481  QAAAKLKLLKIQQKKSKMVNSTPINTGMEKKTNTWTLVKSWNPCPIGMLPHALSSSGVLP  540

Query  489  ILDCN----ANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHE  322
            +LD         + V      + C+L N +  KR A   +E L+N++  K   ++     
Sbjct  541  VLDSTNDHKVQDSLVGSFEEKENCEL-NRSIGKRDASCGVESLENTNAMKKMKQSVDDVG  599

Query  321  LD---DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            LD   D S+ GI G L+I G WKKV  +ELQAI S++R+LV
Sbjct  600  LDGQSDLSSGGITGRLLIDGFWKKVGEEELQAIGSAIRILV  640



>ref|XP_010271773.1| PREDICTED: uncharacterized protein LOC104607775 isoform X3 [Nelumbo 
nucifera]
Length=612

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 131/221 (59%), Gaps = 11/221 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GN  L  S+++LA ++G +SL+ +LK L LL +   D  + +S ++  E+FL +QEE + 
Sbjct  393  GNSLLTDSALILAEIIGNDSLVEQLKKLLLLRLPDFDFTDENSSSLDPENFLLQQEEFIV  452

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQ---WVVTDNWRPCPIGMIPHAFSSSGRLP  490
            QA  KL+L+K++  KS  VN T  + G+ ++   W +  +W PCPIGM+PHA SSSG LP
Sbjct  453  QAAAKLKLLKIQQKKSKMVNSTPINTGMEKKTNTWTLVKSWNPCPIGMLPHALSSSGVLP  512

Query  489  ILDCN----ANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHE  322
            +LD         + V      + C+L N +  KR A   +E L+N++  K   ++     
Sbjct  513  VLDSTNDHKVQDSLVGSFEEKENCEL-NRSIGKRDASCGVESLENTNAMKKMKQSVDDVG  571

Query  321  LD---DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            LD   D S+ GI G L+I G WKKV  +ELQAI S++R+LV
Sbjct  572  LDGQSDLSSGGITGRLLIDGFWKKVGEEELQAIGSAIRILV  612



>emb|CBI17902.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 123/218 (56%), Gaps = 8/218 (4%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NK +M S+++LA++   N ++ KL    LL +  +DV E  +P +  E  L  QE+++ Q
Sbjct  330  NKLIMGSALLLAQMAENNIMIEKLSRFCLLGLSKSDVTEETAPPLSFEKLLVHQEDAIRQ  389

Query  657  AGKKLQLIKLKSMKSNKVNKTQN-HAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            A +KL+L+K   +K + V  T N   G   +WVV  +W PCPIGM+P A  SSGRLP LD
Sbjct  390  AAEKLELVKRHRVKGSIVKTTTNGDDGNHSRWVVAKSWNPCPIGMLPRALGSSGRLPALD  449

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES----SHELDD  313
             N N     +SS  +E         KR A   IE LDNS  KKMR   E      H+ DD
Sbjct  450  HNDNQKMPPESSERRELWELKHCSRKREACFDIEMLDNSSVKKMRETVEDQTIEGHDSDD  509

Query  312  ---TSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               T   G++G L+I G WKKV  +EL AI S+VR+LV
Sbjct  510  KDVTLCEGVKGQLLINGVWKKVEREELLAIKSAVRILV  547



>ref|XP_007040710.1| Las1-like family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY25211.1| Las1-like family protein, putative isoform 1 [Theobroma cacao]
Length=624

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFG-ADVNESDSPNVHSESFLSRQEE  670
            + GNK LM S++ LA+L+G + L+ KL  L  L +    D+ E+ S  +     + +++E
Sbjct  413  AFGNKHLMDSALHLAQLVGNSVLMEKLNKLRSLGLSSTGDIGENSSLEISKT--VRQEQE  470

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            S +QA KKL+L+KL+ MKS  V KT +      +WVV  +W PCP+GM+P A  SSGR+P
Sbjct  471  SANQAAKKLELVKLRRMKSTFV-KTADDVRNSNRWVVAKSWNPCPLGMLPRALGSSGRMP  529

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL--D  316
            +LDC+ +C   ++    KE +  N    KR A   I+ LD S  KK++ ET  +HE   +
Sbjct  530  VLDCHNDCQRDTELVEGKENRELNPCSGKRKASDDIQLLDLSSPKKVK-ETIGNHESGGE  588

Query  315  DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            D S+    G LM+ G WKKV   ELQ+I+S+VR+LV
Sbjct  589  DVSSPDTSGLLMMDGVWKKVAQTELQSISSAVRILV  624



>ref|XP_010656891.1| PREDICTED: pre-rRNA-processing protein las1 [Vitis vinifera]
Length=624

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 123/218 (56%), Gaps = 8/218 (4%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NK +M S+++LA++   N ++ KL    LL +  +DV E  +P +  E  L  QE+++ Q
Sbjct  407  NKLIMGSALLLAQMAENNIMIEKLSRFCLLGLSKSDVTEETAPPLSFEKLLVHQEDAIRQ  466

Query  657  AGKKLQLIKLKSMKSNKVNKTQN-HAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            A +KL+L+K   +K + V  T N   G   +WVV  +W PCPIGM+P A  SSGRLP LD
Sbjct  467  AAEKLELVKRHRVKGSIVKTTTNGDDGNHSRWVVAKSWNPCPIGMLPRALGSSGRLPALD  526

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES----SHELDD  313
             N N     +SS  +E         KR A   IE LDNS  KKMR   E      H+ DD
Sbjct  527  HNDNQKMPPESSERRELWELKHCSRKREACFDIEMLDNSSVKKMRETVEDQTIEGHDSDD  586

Query  312  ---TSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               T   G++G L+I G WKKV  +EL AI S+VR+LV
Sbjct  587  KDVTLCEGVKGQLLINGVWKKVEREELLAIKSAVRILV  624



>ref|XP_007214532.1| hypothetical protein PRUPE_ppa003033mg [Prunus persica]
 gb|EMJ15731.1| hypothetical protein PRUPE_ppa003033mg [Prunus persica]
Length=610

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 122/215 (57%), Gaps = 10/215 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N QLM S++ LA+L G N LL KL  LS L     DV E D+   HS +    ++ES+S
Sbjct  400  ANNQLMDSAVHLAQLTGDNYLLGKLNKLSSLVSSNLDVTEEDNSLKHSTNVFKNEDESIS  459

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL++IK + MKS  V  T   AG   +WV+  +W PCPIGM+P A  SSG LP+LD
Sbjct  460  EASKKLEMIKQRKMKSKVVKGTDGDAGNTNRWVLAKSWNPCPIGMLPRAVGSSGCLPVLD  519

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE------SSHEL  319
             +    +VS+    KE    N+   KR A S I+ LDN   KK+R ETE      S H L
Sbjct  520  FDTVPEKVSQLLGRKENWELNQCSGKREASSDIQLLDNRCVKKLR-ETEDGCVSDSEHVL  578

Query  318  DDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRM  214
               S   + G LMIGG WKKV  +EL AI S+  M
Sbjct  579  ---STEDVSGHLMIGGVWKKVGEEELLAIKSACTM  610



>gb|ABK93614.1| unknown [Populus trichocarpa]
Length=311

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 123/230 (53%), Gaps = 18/230 (8%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++ LA+LMG  S++ KLK LS L +   DV +  S      + L +Q+ES
Sbjct  83   SNGNKQLMDSALHLAQLMGDTSVMGKLKKLSSLVLSDPDVTQEKSSLPSLNNLLIQQDES  142

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + QA KKL+ +K    KS  V +T    G    W V  +W PCPIGM+P    SSG LP+
Sbjct  143  IHQATKKLEFVKFCRTKSKAVKRTDGEVGSSGGWAVAKSWNPCPIGMLPRDLGSSGHLPV  202

Query  486  LDCNANCTEVSKSSNPKE-----------CQLS---NENHSKRVAESAIECLDNSHHKKM  349
            LDC  +  +   SS  K+            + S       SKR A   I  LD S  KKM
Sbjct  203  LDCADDGKKPVHSSEWKQSWELKQGSSGDIRFSYGVERTSSKREAGCDIYLLDKSSAKKM  262

Query  348  RAETESSHELD--DTSAAGIE-GCLMIGGEWKKVTADELQAIASSVRMLV  208
            R ET  S E D  +   +G + GCLMI G WKK+  +EL  I S VR+LV
Sbjct  263  R-ETADSFESDCENVLLSGDDKGCLMINGVWKKIGEEELLTIMSDVRILV  311



>ref|XP_011082168.1| PREDICTED: uncharacterized protein LOC105164994 [Sesamum indicum]
Length=626

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 129/214 (60%), Gaps = 8/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GN++LM +++ LA+  G  SLL+KLK L+LL +  ++ N   S N   E+ LS +E S+ 
Sbjct  418  GNRKLMGAALTLAQQTGDRSLLHKLKKLALLDLSTSEANSVYSSN---ETILSGEEYSIR  474

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +K +LI+   M+S  +   Q+    + +W V  +W PCPIGM+PH    SGRLP+LD
Sbjct  475  QAEEKFELIRQFRMQSKHIKPKQSAMETKSKWAVAKSWNPCPIGMLPHTVGFSGRLPVLD  534

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESS---HELDDT  310
                CTE +  S+ KE +  N    KR AE+ IE   N+  KKM+ ETE     H   D 
Sbjct  535  RVNECTEAATLSDSKENRQLNRC-GKRDAETDIEEKANTSVKKMK-ETEEDHVPHYQGDI  592

Query  309  SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            S+ G++G LMI G WK+V  +EL A+ S+VR+LV
Sbjct  593  SSQGVKGHLMIDGVWKEVGEEELLALTSAVRLLV  626



>ref|XP_008357643.1| PREDICTED: uncharacterized protein LOC103421394 isoform X3 [Malus 
domestica]
Length=501

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 117/211 (55%), Gaps = 4/211 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA L G + L+ KL  LS      +D  E ++  ++S     +QEES+S
Sbjct  295  ANKKLMDSAAHLAXLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINSTDQFKKQEESIS  354

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V    +      +WV+  +W PCPIGM+P A   SG LP+LD
Sbjct  355  HAAEKLELIKRRIRKSKAVKTADDDVXNTNRWVLAKSWNPCPIGMLPRAVGPSGCLPVLD  414

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA +E     D  S  
Sbjct  415  VNNVPEKVPEVLGRKELWELNQCSXKR-PSSEMQLLDNPCVKKMRATSEGE---DVLSPE  470

Query  300  GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++G LMIGG WKKV  +EL AI S+VRML+
Sbjct  471  DVDGHLMIGGAWKKVGEEELLAIKSAVRMLI  501



>ref|XP_009353741.1| PREDICTED: uncharacterized protein LOC103944976 isoform X2 [Pyrus 
x bretschneideri]
Length=647

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 127/213 (60%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+L  S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  437  ANKKLTDSAAHLAQLAGDSCLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  496

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS    +     G   +WV+  +W PCPIGM+P A  SSGRLP+LD
Sbjct  497  QAAEKLELIKRRIVKSKVAKRIDADVGDSDRWVLAKSWNPCPIGMLPRAVGSSGRLPVLD  556

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  557  VNVP-EKVPELLGRKEKWELNQCSVKR-PSSDMQLLDNPCVKKMRAAVDGSASEGEDVSS  614

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  615  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  647



>ref|XP_009353740.1| PREDICTED: uncharacterized protein LOC103944976 isoform X1 [Pyrus 
x bretschneideri]
Length=659

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 127/213 (60%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+L  S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  449  ANKKLTDSAAHLAQLAGDSCLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  508

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS    +     G   +WV+  +W PCPIGM+P A  SSGRLP+LD
Sbjct  509  QAAEKLELIKRRIVKSKVAKRIDADVGDSDRWVLAKSWNPCPIGMLPRAVGSSGRLPVLD  568

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  569  VNVP-EKVPELLGRKEKWELNQCSVKR-PSSDMQLLDNPCVKKMRAAVDGSASEGEDVSS  626

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  627  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  659



>gb|KJB21154.1| hypothetical protein B456_003G185300 [Gossypium raimondii]
Length=618

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            N  LM S++ +A+L+G + L+ KL     L +   +V E ++ N  +   +S++EE L+Q
Sbjct  409  NNHLMDSALHIAQLVGNSVLMEKLNKFRSLGLSNTEVTEENTSN-ETWGIVSQEEEYLNQ  467

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL+++KL+  KS  V KT +      +WVV  +W PCP+GM+P    SSGR+P+LDC
Sbjct  468  AAKKLEVVKLRRTKSTAV-KTADDVRNSNRWVVAKSWNPCPLGMLPRTLGSSGRIPLLDC  526

Query  477  NANC---TEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL--DD  313
             ++C   TEV +  N +E    N  + KR     I+ ++ S  KK++   E+ HE   + 
Sbjct  527  GSDCQKDTEVMEGKNEREL---NRRNGKREGSDDIQLMNFSSPKKLKETVENKHEQSSEG  583

Query  312  TSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             S++G    LM+ G WK+V   E++AIAS+VR+LV
Sbjct  584  VSSSGTCRHLMMDGIWKEVGETEVEAIASAVRILV  618



>ref|XP_002298459.2| las1-like family protein [Populus trichocarpa]
 gb|EEE83264.2| las1-like family protein [Populus trichocarpa]
Length=626

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 123/230 (53%), Gaps = 18/230 (8%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++ LA+LMG  S++ KLK LS L +   DV +  S      + L +Q+ES
Sbjct  398  SNGNKQLMDSALHLAQLMGDTSVMGKLKKLSSLVLSDPDVTQEKSSLPSLNNLLIQQDES  457

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + QA KKL+ +K    KS  V +T    G    W V  +W PCPIGM+P    SSG LP+
Sbjct  458  IHQATKKLEFVKFCRTKSKAVKRTDGEVGSSGGWAVAKSWNPCPIGMLPRDLGSSGHLPV  517

Query  486  LDCNANCTEVSKSSNPKE-----------CQLS---NENHSKRVAESAIECLDNSHHKKM  349
            LDC  +  +   SS  K+            + S       SKR A   I  LD S  KKM
Sbjct  518  LDCADDGKKPVHSSEWKQSWELKQGSSGDIRFSYGVERTSSKREAGCDIYLLDKSSAKKM  577

Query  348  RAETESSHELD--DTSAAGIE-GCLMIGGEWKKVTADELQAIASSVRMLV  208
            R ET  S E D  +   +G + GCLMI G WKK+  +EL  I S VR+LV
Sbjct  578  R-ETADSFESDCENVLLSGDDKGCLMINGVWKKIGEEELLTIMSDVRILV  626



>gb|KJB21153.1| hypothetical protein B456_003G185300 [Gossypium raimondii]
Length=619

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 128/215 (60%), Gaps = 10/215 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            N  LM S++ +A+L+G + L+ KL     L +   +V E ++ N  +   +S++EE L+Q
Sbjct  410  NNHLMDSALHIAQLVGNSVLMEKLNKFRSLGLSNTEVTEENTSN-ETWGIVSQEEEYLNQ  468

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL+++KL+  KS  V KT +      +WVV  +W PCP+GM+P    SSGR+P+LDC
Sbjct  469  AAKKLEVVKLRRTKSTAV-KTADDVRNSNRWVVAKSWNPCPLGMLPRTLGSSGRIPLLDC  527

Query  477  NANC---TEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL--DD  313
             ++C   TEV +  N +E    N  + KR     I+ ++ S  KK++   E+ HE   + 
Sbjct  528  GSDCQKDTEVMEGKNEREL---NRRNGKREGSDDIQLMNFSSPKKLKETVENKHEQSSEG  584

Query  312  TSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             S++G    LM+ G WK+V   E++AIAS+VR+LV
Sbjct  585  VSSSGTCRHLMMDGIWKEVGETEVEAIASAVRILV  619



>ref|XP_008357641.1| PREDICTED: uncharacterized protein LOC103421394 isoform X1 [Malus 
domestica]
Length=618

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 117/211 (55%), Gaps = 4/211 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA L G + L+ KL  LS      +D  E ++  ++S     +QEES+S
Sbjct  412  ANKKLMDSAAHLAXLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINSTDQFKKQEESIS  471

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V    +      +WV+  +W PCPIGM+P A   SG LP+LD
Sbjct  472  HAAEKLELIKRRIRKSKAVKTADDDVXNTNRWVLAKSWNPCPIGMLPRAVGPSGCLPVLD  531

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA +E     D  S  
Sbjct  532  VNNVPEKVPEVLGRKELWELNQCSXKR-PSSEMQLLDNPCVKKMRATSEGE---DVLSPE  587

Query  300  GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++G LMIGG WKKV  +EL AI S+VRML+
Sbjct  588  DVDGHLMIGGAWKKVGEEELLAIKSAVRMLI  618



>ref|XP_008357642.1| PREDICTED: uncharacterized protein LOC103421394 isoform X2 [Malus 
domestica]
Length=606

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 117/211 (55%), Gaps = 4/211 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA L G + L+ KL  LS      +D  E ++  ++S     +QEES+S
Sbjct  400  ANKKLMDSAAHLAXLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINSTDQFKKQEESIS  459

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V    +      +WV+  +W PCPIGM+P A   SG LP+LD
Sbjct  460  HAAEKLELIKRRIRKSKAVKTADDDVXNTNRWVLAKSWNPCPIGMLPRAVGPSGCLPVLD  519

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
             N    +V +    KE    N+   KR   S ++ LDN   KKMRA +E     D  S  
Sbjct  520  VNNVPEKVPEVLGRKELWELNQCSXKR-PSSEMQLLDNPCVKKMRATSEGE---DVLSPE  575

Query  300  GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++G LMIGG WKKV  +EL AI S+VRML+
Sbjct  576  DVDGHLMIGGAWKKVGEEELLAIKSAVRMLI  606



>ref|XP_008339382.1| PREDICTED: uncharacterized protein LOC103402411 isoform X4 [Malus 
domestica]
Length=596

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  386  ANKKLMDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  445

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS  V       G   +WV+  +W  CPIGM+P A  SSGRLP+LD
Sbjct  446  QAAEKLELIKRRIVKSKVVXXIDADVGDTNRWVLAKSWNXCPIGMLPRAVGSSGRLPVLD  505

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
                  +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  506  VXVP-EKVPELLGRKEKWELNQCSVKR-PXSDMQLLDNPCVKKMRATVDGSASEGEDVSS  563

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  564  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  596



>ref|XP_008339381.1| PREDICTED: uncharacterized protein LOC103402411 isoform X3 [Malus 
domestica]
Length=635

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  425  ANKKLMDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  484

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS  V       G   +WV+  +W  CPIGM+P A  SSGRLP+LD
Sbjct  485  QAAEKLELIKRRIVKSKVVXXIDADVGDTNRWVLAKSWNXCPIGMLPRAVGSSGRLPVLD  544

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
                  +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  545  VXVP-EKVPELLGRKEKWELNQCSVKR-PXSDMQLLDNPCVKKMRATVDGSASEGEDVSS  602

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  603  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  635



>ref|XP_008339380.1| PREDICTED: uncharacterized protein LOC103402411 isoform X2 [Malus 
domestica]
Length=638

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  428  ANKKLMDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  487

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS  V       G   +WV+  +W  CPIGM+P A  SSGRLP+LD
Sbjct  488  QAAEKLELIKRRIVKSKVVXXIDADVGDTNRWVLAKSWNXCPIGMLPRAVGSSGRLPVLD  547

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
                  +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  548  VXVP-EKVPELLGRKEKWELNQCSVKR-PXSDMQLLDNPCVKKMRATVDGSASEGEDVSS  605

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  606  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  638



>ref|XP_008449642.1| PREDICTED: pre-rRNA-processing protein las1 [Cucumis melo]
Length=607

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 3/213 (1%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NK+L+ S+  LA+L+  +SL+ KL  LS ++V  + + + ++PN  +      Q ESL +
Sbjct  395  NKRLLDSATDLAQLLDDDSLVKKLNKLSFVNVPISPIPDGENPNQTASENSFNQAESLRE  454

Query  657  AGKKLQLIKLKSMKSNKV-NKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            A +KL++IKL+  K+N   N    + G   +W V  +W PCPIGM+P +   SGRL +LD
Sbjct  455  ASRKLEMIKLRKRKNNLASNPVDGNVGCSSRWTVVSSWTPCPIGMLPRSIGCSGRLSVLD  514

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSH-ELDDT-S  307
             N      S+    K+ +  N +  KR A S I+ LD+S  KKM+   + S  E +D  S
Sbjct  515  LNPENEPASEEPRSKDNRALNNSSHKREASSDIQHLDSSIVKKMKETNDKSQFETEDVES  574

Query  306  AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
              GIEG L+IGG WKKV  +EL AI SSVR+L+
Sbjct  575  PEGIEGRLLIGGIWKKVGEEELSAIQSSVRILI  607



>ref|XP_008339379.1| PREDICTED: uncharacterized protein LOC103402411 isoform X1 [Malus 
domestica]
Length=650

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             NK+LM S+  LA+L G + L+ KL  LS      +D  E D+ +++S +   +QEES+S
Sbjct  440  ANKKLMDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEDTVHINSNNQFKKQEESIS  499

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA +KL+LIK + +KS  V       G   +WV+  +W  CPIGM+P A  SSGRLP+LD
Sbjct  500  QAAEKLELIKRRIVKSKVVXXIDADVGDTNRWVLAKSWNXCPIGMLPRAVGSSGRLPVLD  559

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE-SSHELDDTSA  304
                  +V +    KE    N+   KR   S ++ LDN   KKMRA  + S+ E +D S+
Sbjct  560  VXVP-EKVPELLGRKEKWELNQCSVKR-PXSDMQLLDNPCVKKMRATVDGSASEGEDVSS  617

Query  303  -AGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  618  WEDVDGHLMIGGVWKKVGEEELLAIKSAVRILI  650



>ref|XP_007198899.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica]
 gb|EMJ00098.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica]
Length=611

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 120/214 (56%), Gaps = 4/214 (2%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N QLM S+I LA+L G N LL KL  LS L    +DV E      HS +   +++ES+S
Sbjct  399  ANNQLMDSAIDLAQLTGDNYLLGKLNKLSSLVSSNSDVTEEGDSLKHSNNVFKKKDESMS  458

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL++IK   +K   V +T   A    +WV+  +W PCPIGM+P A   SG LP+LD
Sbjct  459  EAAKKLEMIKCHKIKKKVVKRTDADARNTNRWVLAKSWNPCPIGMLPRAVGFSGCLPVLD  518

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
             N    +VS+    KE    N+   KR A S +  LDN   KK+R ETE     D    +
Sbjct  519  FNIVPEKVSQLIGRKENWELNQCSGKREASSDLHLLDNQCVKKLR-ETEDGCVSDSEHVS  577

Query  300  GIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
             IE   G LMI G WK+V  +EL AI S++R+L+
Sbjct  578  SIEDVSGHLMIDGVWKRVGEEELLAIKSALRILI  611



>gb|KHG08373.1| Ribosomal biogenesis LAS1L [Gossypium arboreum]
Length=618

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 129/216 (60%), Gaps = 13/216 (6%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESF-LSRQEESLS  661
            N  LM S++ +A+L+G + L+ KL  L  L +    V E ++ N   E + +  QEE L+
Sbjct  410  NNHLMDSALHIAQLIGNSVLMEKLNELHSLGLSNTAVTEENTSN---EIWGIVSQEEYLN  466

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA KKL+++KL+  KS  V KT +      +WVV  +W PCP+GM+P    SSGR+P+LD
Sbjct  467  QAAKKLEVVKLRRTKSTAV-KTADDVRNSNRWVVAKSWNPCPLGMLPRTLGSSGRVPLLD  525

Query  480  CNANC---TEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL--D  316
            C ++C   TEV ++ N +E    N  + KR     I+ ++ S  KK++   E+ HE   +
Sbjct  526  CGSDCQKDTEVMEAKNEREL---NRRNGKREGSDDIQLMNFSSPKKLKETVENKHEQSSE  582

Query  315  DTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
              S++G    LM+ G WK+V A E++AIAS+VR+LV
Sbjct  583  GVSSSGTCRHLMMDGVWKEVGATEVEAIASAVRLLV  618



>ref|XP_010031719.1| PREDICTED: uncharacterized protein LOC104421464 [Eucalyptus grandis]
 gb|KCW51086.1| hypothetical protein EUGRSUZ_J00691 [Eucalyptus grandis]
Length=627

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 124/214 (58%), Gaps = 9/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNKQLM S+  ++ ++G NSL+NKL  L+ +S+   DV    S    S +F + QE+ L 
Sbjct  420  GNKQLMDSAFQISEVIGNNSLVNKLNKLTSVSITTLDVINGSSCKTSSATF-AEQEDCLR  478

Query  660  QAGKKLQLIKLKSMK--SNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            QA +KL+L++L+ +K  ++ +  T  H   R  W +  +W PCPIG +P  F  SGRLPI
Sbjct  479  QAAQKLELVRLRRVKNKASSLTNTDGHNNCR--WAIAKSWNPCPIGTLPLDFGFSGRLPI  536

Query  486  LDC-NANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDT  310
            LDC      E  + S+ +E    ++   KR A    + L +S +KK R         D+ 
Sbjct  537  LDCKTGKAPEALERSSTREL---SQCPGKREASCDADSLRDSGNKKTREAVADCGLEDEG  593

Query  309  SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            ++ G  GCLM+GG WKKV  +EL+AI SS+R+LV
Sbjct  594  ASRGAGGCLMMGGVWKKVGLEELEAIKSSIRILV  627



>ref|XP_011024993.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105125999 
[Populus euphratica]
Length=625

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 121/232 (52%), Gaps = 20/232 (9%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++   +LMG  S++ KLK LS L +   DV +  S      + L +Q+ES
Sbjct  395  SNGNKQLMDSALHFVQLMGDTSVMGKLKELSSLVLSDPDVTQEKSSLPSLYNLLIQQDES  454

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + QA KKL+ +K    KS  V +T    G    W V  +W PCPIGM+P    SSG LP+
Sbjct  455  IHQATKKLEFVKFCRTKSKAVKRTGGEVGSSGGWAVEKSWNPCPIGMLPXDLGSSGHLPV  514

Query  486  LDCNANCTEVSKSSNPKE-----------CQLS-----NENHSKRVAESAIECLDNSHHK  355
            LDC  +  +   SS  K+            + S         SKR A   I  LD S  K
Sbjct  515  LDCADDGKKPVHSSEWKQSWELKQGSSGDIRFSYYPSIERTGSKREAGCDIYLLDKSSVK  574

Query  354  KMRAETESSHELD--DTSAAGIE-GCLMIGGEWKKVTADELQAIASSVRMLV  208
            KMR ET  S E +  +   +G + GCLMI G WKK+  +EL  I S VR+LV
Sbjct  575  KMR-ETADSFESNCKNVLLSGDDKGCLMINGVWKKIGEEELFTIMSDVRILV  625



>ref|XP_010097924.1| hypothetical protein L484_009358 [Morus notabilis]
 gb|EXB73280.1| hypothetical protein L484_009358 [Morus notabilis]
Length=683

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 123/215 (57%), Gaps = 7/215 (3%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK LM S++ + +L+G N L+ KL  LS L    +++ E  S   +S+S + R +ES+S
Sbjct  472  GNKHLMDSALYITQLIGCNHLMKKLNKLSSLVSSNSEIIEDKSSLFNSKSLIQR-DESIS  530

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            QA KKL+LIK   MK    N   +  G  R+W V+ +W PCPIGM+P++  SSG LP+LD
Sbjct  531  QAAKKLELIKHLRMKRKVANAADDDMGNSRRWAVSTSWIPCPIGMLPNSVGSSGCLPVLD  590

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHEL----DD  313
            C  +  + S++   +E  L    +S+ +  +    LD S  KK R   E   E     D 
Sbjct  591  CKGDQKKNSETQQARE-NLEFNCYSEAIGPTP-ALLDGSGVKKRRLTVEGDFESNRGEDV  648

Query  312  TSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            +   G++G LMIGG WK V  +++  I SSVR+LV
Sbjct  649  SILEGLDGQLMIGGVWKTVGEEDILDIKSSVRILV  683



>ref|XP_006470523.1| PREDICTED: uncharacterized protein LOC102625692 isoform X1 [Citrus 
sinensis]
Length=633

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 116/214 (54%), Gaps = 8/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E      +E + 
Sbjct  425  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCEDM----QEDIP  480

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   MK   V       G R +WV+  +W  CPIGM+PH   SSGRLPILD
Sbjct  481  KAAKKLEFVKRYKMKRKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPHDLGSSGRLPILD  540

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
            C+       +     E    N+   KR A   I+ LDNS  KKM+ ET    +L+    +
Sbjct  541  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIQLLDNSSIKKMK-ETVEVCQLNTDGIS  599

Query  300  GIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
              +   G LMIGG WKKV+  EL+ I S VR+L+
Sbjct  600  LFDDSIGHLMIGGVWKKVSEQELETIKSRVRILI  633



>ref|XP_006470524.1| PREDICTED: uncharacterized protein LOC102625692 isoform X2 [Citrus 
sinensis]
Length=605

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 116/214 (54%), Gaps = 8/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E      +E + 
Sbjct  397  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCEDM----QEDIP  452

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   MK   V       G R +WV+  +W  CPIGM+PH   SSGRLPILD
Sbjct  453  KAAKKLEFVKRYKMKRKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPHDLGSSGRLPILD  512

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
            C+       +     E    N+   KR A   I+ LDNS  KKM+ ET    +L+    +
Sbjct  513  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIQLLDNSSIKKMK-ETVEVCQLNTDGIS  571

Query  300  GIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
              +   G LMIGG WKKV+  EL+ I S VR+L+
Sbjct  572  LFDDSIGHLMIGGVWKKVSEQELETIKSRVRILI  605



>ref|XP_009355292.1| PREDICTED: uncharacterized protein LOC103946347 isoform X2 [Pyrus 
x bretschneideri]
Length=610

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 119/213 (56%), Gaps = 3/213 (1%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N +L+ S+  LA+L G + L+ KL  LS      +D  E ++  ++  +  + QEES+S
Sbjct  399  ANNKLVDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINLNNQFNEQEESIS  458

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V       G   +WV+  +W PCPIGM+P A  SSG LP+LD
Sbjct  459  HAVEKLELIKRRIRKSKAVKIADADVGNTNRWVLAKSWNPCPIGMLPRAVGSSGCLPVLD  518

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES--SHELDDTS  307
             N    +V +    KE    N+   KR   S ++ LDN   KKMR  ++S  S   D  S
Sbjct  519  VNNVPEKVPELLGRKELWELNQCSVKR-NSSEMQLLDNPCAKKMRVTSDSFASEGEDVLS  577

Query  306  AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  578  PEDVDGHLMIGGAWKKVGEEELLAIKSAVRILI  610



>ref|XP_009355290.1| PREDICTED: uncharacterized protein LOC103946347 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009355291.1| PREDICTED: uncharacterized protein LOC103946347 isoform X1 [Pyrus 
x bretschneideri]
Length=622

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 119/213 (56%), Gaps = 3/213 (1%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N +L+ S+  LA+L G + L+ KL  LS      +D  E ++  ++  +  + QEES+S
Sbjct  411  ANNKLVDSAAHLAQLTGDSFLVGKLHKLSSFVSSNSDGTEEEAVRINLNNQFNEQEESIS  470

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
             A +KL+LIK +  KS  V       G   +WV+  +W PCPIGM+P A  SSG LP+LD
Sbjct  471  HAVEKLELIKRRIRKSKAVKIADADVGNTNRWVLAKSWNPCPIGMLPRAVGSSGCLPVLD  530

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES--SHELDDTS  307
             N    +V +    KE    N+   KR   S ++ LDN   KKMR  ++S  S   D  S
Sbjct  531  VNNVPEKVPELLGRKELWELNQCSVKR-NSSEMQLLDNPCAKKMRVTSDSFASEGEDVLS  589

Query  306  AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
               ++G LMIGG WKKV  +EL AI S+VR+L+
Sbjct  590  PEDVDGHLMIGGAWKKVGEEELLAIKSAVRILI  622



>ref|XP_012065836.1| PREDICTED: uncharacterized protein LOC105628951 isoform X2 [Jatropha 
curcas]
Length=634

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 126/235 (54%), Gaps = 23/235 (10%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVF-GADVNESDSPNVHSESFLSRQEE  670
            S+GNKQLM S++ LA L+G N L+ KL  +S L +   AD  E+ S    S + L +Q+E
Sbjct  401  SYGNKQLMDSALHLAELIGNNLLIKKLSKVSFLGLSDSADTEENYSFKSFS-NMLVQQDE  459

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            S+ +A  KL+LIK    K   V      + +  +W V  +W PCPIGM+P    SSGRLP
Sbjct  460  SIHKAADKLELIKHCIAKRRIVKTLAGDSVIASRWTVAKSWNPCPIGMLPQDLGSSGRLP  519

Query  489  ILDCN------ANCTEVSKSSNPKECQLSNENHS--------------KRVAESAIECLD  370
            +LD +       +  E +++S  ++C  + E  S              KR A   I  LD
Sbjct  520  VLDQDNVDTKFVDSLERTQTSELRQCSDAEEPSSDIHCNKTDVEKASGKREACFDICLLD  579

Query  369  NSHHKKMRAETESSHELDDT-SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             S+ KK+R   ES    +D      +EGCL++ G WKK+  +EL AI SSVR+LV
Sbjct  580  RSNVKKIRVTRESGESDEDVLFPTDVEGCLIVNGVWKKIKEEELLAIKSSVRILV  634



>ref|XP_012065835.1| PREDICTED: uncharacterized protein LOC105628951 isoform X1 [Jatropha 
curcas]
 gb|KDP43177.1| hypothetical protein JCGZ_22729 [Jatropha curcas]
Length=662

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 126/235 (54%), Gaps = 23/235 (10%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVF-GADVNESDSPNVHSESFLSRQEE  670
            S+GNKQLM S++ LA L+G N L+ KL  +S L +   AD  E+ S    S + L +Q+E
Sbjct  429  SYGNKQLMDSALHLAELIGNNLLIKKLSKVSFLGLSDSADTEENYSFKSFS-NMLVQQDE  487

Query  669  SLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            S+ +A  KL+LIK    K   V      + +  +W V  +W PCPIGM+P    SSGRLP
Sbjct  488  SIHKAADKLELIKHCIAKRRIVKTLAGDSVIASRWTVAKSWNPCPIGMLPQDLGSSGRLP  547

Query  489  ILDCN------ANCTEVSKSSNPKECQLSNENHS--------------KRVAESAIECLD  370
            +LD +       +  E +++S  ++C  + E  S              KR A   I  LD
Sbjct  548  VLDQDNVDTKFVDSLERTQTSELRQCSDAEEPSSDIHCNKTDVEKASGKREACFDICLLD  607

Query  369  NSHHKKMRAETESSHELDDT-SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             S+ KK+R   ES    +D      +EGCL++ G WKK+  +EL AI SSVR+LV
Sbjct  608  RSNVKKIRVTRESGESDEDVLFPTDVEGCLIVNGVWKKIKEEELLAIKSSVRILV  662



>gb|KEH28372.1| Las1 family protein, putative [Medicago truncatula]
Length=490

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 127/218 (58%), Gaps = 10/218 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            +KQ+M S++ LA+L+   SLL K++ LS L +     N  D  ++ S   +S+ EES+ +
Sbjct  275  DKQVMDSALHLAQLIYDRSLLQKVQLLSGLVLSNVFDNADDQSSLLSPMNVSQFEESMRE  334

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL  +K + M++ K ++          W +  +W PCPIGM+P    SSG LP+LD 
Sbjct  335  AYKKLDFVKQQIMRNKKSSEMNCETEETEVWALAKSWNPCPIGMLPRVVGSSGCLPVLDV  394

Query  477  NANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAAG  298
              N  E +++S  KE     ++ +KR A S I+ LDNS  KKMR ETE   EL+D S+  
Sbjct  395  IDN-EEHNQASERKENWKLIKHSAKRDAPSDIQLLDNSTVKKMR-ETEEFGELNDESSME  452

Query  297  IE--------GCLMIGGEWKKVTADELQAIASSVRMLV  208
             +        G LM+GG WKKVT +EL +I SSVR+L+
Sbjct  453  EDESPTDEGKGYLMVGGIWKKVTEEELLSIQSSVRILI  490



>ref|XP_004140277.1| PREDICTED: pre-rRNA-processing protein las1 [Cucumis sativus]
Length=607

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 127/217 (59%), Gaps = 11/217 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHS---ESFLSRQEES  667
            NK+L+ S+  LA+L+  +SL+ KL  L  ++   + + + ++PN HS   +SF   Q ES
Sbjct  395  NKRLLDSATNLAQLLDDDSLVKKLNKLFFVNAPISSIPDEENPN-HSASEDSF--NQAES  451

Query  666  LSQAGKKLQLIKLKSMKSNKV-NKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            L +A +KL+ IKL+  K+N   N    + G   +W V  +W PCPIGM+P +   SGR  
Sbjct  452  LREASRKLETIKLRKRKNNLASNPVDGNVGGSSRWTVVSSWTPCPIGMLPRSIGCSGRPS  511

Query  489  ILDCNANCTEVSKSSNPKE-CQLSNENHSKRVAESAIECLDNSHHKKMRAETESSH-ELD  316
            +LD N      S+    KE C+L+N +  KR A S I  LDNS  KKM+   + S  E +
Sbjct  512  VLDLNPENEPTSEELRSKEKCELNNSSQ-KREASSDIHHLDNSIVKKMKDTNDKSQLETE  570

Query  315  DT-SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            D  S  GI+G L+IGG WK V  +EL AI S+VR+L+
Sbjct  571  DVESPEGIKGRLLIGGIWKNVGEEELSAIQSAVRILI  607



>gb|KGN48087.1| hypothetical protein Csa_6G430640 [Cucumis sativus]
Length=733

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 127/217 (59%), Gaps = 11/217 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHS---ESFLSRQEES  667
            NK+L+ S+  LA+L+  +SL+ KL  L  ++   + + + ++PN HS   +SF   Q ES
Sbjct  521  NKRLLDSATNLAQLLDDDSLVKKLNKLFFVNAPISSIPDEENPN-HSASEDSF--NQAES  577

Query  666  LSQAGKKLQLIKLKSMKSNKV-NKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
            L +A +KL+ IKL+  K+N   N    + G   +W V  +W PCPIGM+P +   SGR  
Sbjct  578  LREASRKLETIKLRKRKNNLASNPVDGNVGGSSRWTVVSSWTPCPIGMLPRSIGCSGRPS  637

Query  489  ILDCNANCTEVSKSSNPKE-CQLSNENHSKRVAESAIECLDNSHHKKMRAETESSH-ELD  316
            +LD N      S+    KE C+L+N +  KR A S I  LDNS  KKM+   + S  E +
Sbjct  638  VLDLNPENEPTSEELRSKEKCELNNSSQ-KREASSDIHHLDNSIVKKMKDTNDKSQLETE  696

Query  315  DT-SAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            D  S  GI+G L+IGG WK V  +EL AI S+VR+L+
Sbjct  697  DVESPEGIKGRLLIGGIWKNVGEEELSAIQSAVRILI  733



>ref|XP_011464875.1| PREDICTED: protein LAS1 isoform X2 [Fragaria vesca subsp. vesca]
Length=623

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 117/223 (52%), Gaps = 12/223 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N  LM S++ LA+L G   L+ KL  LS L     D  + ++    S S   +QE+S+S
Sbjct  401  ANNHLMKSALHLAKLTGDEYLVQKLNKLSFLVSSNLDAAKENTCLASSNSIFVQQEKSIS  460

Query  660  QAGKKLQLIKLKSMKSNKVNKTQN-HAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPIL  484
            QA KKL+LIK   MK   V  T++   G  ++WV+  +W  CPIGM+P A   SG LPIL
Sbjct  461  QAAKKLELIKRHQMKREAVKGTRDADVGSSKRWVMAKSWTRCPIGMLPCAVGHSGSLPIL  520

Query  483  DCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRA-----------ET  337
            D N    +  +     E    N    K+ A S ++  DN   KKMR            + 
Sbjct  521  DYNGASEQDPEVPGENEKWELNSCTGKKRANSDMQLFDNPCAKKMRGTVVDDYVSDMEDV  580

Query  336  ESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             SS E++  S+  + G LMIGG WKKV  +E+ AI S+VR+LV
Sbjct  581  LSSEEVNAMSSEDVCGHLMIGGVWKKVGEEEILAIKSAVRILV  623



>ref|XP_004299975.1| PREDICTED: uncharacterized protein LOC101296866 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=651

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 117/223 (52%), Gaps = 12/223 (5%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
             N  LM S++ LA+L G   L+ KL  LS L     D  + ++    S S   +QE+S+S
Sbjct  429  ANNHLMKSALHLAKLTGDEYLVQKLNKLSFLVSSNLDAAKENTCLASSNSIFVQQEKSIS  488

Query  660  QAGKKLQLIKLKSMKSNKVNKTQN-HAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPIL  484
            QA KKL+LIK   MK   V  T++   G  ++WV+  +W  CPIGM+P A   SG LPIL
Sbjct  489  QAAKKLELIKRHQMKREAVKGTRDADVGSSKRWVMAKSWTRCPIGMLPCAVGHSGSLPIL  548

Query  483  DCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRA-----------ET  337
            D N    +  +     E    N    K+ A S ++  DN   KKMR            + 
Sbjct  549  DYNGASEQDPEVPGENEKWELNSCTGKKRANSDMQLFDNPCAKKMRGTVVDDYVSDMEDV  608

Query  336  ESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             SS E++  S+  + G LMIGG WKKV  +E+ AI S+VR+LV
Sbjct  609  LSSEEVNAMSSEDVCGHLMIGGVWKKVGEEEILAIKSAVRILV  651



>ref|XP_003617221.1| LAS1-like protein [Medicago truncatula]
 gb|AET00180.1| Las1 family protein, putative [Medicago truncatula]
Length=603

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 127/218 (58%), Gaps = 10/218 (5%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            +KQ+M S++ LA+L+   SLL K++ LS L +     N  D  ++ S   +S+ EES+ +
Sbjct  388  DKQVMDSALHLAQLIYDRSLLQKVQLLSGLVLSNVFDNADDQSSLLSPMNVSQFEESMRE  447

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL  +K + M++ K ++          W +  +W PCPIGM+P    SSG LP+LD 
Sbjct  448  AYKKLDFVKQQIMRNKKSSEMNCETEETEVWALAKSWNPCPIGMLPRVVGSSGCLPVLDV  507

Query  477  NANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAAG  298
              N  E +++S  KE     ++ +KR A S I+ LDNS  KKMR ETE   EL+D S+  
Sbjct  508  IDN-EEHNQASERKENWKLIKHSAKRDAPSDIQLLDNSTVKKMR-ETEEFGELNDESSME  565

Query  297  IE--------GCLMIGGEWKKVTADELQAIASSVRMLV  208
             +        G LM+GG WKKVT +EL +I SSVR+L+
Sbjct  566  EDESPTDEGKGYLMVGGIWKKVTEEELLSIQSSVRILI  603



>gb|KHN38396.1| hypothetical protein glysoja_004061 [Glycine soja]
Length=295

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 119/228 (52%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQL+ S++ LA LM  + L+ K++  SL+S+   +  + +SP   S++   + EES+ +
Sbjct  69   NKQLLDSALQLAELMNDSYLMEKVQKFSLISLSNLESADDESPLSTSKNIF-QFEESMLE  127

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD-  481
            A KKL+L+K + MK+ K+          + W +  +W PCPIGM+P A  SSG LP+L+ 
Sbjct  128  AAKKLELVKQQIMKNKKLMAMDCDTKKSQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLNI  187

Query  480  -----------CNANCTEVSKSSNPKECQLSNENH------SKRVAESAIECLDNSHHKK  352
                       C     ++             EN       +KR A   +  LDNS  KK
Sbjct  188  VDGEKQNQVSPCCLPVVDIIDDEKQNRVSEKEENWKLTPHGAKRDATLDLLQLDNSTVKK  247

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   E     ++    G +GCL++GG WKK+T +EL  I SSVR+LV
Sbjct  248  MRETKEFGELNNELPLQGEKGCLVVGGVWKKLTEEELLVIESSVRILV  295



>ref|XP_002530843.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31556.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 117/231 (51%), Gaps = 18/231 (8%)
 Frame = -3

Query  846  SHGNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEES  667
            S+GNKQLM S++ LA+L+  +  + KL  LSLL++  +DV E +     S + L +Q++S
Sbjct  359  SYGNKQLMDSTMHLAQLVVNSPSMEKLTKLSLLNLSDSDVAEENFSLKSSSNLLVQQDKS  418

Query  666  LSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            + +A  KL+L+K+   K   V           +W V  +W PCPIGM+P    SSG LP 
Sbjct  419  IHEAADKLKLVKISLAKRRIVRTADGDLKGGDRWAVAKSWNPCPIGMLPRDLGSSGCLPD  478

Query  486  LDCNA----------------NCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHK  355
            LD +                  C  V + S+      S    SKR A   I  LD S  K
Sbjct  479  LDHHYVDKELVNLSGRTWELKQCGGVEEPSSDIHSNNSQVERSKREASYDICLLDRSSVK  538

Query  354  KMRAETES--SHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            KMR   ES  S   D      I+GCLMI G WKK+  +EL AI S +R+LV
Sbjct  539  KMREMVESYESGGKDALLPTDIKGCLMINGVWKKIEEEELLAIKSGIRILV  589



>ref|XP_006575620.1| PREDICTED: uncharacterized protein LOC100818525 isoform X2 [Glycine 
max]
Length=609

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 120/228 (53%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQL+ S++ LA LM  + L+ K++  SL+S+   +  + +SP + S++   + EES+ +
Sbjct  383  NKQLLDSALQLAELMNDSYLMEKVQKFSLISLSNLESADDESPLLTSKNIF-QFEESMLE  441

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD-  481
            A KKL+L+K + MK+ K+          + W +  +W PCPIGM+P A  SSG LP+L+ 
Sbjct  442  AAKKLELVKQQIMKNKKLMAMDCDTKKSQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLNI  501

Query  480  -----------CNANCTEVSKSSNPKECQLSNENH------SKRVAESAIECLDNSHHKK  352
                       C     ++             EN       +KR A   +  LDNS  KK
Sbjct  502  VDGEKQNQVSPCCLPVVDIIDDEKQNRVSEKEENWKLTPHGAKRDATLDLLQLDNSTVKK  561

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   E     ++    G +GCL++GG WKK+T +EL  I SSVR+LV
Sbjct  562  MRETKEFGELNNELPLQGEKGCLVVGGVWKKLTEEELLVIESSVRILV  609



>ref|XP_006575619.1| PREDICTED: uncharacterized protein LOC100818525 isoform X1 [Glycine 
max]
Length=637

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 120/228 (53%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQL+ S++ LA LM  + L+ K++  SL+S+   +  + +SP + S++   + EES+ +
Sbjct  411  NKQLLDSALQLAELMNDSYLMEKVQKFSLISLSNLESADDESPLLTSKNIF-QFEESMLE  469

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD-  481
            A KKL+L+K + MK+ K+          + W +  +W PCPIGM+P A  SSG LP+L+ 
Sbjct  470  AAKKLELVKQQIMKNKKLMAMDCDTKKSQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLNI  529

Query  480  -----------CNANCTEVSKSSNPKECQLSNENH------SKRVAESAIECLDNSHHKK  352
                       C     ++             EN       +KR A   +  LDNS  KK
Sbjct  530  VDGEKQNQVSPCCLPVVDIIDDEKQNRVSEKEENWKLTPHGAKRDATLDLLQLDNSTVKK  589

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   E     ++    G +GCL++GG WKK+T +EL  I SSVR+LV
Sbjct  590  MRETKEFGELNNELPLQGEKGCLVVGGVWKKLTEEELLVIESSVRILV  637



>ref|XP_006446315.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 ref|XP_006446318.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59555.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59558.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
Length=632

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 114/214 (53%), Gaps = 8/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E+     +E + 
Sbjct  424  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCENV----QEDIL  479

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   M+   V       G R +WV+  +W  CPIGM+P    SSG LPILD
Sbjct  480  RAEKKLEFVKHYKMERKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPRDLGSSGHLPILD  539

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
            C+       +     E    N+   KR A   I  LDNS  KKM+ ET    +L+    +
Sbjct  540  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIHQLDNSSIKKMK-ETVEVCQLNTDGIS  598

Query  300  GIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
              +   G LMIGG WKKV+  EL+ I S VR+L+
Sbjct  599  LFDDSIGHLMIGGVWKKVSEQELETIKSRVRILI  632



>ref|XP_006446316.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 ref|XP_006446317.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59556.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59557.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
Length=604

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 114/214 (53%), Gaps = 8/214 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E+     +E + 
Sbjct  396  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCENV----QEDIL  451

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   M+   V       G R +WV+  +W  CPIGM+P    SSG LPILD
Sbjct  452  RAEKKLEFVKHYKMERKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPRDLGSSGHLPILD  511

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAA  301
            C+       +     E    N+   KR A   I  LDNS  KKM+ ET    +L+    +
Sbjct  512  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIHQLDNSSIKKMK-ETVEVCQLNTDGIS  570

Query  300  GIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
              +   G LMIGG WKKV+  EL+ I S VR+L+
Sbjct  571  LFDDSIGHLMIGGVWKKVSEQELETIKSRVRILI  604



>ref|XP_010519821.1| PREDICTED: pre-rRNA-processing protein las1 [Tarenaya hassleriana]
Length=614

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 114/232 (49%), Gaps = 27/232 (12%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVN-ESDSPNVHSESFLSRQEESL  664
            G+ QL  S++ LA L+G      KL  L+ +     DV  E  S  V +   L +QE S+
Sbjct  389  GHDQLANSALQLAELVGGRVWKEKLIKLAYVHKPRMDVPLERCSSLVTTHETLFQQERSI  448

Query  663  SQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPIL  484
              A KKL+ +K++  K       +  A V + WV    W PCPIGM+P    SSGRLP+L
Sbjct  449  HSAAKKLEFVKIQLSKKKSECTEETDARVPKTWVKPKTWNPCPIGMLPRVIGSSGRLPLL  508

Query  483  DCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRA---ETESSHE---  322
                NC E ++ +  K       + +KR AE  I+ LD+S  K+ R    + ES+ E   
Sbjct  509  ----NCREATEKTQTKSMVAGQSDSTKREAE--IQLLDDSTTKRARKTMEDPESNREGEM  562

Query  321  -----------LDDTSAAGIE---GCLMIGGEWKKVTADELQAIASSVRMLV  208
                        +D     IE    CLMIGGEWK V   EL  IAS+VR+LV
Sbjct  563  DARSESKEKAMFNDEDNLLIEESGSCLMIGGEWKVVNTKELLEIASAVRILV  614



>ref|XP_003545166.1| PREDICTED: uncharacterized protein LOC100775513 [Glycine max]
Length=631

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 124/228 (54%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQL+ S++ LA LM  + L+ K++  SL+S+   +  + +SP + S++   + EES+ +
Sbjct  405  NKQLVDSALQLAELMNDSYLMEKVRKFSLISLSNLESADDESPLLTSKNIF-QFEESMLE  463

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL+L+K + MK+ K           + W +  +W PCPIGM+P A  SSG LP+L+ 
Sbjct  464  AAKKLELVKQQIMKNKKPMAMDCDTEKSQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLNI  523

Query  477  --NANCTEVSKSSNP--------KECQLSNENH--------SKRVAESAIECLDNSHHKK  352
              +    +VS    P        K+ Q+S +          SKR A   +  LDNS  KK
Sbjct  524  IDDEKQNQVSSCCLPAADIIVDEKQNQVSEKEENWKLIPHGSKRDASLDLLQLDNSTVKK  583

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   E S   ++    G +GCLM+GG  KK+T +EL  I SSV ++V
Sbjct  584  MRETKEFSELNNELPLQGGKGCLMVGGVRKKLTEEELLVIESSVSIIV  631



>gb|KHN12038.1| Ribosomal biogenesis protein LAS1L [Glycine soja]
Length=632

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 124/228 (54%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQL+ S++ LA LM  + L+ K++  SL+S+   +  + +SP + S++   + EES+ +
Sbjct  406  NKQLVDSALQLAELMNDSYLMEKVRKFSLISLSNLESADDESPLLTSKNIF-QFEESMLE  464

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A KKL+L+K + MK+ K           + W +  +W PCPIGM+P A  SSG LP+L+ 
Sbjct  465  AAKKLELVKQQIMKNKKPMAMDCDTEKSQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLNI  524

Query  477  --NANCTEVSKSSNP--------KECQLSNENH--------SKRVAESAIECLDNSHHKK  352
              +    +VS    P        K+ Q+S +          SKR A   +  LDNS  KK
Sbjct  525  IDDEKQNQVSSCCLPAADIIVDEKQNQVSEKEENWKLIPHGSKRDASLDLLQLDNSTVKK  584

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   E S   ++    G +GCLM+GG  KK+T +EL  I SSV ++V
Sbjct  585  MRETKEFSELNNELPLQGGKGCLMVGGVRKKLTEEELLVIESSVSIIV  632



>ref|XP_007141512.1| hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris]
 gb|ESW13506.1| hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris]
Length=633

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 116/228 (51%), Gaps = 19/228 (8%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NKQLM S++ L  LM    L+ K++ LS +S+   + +  D  ++ + + + + EES+ +
Sbjct  407  NKQLMDSALQLIELMDDRYLMEKVQKLSHISLSNLE-HADDQSSLLTSNNIIQFEESIHE  465

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
              KKL+LIK + MK  K           + W +  +W PCPIGM+P A  SSG LP+LD 
Sbjct  466  TAKKLELIKHQVMKKKKPMTMDCDIKKPQTWTLAKSWNPCPIGMLPRAVGSSGCLPVLDI  525

Query  477  --NANCTEVSKSSNPKECQLSNENH----------------SKRVAESAIECLDNSHHKK  352
              N    + S S  P    + +E                  +KR A      LDNS  KK
Sbjct  526  INNEKQNQESSSCFPVVDVIDDEEQDQVWEKKENWKLAPHGAKRDATIDPLQLDNSTVKK  585

Query  351  MRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            MR   ES     +    G +GCL++GG WKK+T +EL  I SSVR+LV
Sbjct  586  MRESKESGELNSELPLQGDKGCLIVGGVWKKLTEEELLVIESSVRILV  633



>ref|XP_004491236.1| PREDICTED: uncharacterized protein LOC101503689 isoform X1 [Cicer 
arietinum]
Length=628

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 124/221 (56%), Gaps = 15/221 (7%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NK++M S++ LA L+G  SL  K++ LS +++     +  D   + + + + + EE++ +
Sbjct  410  NKEVMDSALHLAELVGDRSLSKKVQMLSRVTLSNVFDSADDQSTLLTSANVFQLEETMRE  469

Query  657  AGKKLQLIKLKSMKSNK---VNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            A KKL+L+K + MK+ K   V+         + W +   W PCPIGM+P    SSG +P+
Sbjct  470  ACKKLELVKQQIMKNKKAKEVDCEIEETEETQIWTLAKTWNPCPIGMLPRVVGSSGCVPV  529

Query  486  LDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDD--  313
            LD   N  E ++ S  KE     ++ +KR A S ++ LDNS  KKM+ ETE   EL+D  
Sbjct  530  LDVIDN-EEHNQVSERKENWKLIKHGAKRDAPSDLQLLDNSTVKKMK-ETEKVGELNDEL  587

Query  312  -------TSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
                    + AG +G LM  G WK+V  +EL AI SSVR+L
Sbjct  588  PMEEDELPTEAG-KGYLMEAGVWKRVKEEELLAIQSSVRIL  627



>ref|XP_004491237.1| PREDICTED: uncharacterized protein LOC101503689 isoform X2 [Cicer 
arietinum]
Length=600

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 124/221 (56%), Gaps = 15/221 (7%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            NK++M S++ LA L+G  SL  K++ LS +++     +  D   + + + + + EE++ +
Sbjct  382  NKEVMDSALHLAELVGDRSLSKKVQMLSRVTLSNVFDSADDQSTLLTSANVFQLEETMRE  441

Query  657  AGKKLQLIKLKSMKSNK---VNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPI  487
            A KKL+L+K + MK+ K   V+         + W +   W PCPIGM+P    SSG +P+
Sbjct  442  ACKKLELVKQQIMKNKKAKEVDCEIEETEETQIWTLAKTWNPCPIGMLPRVVGSSGCVPV  501

Query  486  LDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDD--  313
            LD   N  E ++ S  KE     ++ +KR A S ++ LDNS  KKM+ ETE   EL+D  
Sbjct  502  LDVIDN-EEHNQVSERKENWKLIKHGAKRDAPSDLQLLDNSTVKKMK-ETEKVGELNDEL  559

Query  312  -------TSAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
                    + AG +G LM  G WK+V  +EL AI SSVR+L
Sbjct  560  PMEEDELPTEAG-KGYLMEAGVWKRVKEEELLAIQSSVRIL  599



>ref|XP_010673777.1| PREDICTED: uncharacterized protein LOC104890105 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 92/164 (56%), Gaps = 8/164 (5%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQ-WVVTDNWRPCPIGMIPHAFSSS  502
            QEE +  A KKL+L+K   +K   V  T++     +  W     W+PCPIGM+P A  SS
Sbjct  472  QEEYIRAAAKKLELVKHYKLKKASVLSTRDDIMEDKNIWTTAKFWKPCPIGMLPRAVGSS  531

Query  501  GRLPILDCNANC-TEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSH  325
            G LP+LD   NC  +   +S   E  L +++ SKR A   IE +++S  K+M+ ET +S 
Sbjct  532  GCLPVLDHGINCEIKAGLNSMDAEKHLESKHSSKREASCDIETMNDSSTKRMK-ETHNSD  590

Query  324  ELDDTSAAG-----IEGCLMIGGEWKKVTADELQAIASSVRMLV  208
              +  +++G     ++G L+I G W+K+   ELQ I S + +LV
Sbjct  591  SFEAENSSGTAFDRLKGQLLINGIWQKIRDQELQDIKSHIGILV  634



>ref|XP_010673778.1| PREDICTED: uncharacterized protein LOC104890105 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=606

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 92/164 (56%), Gaps = 8/164 (5%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQ-WVVTDNWRPCPIGMIPHAFSSS  502
            QEE +  A KKL+L+K   +K   V  T++     +  W     W+PCPIGM+P A  SS
Sbjct  439  QEEYIRAAAKKLELVKHYKLKKASVLSTRDDIMEDKNIWTTAKFWKPCPIGMLPRAVGSS  498

Query  501  GRLPILDCNANC-TEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSH  325
            G LP+LD   NC  +   +S   E  L +++ SKR A   IE +++S  K+M+ ET +S 
Sbjct  499  GCLPVLDHGINCEIKAGLNSMDAEKHLESKHSSKREASCDIETMNDSSTKRMK-ETHNSD  557

Query  324  ELDDTSAAG-----IEGCLMIGGEWKKVTADELQAIASSVRMLV  208
              +  +++G     ++G L+I G W+K+   ELQ I S + +LV
Sbjct  558  SFEAENSSGTAFDRLKGQLLINGIWQKIRDQELQDIKSHIGILV  601



>gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Erythranthe guttata]
Length=571

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 124/216 (57%), Gaps = 12/216 (6%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            G  +LM+S++ LA+L G  +LL KLK  ++L      ++E+++    +E+  S QE S+ 
Sbjct  363  GKNRLMSSAVTLAQLSGDATLLQKLKKFAILEQLS--ISEANTEISCTETLFSEQEYSIR  420

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A +K +L+ ++  +  K N+  N +  R  W V  +W  CP+GM+PH+   SGR   + 
Sbjct  421  KAEEKFELM-MRQHRMQKKNEKPNLSESR--WSVIKSWNSCPMGMLPHSVGFSGRFSSVG  477

Query  480  -CNANCTEVSKSSNPK-ECQLSNENHSKRVAESAIECLDNSHHKKMR--AETESSHELDD  313
              +  C EV  SS+ K +C ++N    KR AE     +D++  K++   AE     + DD
Sbjct  478  LIDDVCEEVVTSSDNKGDCVVNN--LGKREAEICTAEMDDTRVKRLEIVAEDCVMQDQDD  535

Query  312  TSAA-GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             S   G +GCL+I G WKKV  +EL AIAS++R+LV
Sbjct  536  VSEEEGTKGCLVIDGVWKKVGEEELSAIASAIRVLV  571



>ref|XP_010491978.1| PREDICTED: uncharacterized protein LOC104769459 [Camelina sativa]
Length=613

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 116/249 (47%), Gaps = 55/249 (22%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVN-ESDSPNVHSESFLSRQEESL  664
            G K +  S+ +LA ++G   L  KL  L L+    A V  E  S  V + + L  +E++L
Sbjct  382  GYKLVFKSAFLLAEIVGGRVLKEKLIKLPLMHESSASVLLEQSSTLVTAPTTLLEREKNL  441

Query  663  SQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
              AGK+L+ +KL+  K   ++  KT N      +W     W PCPIGM+P    SSGRLP
Sbjct  442  DNAGKRLEFVKLQLSKKKGIDTDKTTN------RWRKAKTWSPCPIGMLPRIIGSSGRLP  495

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIEC----LDNSHHKKMR--------  346
            +LDC  N   +SK       Q    N++KR A+   EC    L+NS  K+ +        
Sbjct  496  LLDCQ-NAQSISK-------QAQGNNNAKRGAD---ECNRQQLENSTFKRAKKGAEDSES  544

Query  345  ------------AETESSHELDDTSAAGIE-----------GCLMIGGEWKKVTADELQA  235
                        AE +  H  D+T     E            CLMIGGEWK+V   EL  
Sbjct  545  NDVTPLETYMEEAEIDIEHAYDNTETEADENLMWKDEEESRSCLMIGGEWKRVNDGELVG  604

Query  234  IASSVRMLV  208
            +ASSV + V
Sbjct  605  MASSVTICV  613



>ref|XP_010419810.1| PREDICTED: uncharacterized protein LOC104705493 [Camelina sativa]
Length=618

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 117/254 (46%), Gaps = 60/254 (24%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVN-ESDSPNVHSESFLSRQEESL  664
            G K ++ S+ +LA ++G   L  KL  L L+    A V  E  S  V + + L  +E++L
Sbjct  382  GYKLVLKSAFLLAEIVGGRVLKEKLIKLPLMHESSASVLLEQSSTLVTAPTTLLEREKNL  441

Query  663  SQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
              AGK+L+ +KL+  K   ++  KT N      +W     W PCPIGM+P    SSGRLP
Sbjct  442  DNAGKRLEFVKLQLSKKKGIDTDKTTN------RWRKAKTWSPCPIGMLPRIIGSSGRLP  495

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIEC----LDNSHHKKM---------  349
            +LDC  N   +SK       Q    N++KR A+   EC    L+NS  K+          
Sbjct  496  LLDCQ-NAQTISK-------QAEGNNNAKRGAD---ECNRQQLENSPFKRAPFKRAKKGA  544

Query  348  ----------------RAETESSHELDDTSAAGIE-----------GCLMIGGEWKKVTA  250
                             AE ++ H  D+T     E            CLMIGGEWK+V  
Sbjct  545  EDSESNDVTPSETYMEEAEMDTEHAYDNTETEANENLMWKDEEESRSCLMIGGEWKRVND  604

Query  249  DELQAIASSVRMLV  208
             EL  +ASSV + V
Sbjct  605  GELVGMASSVTICV  618



>ref|XP_010543390.1| PREDICTED: uncharacterized protein LOC104816332 isoform X1 [Tarenaya 
hassleriana]
Length=603

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 17/175 (10%)
 Frame = -3

Query  696  ESFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPH  517
            E+ L +QE S+  A KKL+ +K++  K     K++  A V+R WV   +W PCPIG +P 
Sbjct  434  ENTLFQQERSIHGAAKKLEFVKIQFSK----KKSETDARVQRTWVKPKSWNPCPIGTLPR  489

Query  516  AFSSSGRLPILDCNANCTEVSKSSNPKEC--QLSNENHSKRVA------ESAIECLDNSH  361
               SSG LP+L C +    V   SN +E   QL +++ +KR        ES+   LD  +
Sbjct  490  VVGSSGCLPLL-CCSKAMPVQSGSNKREAGIQLLDDSTTKRARKRMEDHESSGRRLDLYN  548

Query  360  HKKMRAETESSHELDDTSAAGI--EG--CLMIGGEWKKVTADELQAIASSVRMLV  208
                 +E+E      D     +  EG  CLM+GGEWK V   +L  IAS+V++LV
Sbjct  549  EADDESESEGDAMFKDKDNNVLIEEGGSCLMVGGEWKMVDTKQLLEIASAVKILV  603



>ref|XP_010543391.1| PREDICTED: uncharacterized protein LOC104816332 isoform X2 [Tarenaya 
hassleriana]
Length=602

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 17/175 (10%)
 Frame = -3

Query  696  ESFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPH  517
            E+ L +QE S+  A KKL+ +K++  K     K++  A V+R WV   +W PCPIG +P 
Sbjct  433  ENTLFQQERSIHGAAKKLEFVKIQFSK----KKSETDARVQRTWVKPKSWNPCPIGTLPR  488

Query  516  AFSSSGRLPILDCNANCTEVSKSSNPKEC--QLSNENHSKRVA------ESAIECLDNSH  361
               SSG LP+L C +    V   SN +E   QL +++ +KR        ES+   LD  +
Sbjct  489  VVGSSGCLPLL-CCSKAMPVQSGSNKREAGIQLLDDSTTKRARKRMEDHESSGRRLDLYN  547

Query  360  HKKMRAETESSHELDDTSAAGI--EG--CLMIGGEWKKVTADELQAIASSVRMLV  208
                 +E+E      D     +  EG  CLM+GGEWK V   +L  IAS+V++LV
Sbjct  548  EADDESESEGDAMFKDKDNNVLIEEGGSCLMVGGEWKMVDTKQLLEIASAVKILV  602



>ref|XP_010453287.1| PREDICTED: uncharacterized protein LOC104735237 [Camelina sativa]
Length=612

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 113/245 (46%), Gaps = 48/245 (20%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVN-ESDSPNVHSESFLSRQEESL  664
            G K +  S+ +LA ++G   L  KL  L L+    A V  E  S  V + + L  +E++L
Sbjct  382  GYKLVFKSAFLLAEIVGGRVLKEKLSKLPLMHESSASVLLEQSSTLVTAPTTLLEREKNL  441

Query  663  SQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLP  490
              AGK+L+ +KL+  K   ++  KT N      +W     W PCPIGM+P    SSGRLP
Sbjct  442  DNAGKRLEFVKLQLSKKKGIDTDKTTN------RWRKAKTWSPCPIGMLPRIIGSSGRLP  495

Query  489  ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMR------------  346
            +LDC  N   +SK       Q    N++KR AE   + L+NS  K+ +            
Sbjct  496  LLDCQ-NAQSISK-------QAQGNNNAKRGAECNRQQLENSPFKRAKTGAEDSESNDVT  547

Query  345  --------AETESSHELDDTSAAGIE-----------GCLMIGGEWKKVTADELQAIASS  223
                    AE +  H  D+T     E            CLMI GEWK+V    L  +ASS
Sbjct  548  PLETYMEEAEMDIEHAYDNTETEADENLMWNDEEESRSCLMIDGEWKRVNDGVLVGMASS  607

Query  222  VRMLV  208
            V + V
Sbjct  608  VTVCV  612



>ref|XP_006399738.1| hypothetical protein EUTSA_v10012989mg [Eutrema salsugineum]
 gb|ESQ41191.1| hypothetical protein EUTSA_v10012989mg [Eutrema salsugineum]
Length=614

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 92/179 (51%), Gaps = 26/179 (15%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSG  499
            QE+ +  AGK+L+ +KL+  K    N  + ++    +W     W PCPIGM+P    SSG
Sbjct  440  QEKKIGSAGKRLEFVKLQVSKKRGNNTDKANS----RWRKAKTWSPCPIGMLPRIIGSSG  495

Query  498  RLPILDCNANCT---EVSKSSNPK---EC--QLSNENHSKRVAESAIECLDN-----SHH  358
            RLPILD  +  T   +  ++ N K   EC  Q    +  KR  +S  +   N     +H 
Sbjct  496  RLPILDFQSAHTISKQTQRNDNVKRGAECNSQQFENSTCKRAKKSREDPESNDMTLATHE  555

Query  357  KKMRAETESSHELDDTSAAG---------IEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            ++   + E ++E  ++ A G         I GCLMIGGEW++V   EL  +AS+V++ V
Sbjct  556  EEAEMDIEHAYEETESEAEGNLMLKDEEEIRGCLMIGGEWRRVKDGELLGMASNVKLYV  614



>ref|XP_010922079.1| PREDICTED: uncharacterized protein LOC105045481 [Elaeis guineensis]
Length=618

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 114/215 (53%), Gaps = 8/215 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            G+K L+ S +++A ++G NSL  +LK L LL +   D  E D  +  +E+ LS++E+SL 
Sbjct  406  GDKHLIDSVMLVAEMIGNNSLKERLKKLPLLGLKDRDSME-DPIHSSTETMLSQEEDSLK  464

Query  660  QAGKKLQLIKLKSMKSNKVNKT----QNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRL  493
             A  KL+LIKL+    N  N+T      +      W V  +W  CPIGM+P +FSS+  L
Sbjct  465  IAAAKLELIKLQF--QNHSNRTTGPVDGNTDTANMWTVAKSWISCPIGMLPCSFSSTAVL  522

Query  492  PILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDD  313
            P+LD   +  E  K     +  ++++   K   +S  E  +N    K    T   H+LD 
Sbjct  523  PVLDKVDDGLESLKVERNNDKAVNDQATDKSDLDSHTEPWENGSAIKKLKPTLKEHDLDF  582

Query  312  TSAA-GIEGCLMIGGEWKKVTADELQAIASSVRML  211
                  +EG L+I G WKKV+  EL AI S++R+ 
Sbjct  583  PEIKFPMEGRLLIDGIWKKVSEQELLAIGSNIRIF  617



>ref|XP_008788499.1| PREDICTED: uncharacterized protein LOC103706229 [Phoenix dactylifera]
Length=622

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 8/216 (4%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGA-DVNESDSPNVHS-ESFLSRQEES  667
            G+K L  S ++LA ++G NSL  +LK L    + G+ D +  + P + S E+  S++E+S
Sbjct  410  GDKHLTDSVMLLAEMIGNNSLKERLKKLP---LLGSKDWDSIEDPVLASTETMCSQEEDS  466

Query  666  LSQAGKKLQLIKLKSMK-SNK-VNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRL  493
            L  A  KL+L+KL+    SN+       +      W +  +W PCPIGM+P +FSS+  L
Sbjct  467  LKIAAAKLELLKLQFQNHSNRSTGPVDGNTDTSNMWTLAKSWIPCPIGMLPCSFSSTAVL  526

Query  492  PILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDD  313
            P+LD      E  K     +  +S++  +K   +S  E  +N    K    T    ELD 
Sbjct  527  PVLDKVDEGLESMKIEINNDKAVSDQATNKSDLDSHTEPWENGSAIKKLKPTLKEQELDF  586

Query  312  TSAA-GIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
                  +EG L+I G WKKV+  EL AI S++R+ V
Sbjct  587  PEIKFPMEGRLLIDGIWKKVSEQELLAIESNIRIFV  622



>ref|NP_196783.2| las1-like family protein [Arabidopsis thaliana]
 gb|AED91776.1| las1-like family protein [Arabidopsis thaliana]
Length=611

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 93/198 (47%), Gaps = 46/198 (23%)
 Frame = -3

Query  705  VHSESFLSRQEESLSQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPI  532
            V + + L  QE++L  AGK+L+ +KL+  K   ++  KT N      +W     W PCPI
Sbjct  428  VTASTTLLEQEKNLGNAGKRLEFVKLQLSKKKGIDTDKTGN------RWRKAKTWSPCPI  481

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKK  352
            GM+P    SSGRLP+LD N N   +SK       Q    N++KR AE     L+ S  K+
Sbjct  482  GMLPRIIGSSGRLPLLD-NQNAKSISK-------QAQGNNNAKRGAECNRNQLEKSPCKR  533

Query  351  MR---AETESS----------------HELDDTSAAGIE-----------GCLMIGGEWK  262
             R    ++ES+                H  ++T     E            CLMI GEWK
Sbjct  534  ARKSAGDSESNDVTLESYEEEAEMEIEHAYEETETVAEENLMWNDEEESRSCLMIDGEWK  593

Query  261  KVTADELQAIASSVRMLV  208
            +V   EL  +ASSV + V
Sbjct  594  RVNDGELSGMASSVTICV  611



>ref|NP_001190293.1| las1-like family protein [Arabidopsis thaliana]
 gb|AED91777.1| las1-like family protein [Arabidopsis thaliana]
Length=600

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 93/198 (47%), Gaps = 46/198 (23%)
 Frame = -3

Query  705  VHSESFLSRQEESLSQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPI  532
            V + + L  QE++L  AGK+L+ +KL+  K   ++  KT N      +W     W PCPI
Sbjct  417  VTASTTLLEQEKNLGNAGKRLEFVKLQLSKKKGIDTDKTGN------RWRKAKTWSPCPI  470

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKK  352
            GM+P    SSGRLP+LD N N   +SK       Q    N++KR AE     L+ S  K+
Sbjct  471  GMLPRIIGSSGRLPLLD-NQNAKSISK-------QAQGNNNAKRGAECNRNQLEKSPCKR  522

Query  351  MR---AETESS----------------HELDDTSAAGIE-----------GCLMIGGEWK  262
             R    ++ES+                H  ++T     E            CLMI GEWK
Sbjct  523  ARKSAGDSESNDVTLESYEEEAEMEIEHAYEETETVAEENLMWNDEEESRSCLMIDGEWK  582

Query  261  KVTADELQAIASSVRMLV  208
            +V   EL  +ASSV + V
Sbjct  583  RVNDGELSGMASSVTICV  600



>dbj|BAB10040.1| unnamed protein product [Arabidopsis thaliana]
Length=626

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 93/198 (47%), Gaps = 46/198 (23%)
 Frame = -3

Query  705  VHSESFLSRQEESLSQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPI  532
            V + + L  QE++L  AGK+L+ +KL+  K   ++  KT N      +W     W PCPI
Sbjct  443  VTASTTLLEQEKNLGNAGKRLEFVKLQLSKKKGIDTDKTGN------RWRKAKTWSPCPI  496

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKK  352
            GM+P    SSGRLP+LD N N   +SK       Q    N++KR AE     L+ S  K+
Sbjct  497  GMLPRIIGSSGRLPLLD-NQNAKSISK-------QAQGNNNAKRGAECNRNQLEKSPCKR  548

Query  351  MR---AETESS----------------HELDDTSAAGIE-----------GCLMIGGEWK  262
             R    ++ES+                H  ++T     E            CLMI GEWK
Sbjct  549  ARKSAGDSESNDVTLESYEEEAEMEIEHAYEETETVAEENLMWNDEEESRSCLMIDGEWK  608

Query  261  KVTADELQAIASSVRMLV  208
            +V   EL  +ASSV + V
Sbjct  609  RVNDGELSGMASSVTICV  626



>ref|XP_006287306.1| hypothetical protein CARUB_v10000499mg [Capsella rubella]
 gb|EOA20204.1| hypothetical protein CARUB_v10000499mg [Capsella rubella]
Length=611

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 112/243 (46%), Gaps = 45/243 (19%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVN-ESDSPNVHSESFLSRQEESL  664
            G + ++ S+ +LA ++G   L  KL  L L+    A    E  S  V + + L  +E++L
Sbjct  382  GYELVLKSAFLLAEIVGGRVLKEKLIKLPLMHTSSASFRLEQGSTLVTAPTTLLEREKNL  441

Query  663  SQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPIL  484
            + AGK+L ++KL+  K   ++  +       +W     W PCPIGM+P    SSGRLP+L
Sbjct  442  NNAGKRLDIVKLQLSKKKGIDTDKTSI----RWRKAKTWSPCPIGMLPRIIGSSGRLPLL  497

Query  483  DCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMR--------------  346
            D N N   +SK       Q    N++KR AE   + L+NS  K+ +              
Sbjct  498  D-NQNAQNISK-------QAQGNNNAKRGAECTRQ-LENSTCKRAKKGAEDSESNDVTFE  548

Query  345  -----AETESSHELDDTSAAGIEGC------------LMIGGEWKKVTADELQAIASSVR  217
                 AE +  H  D T     E              LMIGGEWK+V   EL  +AS+V 
Sbjct  549  TCMEEAEMDIEHAFDKTETEAEENLMMWNDEEENRSYLMIGGEWKRVNDGELVGMASNVT  608

Query  216  MLV  208
            + V
Sbjct  609  VCV  611



>gb|EMT32865.1| hypothetical protein F775_28198 [Aegilops tauschii]
Length=571

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 85/181 (47%), Gaps = 31/181 (17%)
 Frame = -3

Query  690  FLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHA-GV--------RRQWVVTDNWRPC  538
             LS  +ES+  A +KL+  KL+  K + VN  +N   G         R  W +  +W PC
Sbjct  402  ILSNGQESVESATQKLEAFKLQLRKPDNVNLAENGTQGTLNTSMPEKRNGWSIAKSWTPC  461

Query  537  PIGMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHH  358
            P+GMIP ++SS+  LP+LD   +           E +     H     +  IE  D   H
Sbjct  462  PLGMIPCSYSSTAVLPVLDVIDD-----------ELKHDTAEHGDFEPDGEIEIFDCYAH  510

Query  357  KKMRAETES---------SHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
             +   + E           H + D     +G+ G L++GG WKKVT +EL +I SS+++L
Sbjct  511  PEQHLDGEGILEMPRSPPEHGISDMPELTSGLRGTLLVGGVWKKVTEEELLSIKSSMKIL  570

Query  210  V  208
            +
Sbjct  571  L  571



>ref|XP_002871519.1| hypothetical protein ARALYDRAFT_488065 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47778.1| hypothetical protein ARALYDRAFT_488065 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 90/204 (44%), Gaps = 46/204 (23%)
 Frame = -3

Query  723  ESDSPNVHSESFLSRQEESLSQAGKKLQLIKLKSMKSNKV--NKTQNHAGVRRQWVVTDN  550
            E  S  V + + L  QE+ L  AGK+L+ +KL+  K   +  +KT N      +W     
Sbjct  422  EQSSTLVTAPTTLLEQEKDLGNAGKRLEFVKLQLSKKKGIETDKTGN------RWRKAKT  475

Query  549  WRPCPIGMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLD  370
            W PCPIGM+P    SSGRLP+LD + N   +SK       Q    N++KR  E   + L+
Sbjct  476  WSPCPIGMLPRIIGSSGRLPLLDYH-NAQSISK-------QAQGNNNAKRGTECNRKQLE  527

Query  369  NSHHKKMRAETESSHELD-------------------DTSAAGIE-----------GCLM  280
             S  K+ R   E S   D                   +T A   E            CLM
Sbjct  528  KSPCKRARKSAEDSDTNDVTLEAYEEEAEMEIEHAYEETEAVAEENLMWNDKEESRSCLM  587

Query  279  IGGEWKKVTADELQAIASSVRMLV  208
            I GEWK+V   EL  +AS + + V
Sbjct  588  IDGEWKRVNEGELSGMASKITICV  611



>gb|AAL91200.1| unknown protein [Arabidopsis thaliana]
 gb|AAO00916.1| unknown protein [Arabidopsis thaliana]
Length=611

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 92/198 (46%), Gaps = 46/198 (23%)
 Frame = -3

Query  705  VHSESFLSRQEESLSQAGKKLQLIKLKSMKSNKVN--KTQNHAGVRRQWVVTDNWRPCPI  532
            V + + L  QE++L  AGK+L+ +KL+  K   ++  KT N      +W       PCPI
Sbjct  428  VTASTTLLEQEKNLGNAGKRLEFVKLQLSKKKGIDTDKTGN------RWRKAKTRSPCPI  481

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKK  352
            GM+P    SSGRLP+LD N N   +SK       Q    N++KR AE     L+ S  K+
Sbjct  482  GMLPRIIGSSGRLPLLD-NQNAKSISK-------QAQGNNNAKRGAECNRNQLEKSPCKR  533

Query  351  MR---AETESS----------------HELDDTSAAGIE-----------GCLMIGGEWK  262
             R    ++ES+                H  ++T     E            CLMI GEWK
Sbjct  534  ARKSAGDSESNDVTLESYEEEAEMEIEHAYEETETVAEENLMWNDEEESRSCLMIDGEWK  593

Query  261  KVTADELQAIASSVRMLV  208
            +V   EL  +ASSV + V
Sbjct  594  RVNDGELSGMASSVTICV  611



>ref|XP_009131263.1| PREDICTED: uncharacterized protein LOC103855960 [Brassica rapa]
Length=613

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 92/194 (47%), Gaps = 46/194 (24%)
 Frame = -3

Query  693  SFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHA  514
            + L +QE++L  AGK+L+ +KL+ +   K N+T+      ++W     W  CPIGM+P  
Sbjct  434  TLLEQQEKNLRSAGKRLESVKLQ-LSKKKGNETEK---ANKRWRKARTWSTCPIGMLPRI  489

Query  513  FSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE  334
              SSGRLP+LD N +   +SK       Q    N+ KRVAE + + L+NS  K+ R  TE
Sbjct  490  IGSSGRLPLLD-NLDAHMISK-------QAQGNNNVKRVAECSTQQLENSAFKRARKSTE  541

Query  333  S---------SHE-----------------------LDDTSAAGIEGCLMIGGEWKKVTA  250
                      +HE                       L+D    GI G L IG  WK+V  
Sbjct  542  DLSSNEATLEAHEEEAEMDKEQSDEETESESEGNLMLEDVE-EGI-GYLRIGDVWKRVKD  599

Query  249  DELQAIASSVRMLV  208
             E   +AS V+M V
Sbjct  600  GEQLVMASQVKMCV  613



>gb|KDO54755.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
Length=453

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 81/156 (52%), Gaps = 4/156 (3%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E      +E + 
Sbjct  301  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCEDM----QEDIP  356

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   MK   V       G R +WV+  +W  CPIGM+PH   SSGRLPILD
Sbjct  357  KAAKKLEFVKRYKMKRKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPHDLGSSGRLPILD  416

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECL  373
            C+       +     E    N+   KR A   I+ +
Sbjct  417  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIQLI  452



>gb|KDO54753.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
 gb|KDO54754.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
Length=577

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 81/156 (52%), Gaps = 4/156 (3%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E      +E + 
Sbjct  425  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCEDM----QEDIP  480

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   MK   V       G R +WV+  +W  CPIGM+PH   SSGRLPILD
Sbjct  481  KAAKKLEFVKRYKMKRKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPHDLGSSGRLPILD  540

Query  480  CNANCTEVSKSSNPKECQLSNENHSKRVAESAIECL  373
            C+       +     E    N+   KR A   I+ +
Sbjct  541  CDDRKQSGPQPVEKNEIMELNQYGGKREASCDIQLI  576



>gb|KDO54752.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
Length=549

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 71/122 (58%), Gaps = 4/122 (3%)
 Frame = -3

Query  840  GNKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLS  661
            GNK L+ SS+ LA+L+G  S+  KL+ LSL+ +   D +E +S     E      +E + 
Sbjct  397  GNKLLVDSSLHLAQLVGNLSITEKLRKLSLICLSHLDGSEENSSLSRCEDM----QEDIP  452

Query  660  QAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILD  481
            +A KKL+ +K   MK   V       G R +WV+  +W  CPIGM+PH   SSGRLPILD
Sbjct  453  KAAKKLEFVKRYKMKRKVVMTADGDVGNRNRWVLAKSWNSCPIGMLPHDLGSSGRLPILD  512

Query  480  CN  475
            C+
Sbjct  513  CD  514



>emb|CDX78473.1| BnaA03g03850D [Brassica napus]
Length=613

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 93/196 (47%), Gaps = 46/196 (23%)
 Frame = -3

Query  699  SESFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIP  520
            S + L +QE++L  AGK+L+ +KL+  K  K N+T+      ++W     W  CPIGM+P
Sbjct  432  STTLLEQQEKNLRSAGKRLESVKLQFSK-KKGNETEK---ANKRWRKARTWSTCPIGMLP  487

Query  519  HAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAE  340
                SSGRLP+LD N +   +SK       Q    N+ KRVAE + + L+NS  K+ R  
Sbjct  488  RIIGSSGRLPLLD-NLDAHMISK-------QAQGNNNVKRVAECSTQQLENSAFKRARKS  539

Query  339  TES---------SHE-----------------------LDDTSAAGIEGCLMIGGEWKKV  256
            TE          +HE                       L+D    GI G L IG  WK+V
Sbjct  540  TEDLSSNEATLEAHEEEAEMDKEQTDEETESESEGNLMLED-EEEGI-GYLRIGDVWKRV  597

Query  255  TADELQAIASSVRMLV  208
               E   +AS V++ V
Sbjct  598  KDGEQLVMASQVKICV  613



>emb|CDX70455.1| BnaC03g05390D [Brassica napus]
Length=613

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 92/193 (48%), Gaps = 46/193 (24%)
 Frame = -3

Query  690  FLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAF  511
             L +QE++L  AGK+L+ +KL+ +   K N+T+      ++W     W  CPIGM+P   
Sbjct  435  LLEQQEKNLRSAGKRLESVKLQ-LSRKKGNETEK---ANKRWKKATTWSTCPIGMLPRII  490

Query  510  SSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES  331
             SSGRLP+LD N +   +SK       Q    N++KRVAE + + L+NS  K+ R  TE 
Sbjct  491  GSSGRLPLLD-NQDAHMISK-------QAQGNNNAKRVAECSTQELENSAFKRARKSTED  542

Query  330  ---------SHE-----------------------LDDTSAAGIEGCLMIGGEWKKVTAD  247
                     +HE                       L+D    GI G L IG  WK+V   
Sbjct  543  HNSNEATLEAHEEEAEMDKEQTDEETESESEGNLMLED-EEEGI-GYLRIGDVWKRVKDG  600

Query  246  ELQAIASSVRMLV  208
            E   +AS V++ V
Sbjct  601  EQLVMASQVKICV  613



>gb|KFK25498.1| hypothetical protein AALP_AA8G122400 [Arabis alpina]
Length=614

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 84/187 (45%), Gaps = 42/187 (22%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSG  499
            QE+ L   GK+L LIK + +  NK N T+       +W     W PCPIGM+P    SSG
Sbjct  440  QEKKLGCVGKRLDLIKAQ-LPKNKGNDTEK---TNTRWRKVKTWSPCPIGMLPRTIGSSG  495

Query  498  RLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMR---------  346
            RLP LD       V  +SN    Q     ++KR AE + E L+ S  K+ R         
Sbjct  496  RLPFLDFQ----NVQSTSN----QPQGNKNAKRGAECSNEQLEKSTCKRARKNAEDPESN  547

Query  345  ----------AETESSHELDDTSAAGIEGC-----------LMIGGEWKKVTADELQAIA  229
                      AE +  H  +DT     E             LMIGGE+K+V   EL  +A
Sbjct  548  VVTWETYEEEAEMDIEHAYEDTETEAEENLMLKDEEESRSFLMIGGEYKRVKDAELLGMA  607

Query  228  SSVRMLV  208
            S+V++ V
Sbjct  608  SNVKICV  614



>emb|CDM84627.1| unnamed protein product [Triticum aestivum]
Length=601

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 31/181 (17%)
 Frame = -3

Query  690  FLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHA-GV--------RRQWVVTDNWRPC  538
             L   +ES+  A +KL+  KL+  K++  +  +N   G         R +W +  +W PC
Sbjct  432  ILPNGQESVESATQKLEAFKLQLRKTDNASLAENGTEGTLNTSMPEKRNRWSIAKSWTPC  491

Query  537  PIGMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHH  358
            P+GMIP ++SS+  LP+LD   +           E +     H     +  IE  D    
Sbjct  492  PLGMIPCSYSSTAVLPVLDVIDD-----------ELKHDTAEHENFEPDGQIEIFDCYSQ  540

Query  357  KKMRAETES---------SHELDDT--SAAGIEGCLMIGGEWKKVTADELQAIASSVRML  211
             + + + E           H + D   S  G+ G L++GG WKKVT +EL +I SS+++L
Sbjct  541  PEQQLDGEGILEISRLPPEHGISDMPESTFGLRGTLLVGGVWKKVTEEELLSIKSSMKIL  600

Query  210  V  208
            +
Sbjct  601  L  601



>dbj|BAJ98227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 86/170 (51%), Gaps = 13/170 (8%)
 Frame = -3

Query  690  FLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHA-GV--------RRQWVVTDNWRPC  538
             LS  +ES+  A +KL+  KL+  K +  +  +N   G         R +W V  +W PC
Sbjct  428  ILSNGQESVESATQKLEAFKLQLRKPDNASIAENGTEGTFNTSVPEKRNRWSVAKSWTPC  487

Query  537  PIGMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHH  358
            P+GMIP ++SS+  LP+LD   +  E     +  E     ++    +A+   +  D    
Sbjct  488  PLGMIPCSYSSTAVLPVLDIIDDELE----HDTAEHGNFEDDGQIEIADPEKQLDDEGFL  543

Query  357  KKMRAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            +  R+  E    +      G++G L++GG WKKVT +EL +I SS+++L+
Sbjct  544  EISRSPPEHGISVMPELIHGLKGTLLVGGVWKKVTEEELLSIKSSMKILL  593



>ref|XP_006832836.1| PREDICTED: uncharacterized protein LOC18426107 [Amborella trichopoda]
 gb|ERM98114.1| hypothetical protein AMTR_s00095p00033450 [Amborella trichopoda]
Length=636

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 89/180 (49%), Gaps = 27/180 (15%)
 Frame = -3

Query  669  SLSQAGKKLQLIKLKS--MKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGR  496
            SL++A +KL+L+K +   + ++K+ ++      R  W +  +W  CPIGM+P  FSSSG 
Sbjct  453  SLNEAVRKLELLKQQRSVLLNSKITRSNRMDSDRTAWSIVKSWNKCPIGMLPCQFSSSGI  512

Query  495  LPILDCNANCTE---VSKSSNPKECQLSNENHSK--RVAESAIE-CLDN-------SHHK  355
            +P+L+  ++  E   + ++    E   +N+  +    VAE   + CL         S  K
Sbjct  513  MPVLERESDILENNQIMRNRGQSELSFANKYGATDAEVAERGCKRCLSGEPDLSQASGVK  572

Query  354  KMRAE-----------TESSHELDDTSAAG-IEGCLMIGGEWKKVTADELQAIASSVRML  211
            KMR E            E    LD+    G  EG L++GG  K V  DEL A+ S+VR+ 
Sbjct  573  KMRKEREELPQEDRVMVEGEEMLDEEREVGHFEGRLLVGGIHKLVEPDELTAVQSAVRIF  632



>ref|XP_004970301.1| PREDICTED: uncharacterized protein LOC101771511 [Setaria italica]
Length=601

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 82/164 (50%), Gaps = 13/164 (8%)
 Frame = -3

Query  669  SLSQAGKKLQLIKL--KSMKSNKVNKTQNHAGV--------RRQWVVTDNWRPCPIGMIP  520
            S+ +A + L++ KL  K  K+  + +T    G           +W V  +W PCPIG IP
Sbjct  441  SIEKATETLEMFKLQLKRQKNGCLTETGTTEGSFNTSTPEKHNRWSVAKSWTPCPIGTIP  500

Query  519  HAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAE  340
             +FSS   LP  D   +  EV  ++  +       +HS+R    + E  D S     R+ 
Sbjct  501  CSFSSCAVLPAFDVVDHGPEV--ATLEQHGNFEEVDHSERFESQSEELEDESILNIPRSP  558

Query  339  TESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
                 ++ + +   ++G L++GG WKKVTA+EL  I S+++ML+
Sbjct  559  EYDISDMPELTYP-LKGRLLVGGVWKKVTAEELLLIKSNMKMLL  601



>ref|XP_009384357.1| PREDICTED: uncharacterized protein LOC103971923 [Musa acuminata 
subsp. malaccensis]
Length=613

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 85/161 (53%), Gaps = 4/161 (2%)
 Frame = -3

Query  693  SFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHA  514
            S L ++E+ +  A   L+++KL ++KS +     + +     W V  +W  CPIGM+P +
Sbjct  452  SMLLQEEDVVKNATDNLEIMKL-NLKSRRKRINGSDSDTTSIWTVAKSWTSCPIGMLPCS  510

Query  513  FSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLD-NSHHKKMRAET  337
            FSS+  LP+LD   N  E    +N K+  L+    S  + +   E  +  +  KK++   
Sbjct  511  FSSTAVLPVLDKFDNELETDVGTN-KDAVLNCSAASYGLLDCHTEPSEVGNAFKKLKPSM  569

Query  336  ESSHELD-DTSAAGIEGCLMIGGEWKKVTADELQAIASSVR  217
            +    +D   +   +EG L+I G W KV+ +ELQAI S++R
Sbjct  570  DDVQCVDCSETTCPMEGRLLIHGMWIKVSEEELQAIESNIR  610



>ref|NP_001066337.1| Os12g0189900 [Oryza sativa Japonica Group]
 gb|ABA96027.1| Las1-like family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF29356.1| Os12g0189900 [Oryza sativa Japonica Group]
 dbj|BAG89794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52888.1| hypothetical protein OsJ_35471 [Oryza sativa Japonica Group]
Length=595

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 86/172 (50%), Gaps = 16/172 (9%)
 Frame = -3

Query  684  SRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGV---------RRQWVVTDNWRPCPI  532
            +++ ES+ +A +KL++ K + +K   +   +N  G          R +W    +W PCPI
Sbjct  427  TKETESVEEATEKLEMFKSR-LKQKDLRLAENDTGASLNTIMPEKRNRWSTAKSWTPCPI  485

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAI--ECLDNSHH  358
            GMIP +FSS   LP LD   +  E       +   +  ++H++R+   +   + LD    
Sbjct  486  GMIPCSFSSVAVLPTLDVVDH--ESRDEILEQHVSVEPDDHTERIGYYSDPEKQLDAERI  543

Query  357  KKMRAETESSHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++   +    E+ D    A  ++G L++GG WK V+ +EL  I S +++L+
Sbjct  544  PELSRPSPEECEISDMPELAFPLKGRLLVGGVWKMVSEEELLFIKSKMKILL  595



>gb|EPS61111.1| hypothetical protein M569_13688 [Genlisea aurea]
Length=484

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 108/210 (51%), Gaps = 24/210 (11%)
 Frame = -3

Query  837  NKQLMASSIVLARLMGknsllnklktlsllSVFGADVNESDSPNVHSESFLSRQEESLSQ  658
            ++++M+S+++LA L G  +L+ KL+ L+ +S   +D  E++S      S    +E SL Q
Sbjct  298  DERVMSSALILAELKGDVALVRKLEKLASIS-RNSDSEEAESSRRFITSAPDEEEHSLQQ  356

Query  657  AGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHAFSSSGRLPILDC  478
            A + L      S+K  ++N   N + V+++WVVT +W PCPIGM+PH    SGRLPILD 
Sbjct  357  AAEMLH-----SIKKQRLN--NNDSVVKKKWVVTKSWNPCPIGMLPHDVGFSGRLPILDH  409

Query  477  NANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETESSHELDDTSAAG  298
                               +EN  K    S     +    ++      SS+       + 
Sbjct  410  EP----------------LSENQEKNTTSSIAREREEEEKEEDPLPLPSSNGKTTEENSD  453

Query  297  IEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             +G L+I G WK+V  DE+  IASSVR+LV
Sbjct  454  FKGHLLIDGTWKRVGDDEVVDIASSVRLLV  483



>gb|EEC68976.1| hypothetical protein OsI_37725 [Oryza sativa Indica Group]
Length=598

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 86/172 (50%), Gaps = 16/172 (9%)
 Frame = -3

Query  684  SRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGV---------RRQWVVTDNWRPCPI  532
            +++ ES+ +A +KL++ K + +K   +   +N  G          R +W    +W PCPI
Sbjct  430  TKETESVEEATEKLEMFKSR-LKQKDLRLAENDTGASLNTIMPEKRNRWSTAKSWTPCPI  488

Query  531  GMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAI--ECLDNSHH  358
            GMIP +FSS   LP LD   +  E       +   +  ++H++R+   +   + LD    
Sbjct  489  GMIPCSFSSVAVLPTLDVVDH--ESRDEILEQHVSVEPDDHTERIGYYSDPEKQLDAERI  546

Query  357  KKMRAETESSHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             ++   +    E+ D    A  ++G L++GG WK V+ +EL  I S +++L+
Sbjct  547  PELSRPSPEECEISDMPEQAFPLKGRLLVGGVWKMVSEEELLFIKSKMKILL  598



>ref|XP_002458656.1| hypothetical protein SORBIDRAFT_03g037530 [Sorghum bicolor]
 gb|EES03776.1| hypothetical protein SORBIDRAFT_03g037530 [Sorghum bicolor]
Length=597

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 82/163 (50%), Gaps = 12/163 (7%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIK--LKSMKSNKVNKTQNHAGVRR--QWVVTDNWRPCPIGMIPHAF  511
            Q+ S+  A + L+L K  LK  K+     + N +   +  +W V  +W PCPIG +P +F
Sbjct  441  QQGSVENAIETLELFKVQLKRQKNGTTEGSFNTSTPEKHDRWSVAKSWTPCPIGTVPCSF  500

Query  510  SSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES  331
            SS   LP  D  ++  +VS   N         NHS+R      E +D S  +  ++  E 
Sbjct  501  SSCAVLPAFDVISH-EQVSTLENE---TFEEVNHSERFEPQTEELVDESILEIPKSSPE-  555

Query  330  SHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             +E+ D +     ++G L++GG WK V  +EL  I S +++L+
Sbjct  556  -YEISDVTELTCPLKGRLLVGGVWKMVAEEELLLIKSKMKILL  597



>ref|XP_006663879.1| PREDICTED: uncharacterized protein LOC102721786 [Oryza brachyantha]
Length=509

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 85/180 (47%), Gaps = 34/180 (19%)
 Frame = -3

Query  684  SRQE-ESLSQAGKKLQLIKLKSMKSNKVNKTQNHAG---------VRRQWVVTDNWRPCP  535
            SR+E ES+ +A +KL++ K   +K   +   +N  G          R +W    +W PCP
Sbjct  343  SRKEIESVDKATEKLEMFK-SQLKQKDICSVENGTGGSLHTIIPEKRNRWSTAKSWTPCP  401

Query  534  IGMIPHAFSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHK  355
            IGMIP +FSS   LP LD   +  +            + E H     +   E +++  H 
Sbjct  402  IGMIPCSFSSVPVLPNLDVAVHEDD------------TLEEHVNFEPDDHPEIIEHYSHA  449

Query  354  KMRAETESSHELDDTS-----------AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
            + + + E   E+  TS           A  ++G L++GG WK V+ +EL +I S +++L+
Sbjct  450  EKQLDAEIITEISKTSPECEISEMPELAFPLKGRLLVGGVWKVVSKEELLSIKSKMKILL  509



>emb|CDY69624.1| BnaAnng31020D, partial [Brassica napus]
Length=391

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = -3

Query  693  SFLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAGVRRQWVVTDNWRPCPIGMIPHA  514
            + L +QE++L  AGK+L+ +KL+ +   K N+T+      ++W     W  CPIGM+P  
Sbjct  231  TLLEQQEKNLRSAGKRLESVKLQ-LSKKKGNETEK---ANKRWRKARTWSTCPIGMLPRI  286

Query  513  FSSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETE  334
              SSGRLP+LD N +   +SK       Q     + KR AE   + L+N   K+ R  TE
Sbjct  287  IGSSGRLPLLD-NQDAHMISK-------QAQGNINVKRSAECNTQQLENLTFKRARKSTE  338



>ref|XP_010232471.1| PREDICTED: uncharacterized protein LOC100831838 [Brachypodium 
distachyon]
Length=597

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 88/174 (51%), Gaps = 18/174 (10%)
 Frame = -3

Query  690  FLSRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHA-GV--------RRQWVVTDNWRPC  538
             +S  + S+  A +KL++ KL+  KS      +N   G+          +W +  +W PC
Sbjct  428  IISSGQGSVESATEKLEMFKLQLRKSENACLAENGPKGLFSASMPEKHNRWSIAKSWTPC  487

Query  537  PIGMIPHAFSSSGRLP---ILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDN  367
            P+GMIP ++SS+  LP   ++DC      +   +   + Q     +  +  +     LD+
Sbjct  488  PLGMIPCSYSSTAVLPALGVIDCELKDDTIEHGTFEHDGQTETFAYYSQPEKQ----LDD  543

Query  366  SHHKKM-RAETESSHELDDTSAAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             +  ++ R+      +L + ++  + G L++GG WKKVT +EL ++ S++++L+
Sbjct  544  VNILEISRSPPCEISDLPELTSP-LRGKLLVGGLWKKVTEEELLSMKSNMKILL  596



>ref|NP_001145840.1| uncharacterized protein LOC100279349 [Zea mays]
 gb|ACL52704.1| unknown [Zea mays]
Length=592

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIK--LKSMKSNKVNKTQNHAGVRR--QWVVTDNWRPCPIGMIPHAF  511
            ++ S+  A + L+L K  LK  K+     + + +  ++  +W +  +W PCPIG  P +F
Sbjct  436  EQGSVENATETLELFKVQLKRQKNGGTEGSFSTSTPKKHDRWSIAKSWTPCPIGTAPCSF  495

Query  510  SSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES  331
            SS   LP  D   +     ++S  +       +HS+R      E  D S  +  R+  E 
Sbjct  496  SSCAVLPAFDSIGH----EQNSTLEHGTFEEVDHSERFEPQPEELEDESILEMPRSSPE-  550

Query  330  SHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             +E+ D       ++G L++GG WK V  +EL  I S +++L+
Sbjct  551  -NEISDVKELMCPLKGRLLVGGFWKMVDEEELLLIKSKMKILL  592



>tpg|DAA57195.1| TPA: hypothetical protein ZEAMMB73_455150 [Zea mays]
Length=592

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = -3

Query  678  QEESLSQAGKKLQLIK--LKSMKSNKVNKTQNHAGVRR--QWVVTDNWRPCPIGMIPHAF  511
            ++ S+  A + L+L K  LK  K+     + + +  ++  +W +  +W PCPIG  P +F
Sbjct  436  EQGSVENATETLELFKVQLKRQKNGGTEGSFSTSTPKKHDRWSIAKSWTPCPIGTAPCSF  495

Query  510  SSSGRLPILDCNANCTEVSKSSNPKECQLSNENHSKRVAESAIECLDNSHHKKMRAETES  331
            SS   LP  D   +     ++S  +       +HS+R      E  D S  +  R+  E 
Sbjct  496  SSCAVLPAFDSIGH----EQNSTLEHGTFEEVDHSERFEPQPEELEDESILEMPRSSPE-  550

Query  330  SHELDDTS--AAGIEGCLMIGGEWKKVTADELQAIASSVRMLV  208
             +E+ D       ++G L++GG WK V  +EL  I S +++L+
Sbjct  551  -NEISDVKELMCPLKGRLLVGGFWKMVDEEELLLIKSKMKILL  592



>ref|NP_001044572.2| Os01g0807800 [Oryza sativa Japonica Group]
 dbj|BAD68071.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG89541.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55552.1| hypothetical protein OsJ_03810 [Oryza sativa Japonica Group]
 dbj|BAF06486.2| Os01g0807800 [Oryza sativa Japonica Group]
Length=167

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 10/77 (13%)
 Frame = -3

Query  684  SRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAG---------VRRQWVVTDNWRPCPI  532
            S++ ES  +A +KL++ K   +K   V   +N  G          R +W +T +W PC I
Sbjct  31   SKEIESADRATEKLEMFK-SQLKQKDVCLAENGNGGSLNTILLEKRSRWSITKSWTPCAI  89

Query  531  GMIPHAFSSSGRLPILD  481
            GM+P +FSS+  LP LD
Sbjct  90   GMVPCSFSSTAVLPTLD  106



>gb|EEC71671.1| hypothetical protein OsI_04138 [Oryza sativa Indica Group]
Length=168

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 10/77 (13%)
 Frame = -3

Query  684  SRQEESLSQAGKKLQLIKLKSMKSNKVNKTQNHAG---------VRRQWVVTDNWRPCPI  532
            S++ ES  +A +KL++ K   +K   V   +N  G          R +W +T +W PC I
Sbjct  31   SKEIESADRATEKLEMFK-SQLKQKDVCLAENGNGGSLNTILLEKRSRWSITKSWTPCAI  89

Query  531  GMIPHAFSSSGRLPILD  481
            GM+P +FSS+  LP LD
Sbjct  90   GMVPCSFSSTAVLPTLD  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1840026230422