BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4164

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    138   2e-33   Sesamum indicum [beniseed]
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                138   2e-33   Sesamum indicum [beniseed]
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                124   2e-28   Erythranthe guttata [common monkey flower]
emb|CDP18959.1|  unnamed protein product                                123   3e-28   Coffea canephora [robusta coffee]
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    116   9e-26   
emb|CDP05558.1|  unnamed protein product                                116   9e-26   Coffea canephora [robusta coffee]
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    115   2e-25   Solanum lycopersicum
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...    113   6e-25   Nicotiana sylvestris
emb|CDP00592.1|  unnamed protein product                                113   1e-24   Coffea canephora [robusta coffee]
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...    106   7e-24   
emb|CDP16255.1|  unnamed protein product                                110   8e-24   Coffea canephora [robusta coffee]
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...    110   1e-23   Nicotiana tomentosiformis
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211    105   3e-23   Nicotiana sylvestris
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg                107   9e-23   Erythranthe guttata [common monkey flower]
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...    102   3e-22   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    105   3e-22   Sesamum indicum [beniseed]
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...    103   5e-22   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...    103   5e-22   Nicotiana sylvestris
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    104   1e-21   Nicotiana sylvestris
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...    103   3e-21   Nicotiana sylvestris
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...    101   6e-21   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    101   9e-21   
ref|NP_001234202.1|  NRC1                                               101   1e-20   Solanum lycopersicum
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    100   2e-20   Sesamum indicum [beniseed]
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    100   2e-20   Sesamum indicum [beniseed]
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                100   3e-20   Erythranthe guttata [common monkey flower]
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg                100   3e-20   Erythranthe guttata [common monkey flower]
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    100   3e-20   Nicotiana sylvestris
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    100   3e-20   Nicotiana sylvestris
emb|CDP05499.1|  unnamed protein product                              99.4    6e-20   Coffea canephora [robusta coffee]
emb|CDP11611.1|  unnamed protein product                              99.0    7e-20   Coffea canephora [robusta coffee]
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg              98.2    9e-20   Erythranthe guttata [common monkey flower]
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  97.4    2e-19   Nicotiana tomentosiformis
gb|ABJ99598.1|  NBS-LRR type resistance protein                       97.4    2e-19   Beta vulgaris [beet]
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...  97.4    3e-19   Nicotiana sylvestris
ref|XP_011072180.1|  PREDICTED: putative late blight resistance p...  97.4    3e-19   
gb|ABJ99601.1|  NBS-LRR type resistance protein                       97.4    3e-19   Beta vulgaris [beet]
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...  96.7    5e-19   Nicotiana tomentosiformis
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...  96.3    7e-19   Solanum lycopersicum
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...  94.7    2e-18   Solanum tuberosum [potatoes]
ref|XP_004234046.1|  PREDICTED: putative late blight resistance p...  94.7    2e-18   Solanum lycopersicum
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...  93.2    6e-18   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  87.8    2e-17   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...  91.7    2e-17   Sesamum indicum [beniseed]
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  91.7    3e-17   Solanum lycopersicum
emb|CDP08024.1|  unnamed protein product                              90.5    4e-17   Coffea canephora [robusta coffee]
emb|CDP04724.1|  unnamed protein product                              90.1    5e-17   Coffea canephora [robusta coffee]
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  90.5    5e-17   Sesamum indicum [beniseed]
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  90.5    5e-17   Solanum tuberosum [potatoes]
gb|AAT39951.2|  Disease resistance protein, putative                  90.5    7e-17   Solanum demissum
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  84.7    2e-16   
emb|CDP20211.1|  unnamed protein product                              88.6    2e-16   Coffea canephora [robusta coffee]
emb|CDP08038.1|  unnamed protein product                              89.0    2e-16   Coffea canephora [robusta coffee]
ref|XP_009603189.1|  PREDICTED: uncharacterized protein LOC104098223  85.5    3e-16   
emb|CDP05514.1|  unnamed protein product                              88.2    3e-16   Coffea canephora [robusta coffee]
ref|XP_004236958.1|  PREDICTED: putative late blight resistance p...  88.2    3e-16   Solanum lycopersicum
gb|EYU40383.1|  hypothetical protein MIMGU_mgv1a001106mg              88.2    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  84.3    3e-16   
emb|CDP16256.1|  unnamed protein product                              87.4    4e-16   Coffea canephora [robusta coffee]
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...  87.8    5e-16   Nicotiana sylvestris
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  84.0    5e-16   Nicotiana sylvestris
emb|CDP08032.1|  unnamed protein product                              85.9    5e-16   Coffea canephora [robusta coffee]
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  87.4    6e-16   Sesamum indicum [beniseed]
gb|AAT40487.1|  putative disease resistance protein                   87.8    7e-16   Solanum demissum
ref|XP_011076796.1|  PREDICTED: putative late blight resistance p...  87.0    7e-16   Sesamum indicum [beniseed]
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  87.0    7e-16   Nicotiana sylvestris
gb|EYU40385.1|  hypothetical protein MIMGU_mgv1a007613mg              85.1    8e-16   Erythranthe guttata [common monkey flower]
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...  85.1    1e-15   Sesamum indicum [beniseed]
ref|XP_009604446.1|  PREDICTED: putative late blight resistance p...  85.9    1e-15   
gb|EYU39490.1|  hypothetical protein MIMGU_mgv1a0204861mg             84.0    2e-15   Erythranthe guttata [common monkey flower]
emb|CDP16500.1|  unnamed protein product                              85.5    2e-15   Coffea canephora [robusta coffee]
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...  85.9    2e-15   Sesamum indicum [beniseed]
emb|CDP08040.1|  unnamed protein product                              84.3    4e-15   Coffea canephora [robusta coffee]
emb|CDP05521.1|  unnamed protein product                              84.3    6e-15   Coffea canephora [robusta coffee]
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              83.6    9e-15   Erythranthe guttata [common monkey flower]
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              83.6    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_009596917.1|  PREDICTED: disease resistance protein RPP13-...  83.2    1e-14   Nicotiana tomentosiformis
emb|CDP05594.1|  unnamed protein product                              83.2    2e-14   Coffea canephora [robusta coffee]
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  82.8    2e-14   Sesamum indicum [beniseed]
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              82.8    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  82.4    2e-14   Sesamum indicum [beniseed]
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  82.4    2e-14   Solanum lycopersicum
emb|CDP00590.1|  unnamed protein product                              82.4    2e-14   Coffea canephora [robusta coffee]
emb|CDP21300.1|  unnamed protein product                              82.8    2e-14   Coffea canephora [robusta coffee]
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  82.4    2e-14   
emb|CDP16841.1|  unnamed protein product                              82.0    3e-14   Coffea canephora [robusta coffee]
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  82.0    3e-14   Nicotiana tomentosiformis
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  82.4    3e-14   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg              81.6    4e-14   Erythranthe guttata [common monkey flower]
emb|CDP11160.1|  unnamed protein product                              82.0    4e-14   Coffea canephora [robusta coffee]
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  81.3    5e-14   Sesamum indicum [beniseed]
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  81.3    5e-14   Sesamum indicum [beniseed]
emb|CDP11831.1|  unnamed protein product                              81.3    5e-14   Coffea canephora [robusta coffee]
emb|CDP12797.1|  unnamed protein product                              81.3    7e-14   Coffea canephora [robusta coffee]
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  81.3    7e-14   Sesamum indicum [beniseed]
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  80.9    8e-14   
emb|CDP08033.1|  unnamed protein product                              80.5    9e-14   Coffea canephora [robusta coffee]
ref|XP_006355046.1|  PREDICTED: putative late blight resistance p...  80.5    9e-14   Solanum tuberosum [potatoes]
emb|CDP04880.1|  unnamed protein product                              80.5    1e-13   Coffea canephora [robusta coffee]
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  80.5    1e-13   Nicotiana sylvestris
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  80.5    1e-13   Nicotiana sylvestris
emb|CDP00589.1|  unnamed protein product                              80.1    1e-13   Coffea canephora [robusta coffee]
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  80.1    1e-13   Nicotiana sylvestris
ref|XP_009626721.1|  PREDICTED: putative late blight resistance p...  80.1    1e-13   Nicotiana tomentosiformis
emb|CDP11186.1|  unnamed protein product                              80.5    1e-13   Coffea canephora [robusta coffee]
emb|CDP05441.1|  unnamed protein product                              80.1    1e-13   Coffea canephora [robusta coffee]
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  80.1    2e-13   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana tomentosiformis
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   
ref|XP_009778434.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana sylvestris
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  80.1    2e-13   Nicotiana sylvestris
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  79.3    2e-13   Sesamum indicum [beniseed]
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...  79.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...  79.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  79.3    2e-13   Sesamum indicum [beniseed]
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  79.3    3e-13   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  79.0    3e-13   Nicotiana sylvestris
gb|AAT39932.2|  NB-ARC domain containing protein                      79.0    3e-13   Solanum demissum
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  79.0    3e-13   Sesamum indicum [beniseed]
ref|XP_009761103.1|  PREDICTED: putative late blight resistance p...  79.0    3e-13   Nicotiana sylvestris
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...  79.0    4e-13   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...  79.0    4e-13   Nicotiana tomentosiformis
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...  79.0    4e-13   
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     77.0    4e-13   Nicotiana sylvestris
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  78.6    5e-13   Nicotiana sylvestris
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  78.2    5e-13   Sesamum indicum [beniseed]
ref|XP_009591232.1|  PREDICTED: putative late blight resistance p...  78.2    5e-13   Nicotiana tomentosiformis
emb|CDP10671.1|  unnamed protein product                              78.2    5e-13   Coffea canephora [robusta coffee]
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  78.6    5e-13   Nicotiana sylvestris
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  78.2    6e-13   Sesamum indicum [beniseed]
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...  78.2    6e-13   Nicotiana tomentosiformis
ref|XP_009797674.1|  PREDICTED: putative late blight resistance p...  77.8    6e-13   Nicotiana sylvestris
gb|EYU23506.1|  hypothetical protein MIMGU_mgv1a001122mg              77.8    7e-13   Erythranthe guttata [common monkey flower]
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  77.8    7e-13   Sesamum indicum [beniseed]
gb|EYU23519.1|  hypothetical protein MIMGU_mgv1a022028mg              77.8    7e-13   Erythranthe guttata [common monkey flower]
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  77.4    8e-13   Nicotiana sylvestris
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  77.8    8e-13   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              77.8    8e-13   Erythranthe guttata [common monkey flower]
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...  77.8    8e-13   Nicotiana tomentosiformis
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  77.4    1e-12   Sesamum indicum [beniseed]
emb|CDP10805.1|  unnamed protein product                              77.4    1e-12   Coffea canephora [robusta coffee]
ref|XP_009620237.1|  PREDICTED: putative late blight resistance p...  77.4    1e-12   Nicotiana tomentosiformis
gb|AET22504.1|  hypothetical protein                                  77.0    1e-12   Solanum lycopersicum
gb|EYU23504.1|  hypothetical protein MIMGU_mgv1a021434mg              77.0    1e-12   Erythranthe guttata [common monkey flower]
gb|AEW48197.1|  disease resistance protein RGH3                       77.0    1e-12   Solanum x edinense
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg              74.7    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   Nicotiana sylvestris
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
emb|CDP05538.1|  unnamed protein product                              77.4    1e-12   Coffea canephora [robusta coffee]
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   Nicotiana tomentosiformis
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
emb|CDP13440.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_009603761.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   Nicotiana tomentosiformis
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   Solanum lycopersicum
ref|XP_009603760.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
emb|CDP11161.1|  unnamed protein product                              77.0    1e-12   Coffea canephora [robusta coffee]
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  77.0    1e-12   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  76.3    1e-12   Sesamum indicum [beniseed]
emb|CDP11157.1|  unnamed protein product                              76.6    2e-12   Coffea canephora [robusta coffee]
emb|CDP11825.1|  unnamed protein product                              77.0    2e-12   Coffea canephora [robusta coffee]
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  77.0    2e-12   Solanum tuberosum [potatoes]
ref|XP_011087137.1|  PREDICTED: putative late blight resistance p...  76.6    2e-12   Sesamum indicum [beniseed]
ref|XP_004237189.1|  PREDICTED: putative late blight resistance p...  76.6    2e-12   Solanum lycopersicum
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  76.3    2e-12   Solanum tuberosum [potatoes]
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg              76.3    2e-12   Erythranthe guttata [common monkey flower]
emb|CDP20153.1|  unnamed protein product                              76.6    2e-12   Coffea canephora [robusta coffee]
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  76.3    2e-12   Solanum tuberosum [potatoes]
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  76.3    3e-12   Solanum tuberosum [potatoes]
emb|CDP21316.1|  unnamed protein product                              72.4    3e-12   Coffea canephora [robusta coffee]
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...  75.9    3e-12   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  75.9    3e-12   Sesamum indicum [beniseed]
emb|CDP00736.1|  unnamed protein product                              75.9    3e-12   Coffea canephora [robusta coffee]
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  75.9    3e-12   Nicotiana sylvestris
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  75.9    3e-12   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  76.3    3e-12   
ref|XP_010320671.1|  PREDICTED: uncharacterized protein LOC101257665  76.3    3e-12   
gb|EPS70910.1|  hypothetical protein M569_03853                       75.5    4e-12   Genlisea aurea
emb|CDP04878.1|  unnamed protein product                              75.9    4e-12   Coffea canephora [robusta coffee]
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              75.5    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_009788462.1|  PREDICTED: putative late blight resistance p...  75.5    5e-12   Nicotiana sylvestris
ref|XP_009800556.1|  PREDICTED: putative late blight resistance p...  75.5    5e-12   Nicotiana sylvestris
emb|CDP10800.1|  unnamed protein product                              75.5    5e-12   Coffea canephora [robusta coffee]
ref|XP_009608248.1|  PREDICTED: putative late blight resistance p...  74.3    5e-12   
ref|XP_010320926.1|  PREDICTED: putative late blight resistance p...  75.5    5e-12   
ref|XP_009800554.1|  PREDICTED: putative late blight resistance p...  75.5    5e-12   Nicotiana sylvestris
emb|CDP17920.1|  unnamed protein product                              75.5    5e-12   Coffea canephora [robusta coffee]
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   
emb|CDP05534.1|  unnamed protein product                              75.1    5e-12   Coffea canephora [robusta coffee]
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...  75.5    5e-12   Solanum lycopersicum
emb|CDP00696.1|  unnamed protein product                              70.1    5e-12   Coffea canephora [robusta coffee]
gb|AAC49408.1|  PRF                                                   75.5    5e-12   Solanum lycopersicum
gb|AAF76312.1|AF220603_4  Prf                                         75.5    5e-12   Solanum lycopersicum
gb|AAF76308.1|  Prf                                                   75.5    6e-12   Solanum pimpinellifolium [currant tomato]
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  75.1    6e-12   
emb|CDP00692.1|  unnamed protein product                              75.1    6e-12   Coffea canephora [robusta coffee]
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  75.1    6e-12   Solanum tuberosum [potatoes]
gb|EYU17763.1|  hypothetical protein MIMGU_mgv1a002610mg              74.7    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  74.7    7e-12   Nicotiana sylvestris
emb|CDP04885.1|  unnamed protein product                              74.7    7e-12   Coffea canephora [robusta coffee]
ref|XP_009777062.1|  PREDICTED: putative late blight resistance p...  75.1    7e-12   Nicotiana sylvestris
ref|XP_009777064.1|  PREDICTED: putative late blight resistance p...  75.1    7e-12   Nicotiana sylvestris
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              74.7    7e-12   Erythranthe guttata [common monkey flower]
ref|XP_009777063.1|  PREDICTED: putative late blight resistance p...  74.7    8e-12   Nicotiana sylvestris
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...  74.7    8e-12   Nicotiana sylvestris
emb|CDP11974.1|  unnamed protein product                              74.7    8e-12   Coffea canephora [robusta coffee]
emb|CDP11163.1|  unnamed protein product                              74.7    9e-12   Coffea canephora [robusta coffee]
emb|CDP10323.1|  unnamed protein product                              74.3    9e-12   Coffea canephora [robusta coffee]
emb|CDP08023.1|  unnamed protein product                              74.7    1e-11   Coffea canephora [robusta coffee]
emb|CDP07957.1|  unnamed protein product                              74.3    1e-11   Coffea canephora [robusta coffee]
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...  73.6    1e-11   Nicotiana tomentosiformis
emb|CDP04753.1|  unnamed protein product                              74.3    1e-11   Coffea canephora [robusta coffee]
emb|CDP08019.1|  unnamed protein product                              74.3    1e-11   Coffea canephora [robusta coffee]
emb|CDP13141.1|  unnamed protein product                              73.9    1e-11   Coffea canephora [robusta coffee]
gb|AAF76163.1|AF266747_1  RGC1                                        74.3    1e-11   Solanum tuberosum [potatoes]
gb|EPS69725.1|  hypothetical protein M569_05040                       69.3    1e-11   Genlisea aurea
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   Nicotiana sylvestris
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   Nicotiana tomentosiformis
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  73.6    2e-11   Solanum lycopersicum
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg              73.6    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg              73.6    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   Solanum lycopersicum
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg              73.6    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   Nicotiana sylvestris
ref|XP_009594808.1|  PREDICTED: putative late blight resistance p...  70.9    2e-11   
emb|CDP19489.1|  unnamed protein product                              73.6    2e-11   Coffea canephora [robusta coffee]
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Sesamum indicum [beniseed]
emb|CDP11636.1|  unnamed protein product                              73.2    2e-11   Coffea canephora [robusta coffee]
emb|CDP12799.1|  unnamed protein product                              73.2    2e-11   Coffea canephora [robusta coffee]
ref|XP_006349898.1|  PREDICTED: putative late blight resistance p...  72.0    2e-11   Solanum tuberosum [potatoes]
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg              73.2    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  73.2    2e-11   Nicotiana sylvestris
ref|XP_009610033.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Nicotiana tomentosiformis
gb|AEW48212.1|  disease resistance protein RGH1                       72.8    3e-11   Solanum leptophyes x Solanum sparsipilum
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Solanum tuberosum [potatoes]
ref|XP_009610032.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Nicotiana tomentosiformis
ref|XP_011071970.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Sesamum indicum [beniseed]
emb|CDP12798.1|  unnamed protein product                              73.2    3e-11   Coffea canephora [robusta coffee]
emb|CDP10809.1|  unnamed protein product                              72.4    3e-11   Coffea canephora [robusta coffee]
ref|XP_006360433.1|  PREDICTED: putative late blight resistance p...  71.6    3e-11   
ref|XP_004236959.1|  PREDICTED: putative late blight resistance p...  72.8    3e-11   Solanum lycopersicum
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg              72.8    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_009793040.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
emb|CDP18680.1|  unnamed protein product                              72.8    4e-11   Coffea canephora [robusta coffee]
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  72.8    4e-11   Nicotiana sylvestris
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  72.4    4e-11   Solanum lycopersicum
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  72.4    4e-11   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  72.4    5e-11   Nicotiana tomentosiformis
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  72.4    5e-11   Nicotiana tomentosiformis
gb|AEW48209.1|  disease resistance protein RGH5                       72.0    5e-11   Solanum huancabambense
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  72.4    5e-11   Nicotiana tomentosiformis
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana sylvestris
emb|CDP08021.1|  unnamed protein product                              72.0    5e-11   Coffea canephora [robusta coffee]
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana tomentosiformis
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana tomentosiformis
emb|CDP08020.1|  unnamed protein product                              72.4    5e-11   Coffea canephora [robusta coffee]
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana tomentosiformis
gb|EYU39491.1|  hypothetical protein MIMGU_mgv1a019343mg              72.0    5e-11   Erythranthe guttata [common monkey flower]
emb|CDP19132.1|  unnamed protein product                              72.4    5e-11   Coffea canephora [robusta coffee]
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana tomentosiformis
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   Nicotiana tomentosiformis
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  72.0    5e-11   
ref|XP_009594795.1|  PREDICTED: putative late blight resistance p...  72.0    6e-11   
gb|AEW48205.1|  disease resistance protein RGH2                       71.6    6e-11   
emb|CDP08396.1|  unnamed protein product                              71.6    7e-11   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  72.0    7e-11   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   
ref|XP_010320777.1|  PREDICTED: putative late blight resistance p...  71.2    7e-11   
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...  71.2    7e-11   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  71.6    8e-11   
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  71.6    8e-11   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  71.6    8e-11   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  71.6    9e-11   
emb|CDP16498.1|  unnamed protein product                              71.2    1e-10   
ref|XP_009622529.1|  PREDICTED: putative late blight resistance p...  71.2    1e-10   
gb|EYU34208.1|  hypothetical protein MIMGU_mgv1a026654mg              71.2    1e-10   
emb|CDP10797.1|  unnamed protein product                              71.2    1e-10   
gb|EYU17742.1|  hypothetical protein MIMGU_mgv1a023281mg              70.9    1e-10   
gb|AAL17826.1|  GPA2-like NBS-LRR protein                             70.5    1e-10   
emb|CDP17260.1|  unnamed protein product                              71.2    1e-10   
emb|CDP12821.1|  unnamed protein product                              71.2    1e-10   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  71.2    1e-10   
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   
emb|CDP21314.1|  unnamed protein product                              68.6    1e-10   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg              70.9    1e-10   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  70.9    1e-10   
emb|CDP16510.1|  unnamed protein product                              70.9    1e-10   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   
emb|CDP18040.1|  unnamed protein product                              70.9    2e-10   
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  70.5    2e-10   
emb|CDP18682.1|  unnamed protein product                              70.5    2e-10   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  70.5    2e-10   
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  69.3    2e-10   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   
ref|XP_009763714.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   
gb|EPS64032.1|  hypothetical protein M569_10749                       68.2    2e-10   
ref|XP_011071886.1|  PREDICTED: uncharacterized protein LOC105157233  68.9    2e-10   
ref|XP_009630452.1|  PREDICTED: putative late blight resistance p...  69.7    3e-10   
emb|CDP10807.1|  unnamed protein product                              69.7    3e-10   
ref|XP_009803469.1|  PREDICTED: putative late blight resistance p...  68.2    3e-10   
emb|CDP20519.1|  unnamed protein product                              69.7    3e-10   
gb|ABY61746.1|  resistance protein PSH-RGH7                           69.7    3e-10   
ref|XP_011072559.1|  PREDICTED: putative late blight resistance p...  68.2    4e-10   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...  69.3    4e-10   
gb|EYU23536.1|  hypothetical protein MIMGU_mgv1a001875mg              69.3    4e-10   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
ref|XP_009623262.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
ref|XP_009776932.1|  PREDICTED: putative late blight resistance p...  65.9    4e-10   
ref|XP_009777479.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
emb|CDP00687.1|  unnamed protein product                              68.6    4e-10   
gb|EYU24353.1|  hypothetical protein MIMGU_mgv1a022376mg              68.9    4e-10   
gb|EYU17693.1|  hypothetical protein MIMGU_mgv1a001245mg              68.9    4e-10   
ref|XP_009622940.1|  PREDICTED: putative late blight resistance p...  68.9    4e-10   
ref|XP_009777477.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
emb|CDP20607.1|  unnamed protein product                              68.9    4e-10   
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...  68.9    5e-10   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  68.9    5e-10   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  68.9    5e-10   
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...  68.9    5e-10   
emb|CDP10810.1|  unnamed protein product                              68.9    5e-10   
ref|XP_009783489.1|  PREDICTED: putative late blight resistance p...  68.9    5e-10   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              68.9    6e-10   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  68.9    6e-10   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  68.6    6e-10   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             68.6    6e-10   
gb|EYU17685.1|  hypothetical protein MIMGU_mgv1a023037mg              68.6    6e-10   
emb|CDP00737.1|  unnamed protein product                              68.6    6e-10   
ref|XP_009784114.1|  PREDICTED: uncharacterized protein LOC104232578  65.9    6e-10   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  68.6    6e-10   
emb|CDP11642.1|  unnamed protein product                              68.9    7e-10   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  68.6    7e-10   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  68.9    7e-10   
emb|CDP21622.1|  unnamed protein product                              68.6    7e-10   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  68.6    7e-10   
emb|CDP15990.1|  unnamed protein product                              68.6    7e-10   
emb|CDP16512.1|  unnamed protein product                              68.6    7e-10   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  68.6    8e-10   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              68.2    8e-10   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...  68.6    8e-10   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...  68.6    8e-10   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    8e-10   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    8e-10   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    8e-10   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    8e-10   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  68.2    8e-10   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    9e-10   
emb|CDP15268.1|  unnamed protein product                              68.6    9e-10   
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  65.5    9e-10   
gb|AEW48206.1|  disease resistance protein RGH4                       68.2    9e-10   
emb|CDP10799.1|  unnamed protein product                              68.2    9e-10   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              68.2    9e-10   
ref|XP_009796331.1|  PREDICTED: late blight resistance protein R1...  67.8    9e-10   
emb|CDP00690.1|  unnamed protein product                              67.8    1e-09   
gb|AEW48198.1|  disease resistance protein RGH4                       68.2    1e-09   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
emb|CDP00758.1|  unnamed protein product                              68.2    1e-09   
emb|CDP16115.1|  unnamed protein product                              67.8    1e-09   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              67.8    1e-09   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              67.4    1e-09   
emb|CDP17919.1|  unnamed protein product                              67.8    1e-09   
gb|AAV31175.1|  Putative disease resistance protein, identical        67.8    1e-09   
ref|XP_009757879.1|  PREDICTED: putative late blight resistance p...  67.8    1e-09   
emb|CDP19634.1|  unnamed protein product                              67.8    1e-09   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              67.4    2e-09   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
gb|EYU24406.1|  hypothetical protein MIMGU_mgv1a002161mg              67.4    2e-09   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
emb|CDP00693.1|  unnamed protein product                              63.9    2e-09   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
sp|Q6L3Z0.1|R1B13_SOLDE  RecName: Full=Putative late blight resis...  67.0    2e-09   
emb|CDP15581.1|  unnamed protein product                              67.0    2e-09   
emb|CDP19728.1|  unnamed protein product                              67.0    2e-09   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...  66.6    2e-09   
emb|CDP15705.1|  unnamed protein product                              67.0    2e-09   
gb|AAT40519.2|  hypothetical protein SDM1_22t00007                    67.0    2e-09   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              66.6    3e-09   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  66.2    3e-09   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  65.9    3e-09   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              66.6    3e-09   
ref|XP_009792722.1|  PREDICTED: putative late blight resistance p...  66.6    3e-09   
emb|CDP19994.1|  unnamed protein product                              66.6    3e-09   
gb|AEW48216.1|  disease resistance protein RX3                        66.6    3e-09   
ref|XP_009774297.1|  PREDICTED: putative late blight resistance p...  66.6    3e-09   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  66.6    3e-09   
emb|CDP10806.1|  unnamed protein product                              66.2    3e-09   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  66.2    3e-09   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  66.2    3e-09   
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg             66.2    4e-09   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg              66.2    4e-09   
gb|AEW48201.1|  disease resistance protein RGH9                       66.2    4e-09   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  66.2    4e-09   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  66.2    4e-09   
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...  66.2    4e-09   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg              66.2    4e-09   
emb|CDP04756.1|  unnamed protein product                              66.2    4e-09   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...  65.9    4e-09   
gb|AEW48190.1|  disease resistance protein RX4                        65.9    4e-09   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  65.9    4e-09   
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg              66.2    5e-09   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              65.9    5e-09   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  65.9    5e-09   
emb|CAB56299.1|  NBS-LRR protein                                      65.9    5e-09   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg              65.9    5e-09   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              65.9    5e-09   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg              65.9    5e-09   
gb|EYU17764.1|  hypothetical protein MIMGU_mgv1a026345mg              65.9    5e-09   
ref|XP_009619371.1|  PREDICTED: putative late blight resistance p...  65.9    5e-09   
ref|XP_009604647.1|  PREDICTED: putative late blight resistance p...  65.1    6e-09   
gb|AEW48217.1|  disease resistance protein RX5                        65.9    6e-09   
emb|CAB50786.1|  Rx protein                                           65.9    6e-09   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  65.9    6e-09   
ref|XP_009619372.1|  PREDICTED: putative late blight resistance p...  65.5    6e-09   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...  65.5    6e-09   
gb|EYU23566.1|  hypothetical protein MIMGU_mgv1a020047mg              65.5    6e-09   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  65.5    6e-09   
gb|EYU24408.1|  hypothetical protein MIMGU_mgv1a022062mg              65.5    6e-09   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg              65.5    7e-09   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_009797471.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_004239388.2|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  65.1    7e-09   
ref|XP_010320684.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
gb|AEW48218.1|  disease resistance protein RX6                        65.5    7e-09   
gb|AEW48200.1|  disease resistance protein RGH7                       65.5    7e-09   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
ref|XP_009788554.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              65.5    8e-09   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              65.1    8e-09   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              64.7    8e-09   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              65.1    8e-09   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              65.1    8e-09   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  65.1    8e-09   
gb|EYU38159.1|  hypothetical protein MIMGU_mgv1a025995mg              65.1    9e-09   
sp|Q6L440.2|R1A3_SOLDE  RecName: Full=Putative late blight resist...  65.1    9e-09   
ref|XP_011072171.1|  PREDICTED: putative late blight resistance p...  65.1    9e-09   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              65.1    9e-09   
ref|XP_009601833.1|  PREDICTED: putative late blight resistance p...  64.7    9e-09   
emb|CDP08428.1|  unnamed protein product                              65.1    9e-09   
ref|XP_009604639.1|  PREDICTED: putative late blight resistance p...  64.7    9e-09   
gb|ABO92983.1|  putative disease resistance protein                   65.1    9e-09   
ref|XP_009792813.1|  PREDICTED: putative late blight resistance p...  64.7    1e-08   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              65.1    1e-08   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   
emb|CDP18676.1|  unnamed protein product                              65.1    1e-08   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   
emb|CDP11649.1|  unnamed protein product                              65.1    1e-08   
ref|XP_009757967.1|  PREDICTED: putative late blight resistance p...  64.7    1e-08   
emb|CDP17914.1|  unnamed protein product                              64.7    1e-08   
emb|CDO99208.1|  unnamed protein product                              64.7    1e-08   
emb|CDP12770.1|  unnamed protein product                              64.7    1e-08   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  64.7    1e-08   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              64.7    1e-08   
ref|XP_009763464.1|  PREDICTED: putative late blight resistance p...  64.7    1e-08   
emb|CDP20463.1|  unnamed protein product                              64.7    1e-08   
ref|NP_001234836.1|  hero resistance protein 1 homologue              64.7    1e-08   
gb|AEW48207.1|  disease resistance protein RGH5                       64.7    1e-08   
ref|XP_006362543.1|  PREDICTED: putative late blight resistance p...  64.7    1e-08   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              64.3    1e-08   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  64.3    1e-08   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg              64.3    1e-08   



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW  +  LG L  LE+LKLK++A KGE+W+  +  F++LR L IGR+DLV W      F
Sbjct  760  LDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHF  819

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------Q  360
            P L  L++ HC+SLEA+P  F D+ SL+++EL+CT + AAASAR I+E+K         +
Sbjct  820  PRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVEQSTR  879

Query  359  GDGFDLSIYPP  327
            G GF LSIYPP
Sbjct  880  GTGFKLSIYPP  890



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW  +  LG L  LE+LKLK++A KGE+W+  +  F++LR L IGR+DLV W      F
Sbjct  760  LDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHF  819

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------Q  360
            P L  L++ HC+SLEA+P  F D+ SL+++EL+CT + AAASAR I+E+K         +
Sbjct  820  PRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKKKQMQVEQSTR  879

Query  359  GDGFDLSIYPP  327
            G GF LSIYPP
Sbjct  880  GTGFKLSIYPP  890



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 10/132 (8%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS-  516
            ++WK +  LG L  LEVLKLK++A KGE+W+  +  F+ LR L IGRT+LV W     + 
Sbjct  760  LEWKDMSTLGMLENLEVLKLKDNAFKGEWWKTEDGGFRGLRVLHIGRTNLVTWNVASGNH  819

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------  363
            FP L  L+L HC  L ++PL F DV  L+V++++CTN+  AASAR I  +K         
Sbjct  820  FPRLRHLFLKHCGYLASLPLVFGDVVCLQVVDIYCTNESVAASARKIEGRKMELQGKQSG  879

Query  362  QGDGFDLSIYPP  327
            +G+GF LS+YPP
Sbjct  880  RGNGFKLSVYPP  891



>emb|CDP18959.1| unnamed protein product [Coffea canephora]
Length=890

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DWKH+  LG L +LEVLKLK++A +GE W      F++L+ L IG T+LV W    S FP
Sbjct  758  DWKHMSTLGKLEKLEVLKLKDNAFQGELWRTEGGGFRNLKVLHIGSTNLVMWKALASHFP  817

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----------EQKQ  360
             L  L+L HCT LEAVP    D+ +L+ ++L+CTN   A SAR I+          + K+
Sbjct  818  ILRSLFLRHCTKLEAVPSGLGDIATLQEIDLYCTNSMVAKSARNIQVLKLKVQANDKNKR  877

Query  359  GDGFDLSIYPP  327
            G  F LS+YPP
Sbjct  878  GAAFKLSVYPP  888



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW HI  LG L  LEVLKLK+ A KG  WE  +  F+ LR L IGRT+L  W      F
Sbjct  759  LDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNASGHHF  818

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ-GD----GF  348
            P L +++L HC+SL  +P    +V SL+ MELF     AAASAR I+++KQ GD     F
Sbjct  819  PRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAAASARFIQQEKQKGDIKDNVF  878

Query  347  DLSIYPP  327
             L IYPP
Sbjct  879  KLVIYPP  885



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 75/128 (59%), Gaps = 6/128 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW  +  LG L  LEVLKLK+ A KG  WE  +  F+ LR L +GR+DLV W      F
Sbjct  759  LDWSEMSTLGMLPNLEVLKLKDYAFKGSRWEPLDGGFRLLRVLQLGRSDLVHWHASSHHF  818

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGD------G  351
            P L ++ L HCT LE +P  F +V +L+ MEL+     AAASAR I+ QKQ D       
Sbjct  819  PRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAAASARLIQHQKQQDQRMVNSA  878

Query  350  FDLSIYPP  327
            F L IYPP
Sbjct  879  FKLLIYPP  886



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW HI  LG L  LEVLKLK+ A KG  WE  +  F+ LR L IGRT+L  W      F
Sbjct  759  LDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNASGHHF  818

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ-GD----GF  348
            P L +++L HC+SL  +P    +V SL+ +ELF     AAASAR I+++KQ GD     F
Sbjct  819  PRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAASARIIQQEKQEGDIKDNVF  878

Query  347  DLSIYPP  327
             L IYPP
Sbjct  879  KLVIYPP  885



>ref|XP_009798793.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=704

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = -3

Query  692  IDWKH-ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS  516
            +DW H + +LG L  LEVLKLKE+A KGEYWE     F SL+ L I RTDL  W     +
Sbjct  569  LDWDHDMSILGQLQYLEVLKLKENAFKGEYWEPKVGGFGSLQVLWIQRTDLAAWHASADN  628

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------  363
            FP L +L L  C  L  +PL   DV+SL+VMEL  T K AA  AR I+ +K         
Sbjct  629  FPRLKRLVLVSCEKLAEIPLGLADVRSLQVMELNVTTKLAAKCARDIQTKKLKQANLEGN  688

Query  362  --QGDGFDLSIYPP  327
              +  GF LSIYPP
Sbjct  689  YIKSSGFKLSIYPP  702



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DWKH+ +LG L  LEVLKLK++A +GE W+     F  L+ L+IG T LV W    S F
Sbjct  798  LDWKHMSILGKLENLEVLKLKDNAFEGERWQTEEGGFLRLQVLNIGSTSLVTWNASASDF  857

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----------  363
            P L  L L HC+ LEA+P     + SL+ +E++CT+  A +SA+ I+  K          
Sbjct  858  PRLRCLVLMHCSKLEAIPHGLAQIASLQAVEVYCTSNAAVSSAKKIQAVKLESQSQQPNT  917

Query  362  --QGDGFDLSIYPPAD  321
              +  GF LS+YPP +
Sbjct  918  GTKSRGFKLSVYPPEE  933



>ref|XP_009618247.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
 ref|XP_009618250.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
Length=255

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L  LEVLKLKE A +G+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  128  EWKDMSILGLLEYLEVLKLKEYAFRGQSWEPEDGGFPRLQVLWIERTDLSSWKASSGNFP  187

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI---REQKQGDGFDLS  339
             L +L L  C +L+ +P    DV++L++MEL  T+  AA SAR I   +++K+G GF LS
Sbjct  188  RLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAKSARAILKKKQEKEGSGFKLS  247

Query  338  IYPP  327
            ++PP
Sbjct  248  VFPP  251



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 76/130 (58%), Gaps = 9/130 (7%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W  + VLG L  LEVLKLK++A KG  W   +  F+SL+FL IG TDLV W   ++  P 
Sbjct  757  WNQMSVLGKLENLEVLKLKDNAFKGNRWRTESGGFQSLQFLHIGSTDLVIWDAAENHLPK  816

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQ-----GD  354
            L  L L HCT L+ VP +F D+ +L++++L CTN   AASA  I     EQ Q      +
Sbjct  817  LKCLVLKHCTELQGVPHSFADISTLQIIDLHCTNHSVAASAMKIYVLKLEQAQQKATKSN  876

Query  353  GFDLSIYPPA  324
             F L +YPP 
Sbjct  877  RFKLFVYPPV  886



>ref|XP_009614965.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
 ref|XP_009614966.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=886

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 76/134 (57%), Gaps = 12/134 (9%)
 Frame = -3

Query  692  IDWKH-ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS  516
            +DW H + +LG L  LEVLKLKE+A KGEYWE     F SL+ L I RTDL  W     +
Sbjct  751  LDWDHDMSILGQLQYLEVLKLKENAFKGEYWEPKVGGFCSLQVLWIQRTDLAAWHASADN  810

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------  363
            FP L +L L  C  L  +PL   DV+SL+VMEL  T   AA  AR I+ +K         
Sbjct  811  FPRLKRLVLVSCEKLTEIPLGLADVRSLQVMELNVTTILAAKCARDIQTKKLKQANLEGN  870

Query  362  --QGDGFDLSIYPP  327
              +  GF LSIYPP
Sbjct  871  GIKSSGFKLSIYPP  884



>ref|XP_009796673.1| PREDICTED: uncharacterized protein LOC104243211 [Nicotiana sylvestris]
Length=270

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L  LEVLKLKE+A  G+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  143  EWKDMSILGLLEYLEVLKLKENAFTGQSWEPEDGGFPRLQVLWIERTDLSSWKASSGNFP  202

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI---REQKQGDGFDLS  339
             L +L L  C +L  +P    DV++L+++EL  T+  AA SAR I   +++K+G GF LS
Sbjct  203  RLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAAKSARAILKKKQEKEGSGFKLS  262

Query  338  IYPP  327
            ++PP
Sbjct  263  VFPP  266



>gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Erythranthe guttata]
Length=643

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 80/126 (63%), Gaps = 3/126 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW H+ +LGSL +L VLKLK++A  GE W+  +  F+ L  L IG T+LV W      F
Sbjct  518  LDWSHMPILGSLEKLIVLKLKDNAFMGEIWKTADGGFRHLEVLHIGPTNLVVWRASDRHF  577

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR--EQKQGDGFDLS  339
            P L +L L +C  L  VP+   D++SL+ +EL C+N  AAASA+ IR  +++Q   F LS
Sbjct  578  PKLRRLELYNCEELVQVPIGLADIQSLQFLELNCSN-FAAASAKKIRNIKKQQVSIFKLS  636

Query  338  IYPPAD  321
            ++PP D
Sbjct  637  VFPPLD  642



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L+ LEVLKLKE+A  G+ WE     F  L+ L I RTDL  W     +FP
Sbjct  210  EWKDMSILGLLDYLEVLKLKENAFTGQSWEPEEGGFPRLQVLWIERTDLSSWKSSCGNFP  269

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI---REQKQGDGFDLS  339
             L +L L  C +L+ +P    DV++L++MEL  T+  AA SAR I   +++K+G GF LS
Sbjct  270  RLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAKSARAILKKKQEKEGSGFKLS  329

Query  338  IYPP  327
            + PP
Sbjct  330  VIPP  333



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 8/130 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW H+  LG L  LEVLKLK+ A KG  WE  +  F+ LR L IGRTDL+ W      F
Sbjct  760  LDWDHMSTLGMLPNLEVLKLKDYAFKGSRWEPLDGGFRLLRVLKIGRTDLIWWDASGHHF  819

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--------QG  357
            P L  +   HC+SLEA+P    +V +L+ MEL      AA SAR I+ QK          
Sbjct  820  PRLQCVVFRHCSSLEAIPSGLAEVSALQNMELHWPKPTAAYSARLIQRQKLQMQQLGLLN  879

Query  356  DGFDLSIYPP  327
              F L IYPP
Sbjct  880  TAFKLFIYPP  889



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + VL  L  L+VLKLK++A KGE+WELN+  F  L  L I R +LV W      F
Sbjct  357  LEWDDMSVLKQLEYLQVLKLKDNAFKGEHWELNDGGFPFLEVLCIERANLVSWNASGDHF  416

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK------QGDG  351
            P L  L++S C  LE +P+   D++SL+VM+L  + K AA SAR I+ +K      +   
Sbjct  417  PRLKHLHIS-CDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAREIQAKKNKLQTAKSQK  475

Query  350  FDLSIYPP  327
            F+LS++PP
Sbjct  476  FELSVFPP  483



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 74/130 (57%), Gaps = 8/130 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + VLG L  LEVLKLK++A KGEYWE     F+SL  L I R+DL  W      F
Sbjct  359  LEWDDMSVLGQLEYLEVLKLKDNAFKGEYWEPKVGGFRSLLVLWIERSDLASWNASSDHF  418

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--------QG  357
            P L +L L  C  LE VP+   D+  L+VMEL  + K+ A SAR I+ +K        + 
Sbjct  419  PRLKRLVLVSCDKLEEVPIGLADICGLQVMELRNSTKQTANSARDIQAKKDKQTQEGAKT  478

Query  356  DGFDLSIYPP  327
              F LSI+PP
Sbjct  479  QRFKLSIFPP  488



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L  LEVLKLKE+A +G+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  757  EWKDMSILGLLEYLEVLKLKENAFRGQSWETKDGGFPRLQVLWIERTDLSSWKASSGNFP  816

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ---GDGFDLS  339
             L +L L  C +L  +P    DV++L+++EL  T+  AA SAR I ++KQ   G GF LS
Sbjct  817  RLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAARSARAILKKKQEKVGSGFKLS  876

Query  338  IYPP  327
            ++PP
Sbjct  877  LFPP  880



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 7/129 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + VLG L  LEVLKLKE+   GE WE     F SL  L I RT+LV W      F
Sbjct  750  LGWNDMSVLGQLEHLEVLKLKENGFMGECWEPKVGGFSSLLVLWIERTNLVSWNASADQF  809

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QG---D  354
            P L +L L  C  L+ +P+   D++SL+ +EL+ + K AA SAR ++++K    QG    
Sbjct  810  PRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAAISARELQDKKDKQPQGTEKT  869

Query  353  GFDLSIYPP  327
            GF LSI+PP
Sbjct  870  GFKLSIFPP  878



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + VLG L  LEVLKLKE+   GE WE     F SL  L I RT+LV W      F
Sbjct  571  LGWNDMSVLGQLEHLEVLKLKENGFIGECWEPKVGGFSSLLVLWIERTNLVSWNASADQF  630

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQG---D  354
            P L +L L  C  L+ +P+   D++SL+ +EL+ + K AA SAR ++    +Q QG    
Sbjct  631  PRLKRLVLISCDRLKEIPIGLADIRSLQTVELYNSTKTAAISARELQYKKDKQPQGTEKT  690

Query  353  GFDLSIYPP  327
            GF LSI+PP
Sbjct  691  GFKLSIFPP  699



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 77/128 (60%), Gaps = 7/128 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + VL  L  L VLKLK++A KGE+WELN+  F  L  L I R +LV W      F
Sbjct  569  LEWDDMSVLKQLEYLLVLKLKDNAFKGEHWELNDGGFPFLEVLCIERANLVSWNASGDHF  628

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK------QGDG  351
            P L  L++S C  LE +P+   D++SL+VM+L  + K AA SAR I+ +K      +   
Sbjct  629  PRLKHLHIS-CDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAREIQAKKNKLQTAKSQK  687

Query  350  FDLSIYPP  327
            F+LS++PP
Sbjct  688  FELSVFPP  695



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 77/128 (60%), Gaps = 7/128 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + VL  L  L+VLKLK++A KGE WELN+  F  L+ L I R +LV W      F
Sbjct  754  LEWDDMSVLKQLENLQVLKLKDNAFKGENWELNDGGFPFLQVLCIERANLVSWNASGDHF  813

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK------QGDG  351
            P L  L++S C  LE +P+   D+ SL+VM+L  + K AA SAR I+ +K      +   
Sbjct  814  PRLKHLHIS-CDKLEKIPIGLADICSLQVMDLRNSTKSAAKSAREIQAKKNKLQPAKSQK  872

Query  350  FDLSIYPP  327
            F+LS++PP
Sbjct  873  FELSVFPP  880



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 77/128 (60%), Gaps = 8/128 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW ++ +LG L  LEVLKLK+++  G+ WE  +  F+ L  L IGRTDLV W      F
Sbjct  756  LDWSNMSILGLLENLEVLKLKDNSFMGKRWEAADGGFRHLEVLHIGRTDLVFWIASAHHF  815

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-------QGD  354
            P L +L L +C  L  VP+   D+++ +V++L+ T K A+ASA+ I E K       +  
Sbjct  816  PQLRRLELQNCEELNEVPIGLADIENFQVLDLYHT-KFASASAKKIVEAKKKQEQNGKAG  874

Query  353  GFDLSIYP  330
            GF LSI+P
Sbjct  875  GFKLSIFP  882



>ref|XP_011072129.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=884

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW ++ +LG L  LEVLKLK+ +  G+ WE  +  F+ L  L IGRTDLV W      F
Sbjct  755  LDWSNMSILGLLENLEVLKLKDKSFMGKCWEAADGGFRRLEVLHIGRTDLVFWIASAHHF  814

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE--QKQGD-----  354
            P L +L L +C  L+ VP+   D+++ ++++L+ T K A+ASA+ I E  +KQG      
Sbjct  815  PRLRRLELQNCEELKEVPIGLADIENFQILDLYRT-KFASASAKKIGEAKKKQGQTGKAG  873

Query  353  GFDLSIYP  330
            GF LSI+P
Sbjct  874  GFKLSIFP  881



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 9/132 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW H+ +LG L +L VLKLK++A  G+ W+  +  F+ L  L IG T+LV W      F
Sbjct  634  LDWSHMSILGLLEKLIVLKLKDNAFMGKTWKTADGGFRHLEVLHIGPTNLVVWKASGHHF  693

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--------QG  357
            P L +L L +C  L  VP+   D++SL+ +EL C+N  AAASA+ IR  K        Q 
Sbjct  694  PKLRRLELYNCEELIQVPIGLADIQSLQFLELNCSN-FAAASAKEIRNIKKKQQEQTMQV  752

Query  356  DGFDLSIYPPAD  321
              F LS++PP D
Sbjct  753  SIFKLSVFPPHD  764



>gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Erythranthe guttata]
Length=891

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW  + +LGSL  L VLKLK+ A  G  WE  +  F+ L  L IG T+L  W      F
Sbjct  763  LDWTDMSILGSLENLLVLKLKDKAFMGRSWEAADAGFRRLEVLHIGHTNLAVWVALGHHF  822

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDL  342
            P L  L L +C +LE VP+   D+ + + ++LF T +KAAASA+ IR+ +  +G   F L
Sbjct  823  PRLRCLKLRNCENLEGVPIGLADIPTFQELDLFRT-EKAAASAKKIRKNRTTNGLTEFKL  881

Query  341  SIYPPADN  318
             I+PP+ N
Sbjct  882  FIFPPSQN  889



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +LG +  LEVLKLKE+   GE WE +   F SL  L I RTDLV W      F
Sbjct  756  LEWNDMSILGQMEHLEVLKLKENGFMGECWE-SVGGFCSLLVLWIERTDLVSWKASADHF  814

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--------QG  357
            P L  L L  C  L+ +P+   D++S +VMEL  + K AA SAR IR++K          
Sbjct  815  PRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAAISAREIRDKKDKQTQEGTNN  874

Query  356  DGFDLSIYPP  327
            +GF LSI+PP
Sbjct  875  NGFKLSIFPP  884



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (61%), Gaps = 8/130 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK + +LG L  LEVLKLKE+A +G+ WE ++  F  L+ L I RTDL  W     +F
Sbjct  754  LKWKDMSILGLLEYLEVLKLKENAFRGQSWEPDDGGFPRLQVLWIQRTDLSSWKASSLNF  813

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QGD---  354
            P L +L L  C  LE +P A  DV+SL++MEL  T++ AA SAR I +++    +G    
Sbjct  814  PQLKRLVLISCDKLEELPAALADVQSLQLMELHYTSESAAKSARAILKKRLRKEEGSTNR  873

Query  353  -GFDLSIYPP  327
             G  LS++PP
Sbjct  874  CGCKLSVFPP  883



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DWK + ++G L  LEVLK+K++      WE+ +  F  L+FL +  TDL +W+   SSF
Sbjct  738  VDWKEMSIIGMLPNLEVLKIKDNFFNAPRWEVMDEAFSHLKFLKLSNTDLQQWSASSSSF  797

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ---GDGFDL  342
            P L +L L  C +L+ +P +F+ + +L+ +EL+ +++  A SAR I++ ++    DG  +
Sbjct  798  PCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSSQSVADSARQIQDSQRYMGNDGLKV  857

Query  341  SIYP  330
             I+P
Sbjct  858  LIHP  861



>emb|CDP11611.1| unnamed protein product [Coffea canephora]
Length=921

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW H+  LG L  LEVLKLK++A KG++WE  +  F+ L+ L IG TDL  W  + S+F
Sbjct  789  LDWSHMSTLGKLKCLEVLKLKDNAFKGKHWETEDGGFRYLKVLFIGATDLKVWKAKSSNF  848

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASA--------RTIREQKQG  357
            P L  L L  C +LEA+P    + KSL+V++L  T++   ASA        R +R+++  
Sbjct  849  PELKSLVLKQCRNLEAIPSDLANAKSLQVIDLEHTSQTVVASAKNMQLLQLRVLRQKRDI  908

Query  356  DGFDL--SIYPP  327
            +  +L   IYPP
Sbjct  909  ETSELKVKIYPP  920



>gb|EYU22232.1| hypothetical protein MIMGU_mgv1a002671mg [Erythranthe guttata]
Length=648

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 79/134 (59%), Gaps = 10/134 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW H+ ++G L  LEVLKLKE A  G+ W   +  F+ L  L IGRTDLV W      F
Sbjct  516  LDWCHMSIIGLLENLEVLKLKEKAFVGKSWVAADGGFRCLEVLHIGRTDLVVWVASGHHF  575

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE---QKQGD----  354
            P L +L L +C  L+ VP+   D+ +L++++L+  +K AAA A+ I+E   +KQ +    
Sbjct  576  PRLRRLELHYCEELQEVPIGLADIPTLQLLDLY-RSKFAAAPAKKIQEARSRKQAEETSN  634

Query  353  --GFDLSIYPPADN  318
               F L+++PP + 
Sbjct  635  TCAFKLTVFPPDEQ  648



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L  LEVLKLK++A +G+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  755  EWKDMSILGLLEYLEVLKLKQNAFRGQSWEPEDGGFPCLQVLWIERTDLSSWKASSGNFP  814

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QGD----  354
             L +L L  C  LE +P A  D +SL++MEL  T++ AA SAR I +++    +G     
Sbjct  815  QLKRLVLISCDKLEELPAALADAQSLQLMELHYTSESAAKSARVILKRRLRKEEGSTNRC  874

Query  353  GFDLSIYPP  327
            G  LS++PP
Sbjct  875  GCKLSVFPP  883



>gb|ABJ99598.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=895

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+H  +LG L  L +LKLKE+A  GEYW+  +  F++L    +GRT+L KW      F
Sbjct  765  LSWEHTDILGMLPNLVMLKLKENAFMGEYWKPKDDGFRTLEVFYLGRTNLQKWEASNYHF  824

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG--FDLS  339
            P+L KL L  C  LE +  +  D+ +L+++++   N   AA AR I++   G G    +S
Sbjct  825  PSLKKLILKFCDRLEGLSSSLADISTLQLIDIHMANPVVAACARQIQKNNNGIGRSVQVS  884

Query  338  IYPP  327
            IYPP
Sbjct  885  IYPP  888



>ref|XP_009793189.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=873

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DWK +  L  L  LEVLKLKE+A  G+ WE     F SL+ L I R+DLV W      F
Sbjct  750  LDWKEMGRLCKLEVLEVLKLKENAFTGKLWESTVGTFPSLKVLLIERSDLVSWKASSEQF  809

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIY  333
            P L +L L     LE VP+    + +L+V+EL  T + AA SAR I+      GF LSI+
Sbjct  810  PRLARLVLRSLHKLEEVPIELAKIHNLQVIELENTTRTAAESAREIKSCSVCTGFKLSIF  869

Query  332  PP  327
            PP
Sbjct  870  PP  871



>ref|XP_011072180.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + VLG L  L+VLKLK  A  GE WE  +  F+ L  L I   DLV W      F
Sbjct  756  LGWEQMSVLGMLENLKVLKLKNDAFTGERWEAADGGFQQLEVLQIEYADLVFWEASSHHF  815

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIY  333
            P L  L L +C  L+A+P    D+ SL+V++L  T K AA SAR I+   +G    LSI+
Sbjct  816  PKLQHLSLRNCEELKALPFGLADILSLQVIDLHRTTKLAAVSAREIQADNKGRRLKLSIF  875

Query  332  P  330
            P
Sbjct  876  P  876



>gb|ABJ99601.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=899

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+H  +LG L  L +LKLKE+A  GEYW+  +  F++L    +GRT+L KW      F
Sbjct  769  LSWEHTDILGMLPNLVMLKLKENAFMGEYWKPKDDGFRTLEVFYLGRTNLQKWEASNYHF  828

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG--FDLS  339
            P+L KL L  C  LE +  +  D+ +L+++++   N   AA AR I++   G G    +S
Sbjct  829  PSLKKLILKFCDRLEGLSSSLADISTLQLIDIHMANPVVAACARQIQKNNNGIGRSVQVS  888

Query  338  IYPP  327
            IYPP
Sbjct  889  IYPP  892



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 72/131 (55%), Gaps = 10/131 (8%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +LG L  LEVLKL E+   GE WE +   F SL  L I RTDLV W      F
Sbjct  757  LEWNDMSILGQLEHLEVLKLIENGFMGECWE-SVGGFCSLLVLWIERTDLVSWKASADHF  815

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK---------Q  360
            P L  L L  C  L+ +P+   D++S +VMEL  + K AA SAR IR +K          
Sbjct  816  PRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAAISARDIRAKKDKQTQKGTNN  875

Query  359  GDGFDLSIYPP  327
             +GF LSI+PP
Sbjct  876  NNGFKLSIFPP  886



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 75/130 (58%), Gaps = 9/130 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++WK + +LG L  LEVLK+KE+   GE WE +   F SL  L I RT+LV W      F
Sbjct  755  LEWKDMSILGQLEHLEVLKMKENGFSGESWE-STGGFCSLLVLWIERTNLVSWKASADDF  813

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-----QGD--  354
            P L  L L  C +L+ VP+A  D++S +VM L  + K AA SAR I+ +K     QG   
Sbjct  814  PRLKHLVLICCDNLKEVPIALADIRSFQVMMLQNSTKTAAISARQIQAKKDNQTQQGTKN  873

Query  353  -GFDLSIYPP  327
              F LSI+PP
Sbjct  874  IAFKLSIFPP  883



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++WK + +LG L  LEVLK+KE+   GE WE +   F SL  L I RT+LV W      F
Sbjct  756  LEWKDMSILGQLEHLEVLKMKENGFTGESWE-STGGFCSLLVLWIERTNLVTWKASADDF  814

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-----QGD--  354
            P L  L L  C  L+ VP+A  D++S +VM L  + K AA SAR I+ +K     QG   
Sbjct  815  PRLKHLVLICCDYLKEVPIALADIRSFQVMMLQNSTKTAAISARQIQAKKDNQTQQGTKN  874

Query  353  -GFDLSIYPP  327
              F LSI+PP
Sbjct  875  IAFKLSIFPP  884



>ref|XP_004234046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=866

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = -3

Query  692  IDWKHIC-VLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSIGRTDLVKWTCEKS  519
            +DW+ I   +G L  LEVLK+KE+A +G+ WEL  + VF  L+ L I R++LV W     
Sbjct  741  LDWEEIHRAVGHLELLEVLKVKENAFRGDSWELKKDYVFPCLKVLWIERSELVCWKGCDE  800

Query  518  SFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLS  339
            +FP+L +L L +   LE +P+ F ++ +LK+MEL  T K    SA+ I  Q    GF L+
Sbjct  801  NFPSLERLVLRNLNKLEEIPINFANISNLKMMELVNTTKSTVKSAQKIESQSVCTGFKLT  860

Query  338  IYPP  327
            I+PP
Sbjct  861  IFPP  864



>ref|XP_011072177.1| PREDICTED: disease resistance RPP8-like protein 3 [Sesamum indicum]
Length=861

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (57%), Gaps = 2/123 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +W ++ VLG L  LEVLKLK++A  G+ WE  +  F+ L  L IG TDLV W      FP
Sbjct  737  EWSNMSVLGLLENLEVLKLKDNAFVGKSWETTDGGFRRLEVLQIGYTDLVYWVASAHHFP  796

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAAS--ARTIREQKQGDGFDLSI  336
             L  L L +C  LE VP    ++ SL++M L  + K A  S       +Q++ +GF LSI
Sbjct  797  RLRCLELRNCEELEEVPFGLAEIPSLEIMHLHRSTKSAVDSAKKIQQAKQQKKEGFSLSI  856

Query  335  YPP  327
            +PP
Sbjct  857  FPP  859



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L +LEVLKLKE A KG+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  107  EWKDMSILGLLPDLEVLKLKEYAFKGQSWEQEDGGFPRLQVLWIERTDLTSWKASSGNFP  166

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI--------REQKQGD  354
             L  L L  C  LE +P    DVK+L+++EL  +++ AA SAR I        +E  +G 
Sbjct  167  RLKHLALISCDKLEELPAELADVKNLQLIELQSSSESAARSARAILKRNQEKEQEGDKGT  226

Query  353  GFDLSIYP  330
            GF LSI P
Sbjct  227  GFKLSIVP  234



>ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=886

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW HI  LG L  LEVLKL + +  G+ W+  +  F+ L  L IGRTDLV W      F
Sbjct  756  LDWSHISTLGLLENLEVLKLNDKSFMGKCWQAADGGFRRLEVLHIGRTDLVFWVASAHHF  815

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASA------RTIREQKQG--  357
            P L +L L +C  L+ VP+   ++++ +V++L+ T K AAASA      +  +E++ G  
Sbjct  816  PRLRRLELHNCEELKEVPIGLAEIENFQVLDLYRT-KFAAASAKKIGDAKKKKEEQNGKV  874

Query  356  DGFDLSIYP  330
              F LSI+P
Sbjct  875  GAFKLSIFP  883



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 8/128 (6%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L ELEVLKLKE+A KG+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  759  EWKDMSILGLLPELEVLKLKENAFKGQSWEQEDGGFPRLQVLWIERTDLTSWKASSGNFP  818

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ--------GD  354
             L  L L  C  LE +P    DVK+L+++EL  +++ AA SAR I ++ Q        G 
Sbjct  819  RLKHLALISCDKLEELPAELADVKNLQLIELQSSSESAARSARAILKRNQEKEQDGDKGT  878

Query  353  GFDLSIYP  330
            GF LSI+P
Sbjct  879  GFKLSIFP  886



>emb|CDP08024.1| unnamed protein product [Coffea canephora]
Length=703

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W HI  +GSL  LE+LKL+  A +G+ WE+    F+ LRFLS+   D+V+W       
Sbjct  580  LPWSHISAIGSLANLEILKLQSGAFEGQTWEMEEGEFQRLRFLSLDTLDIVQWNASCDHL  639

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
            P L +L L +C  LE +P    D+ SL+++E+ C  +    SA+ I E
Sbjct  640  PRLERLVLQNCNDLEEIPFDLADILSLQMIEVNCCAQSVEESAKEIGE  687



>emb|CDP04724.1| unnamed protein product [Coffea canephora]
Length=613

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            IDWK + V+G L  LE+LK+K++   G  WE  +  F  L+FL +  TDL +W    SSF
Sbjct  485  IDWKGMSVIGMLPNLEILKIKDNFFNGPKWETGDEGFCHLKFLKLSHTDLQQWIASSSSF  544

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L +L L+ C  LE +P + +++ +L+++E++ + +  A SAR ++E +   G D
Sbjct  545  PCLEQLVLNGCLDLEEIPSSLEEIYTLEIIEVYHSCQSVADSARRLQEIQSYMGND  600



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 67/114 (59%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + V+GSL  L+VLKL++ A +G  WE N   F  L++L I R  L +W  + + F
Sbjct  630  LSWEKMTVIGSLPNLQVLKLRDYAFEGSVWEPNEGEFTKLKYLLIDRNKLERWCADYTHF  689

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L  L L HC  LEA+P    D+ +L+++ELF       ASA  I+E+++  G
Sbjct  690  PQLQHLCLCHCFELEAIPTEVGDIGTLEMLELFRCRSSVVASAMLIQEEQRNLG  743



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 8/128 (6%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +WK + +LG L +LEVLKLKE+A KG+ WE  +  F  L+ L I RTDL  W     +FP
Sbjct  759  EWKDMSILGLLPDLEVLKLKENAFKGQSWEQEDGGFPRLQVLWIERTDLTSWKASSGNFP  818

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI--------REQKQGD  354
             L  L L  C  LE +P    DVK+L+++EL  +++ AA SAR I        +E  +G 
Sbjct  819  RLKHLALISCDKLEELPAELADVKNLQLIELQSSSESAARSARAILKRNQEKEQEGDKGT  878

Query  353  GFDLSIYP  330
            GF LSI+P
Sbjct  879  GFKLSIFP  886



>gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum]
Length=2544

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++G+L  LEVLKL   A +G  W +N+T F  LR+L +   +  +W+  + SFP+
Sbjct  2413  WSEISIVGTLCNLEVLKLLNKAFEGIQWNVNDTEFPELRYLKLDSLNFAQWSISEDSFPS  2472

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----REQKQGDGFDLS  339
             L +L L++C  LE +P  F+DV SLK +E+   +   A SA  I    RE    D F ++
Sbjct  2473  LERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAGEIQTTQREDMANDAFTVT  2532

Query  338   IYPP  327
             I PP
Sbjct  2533  IQPP  2536



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ +  LG L  LEVL+LK  A +G  W LN   FK L+ L I R +LV W     S P 
Sbjct  67   WEDMTTLGQLPNLEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINRKNLVLWEASSESLPR  126

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L  L L +C  LE +P    D+ ++K++EL   ++ AA SA  + E++Q  G
Sbjct  127  LEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLG  178



>emb|CDP20211.1| unnamed protein product [Coffea canephora]
Length=694

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W ++ +LG+L  LEVLKLK+ A KG+YW+     F SL+   IG TDL +W  + + F
Sbjct  561  LNWDYMSILGNLQYLEVLKLKDYAFKGDYWKTKQGGFPSLKVFFIGATDLTRWDAKANDF  620

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----------REQK  363
            P L  L L  C +LE +P  F  +K L+++++  T     +SAR I          ++ K
Sbjct  621  PELKCLILKQCKTLERIPSDFVHMKKLEMIKVEHTKDSVVSSARRIVQLQLEVLLQQKSK  680

Query  362  QGDGFDLSIYPP  327
            +     L +YPP
Sbjct  681  KTSPVKLIVYPP  692



>emb|CDP08038.1| unnamed protein product [Coffea canephora]
Length=1468

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +GSL  LE+LKL+ SA +G+ WE+    F+SLRFLS+   D+V+W       
Sbjct  1345  LPWSHISAIGSLANLEILKLQSSAFEGQTWEMKEGEFQSLRFLSLDTLDIVQWNASCDHL  1404

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMEL-FCTNKKAAASARTIRE  369
             P L +L L +C  LE +PL   ++ SL+++E+ FC  +    SA+ I E
Sbjct  1405  PRLERLVLQNCNDLEEIPLDLAEILSLQMIEVNFCA-QSVEESAKEIGE  1452



>ref|XP_009603189.1| PREDICTED: uncharacterized protein LOC104098223 [Nicotiana tomentosiformis]
Length=329

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            WK I  LG L  LEVLKLK  A +G  W LN   FK L+ L I  T+LV+W    +S P+
Sbjct  12   WKDISFLGKLPNLEVLKLKYFAFQGSNWNLNEGGFKKLKLLHIFMTNLVRWKATSNSLPS  71

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
            L  L L HC  LE + +   D+ +L+++EL   +  AA     I E+++G G ++
Sbjct  72   LECLVLRHCYKLEEIAIEIGDIPTLELIELHHCSHSAATCVEEILEEQKGLGNEI  126



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DWK +  +G L  LEVLK+K +   G+ WE ++  F  L+FL +  T+L +W    SSF
Sbjct  747  LDWKEMSTIGRLPNLEVLKVKNNFFNGQQWETSDEGFHHLKFLKLSHTNLQRWIASSSSF  806

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE-QKQGDGFDLSI  336
            P L  L L  C  LE +P +  D+++L+++E+  ++  AA S   I+E QK    F+L +
Sbjct  807  PCLGHLVLHRCLVLEEIPPSIGDIQTLQMIEVSHSSLAAADSVWQIQESQKSMGNFELKV  866

Query  335  Y  333
            +
Sbjct  867  F  867



>ref|XP_004236958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     LG+L  LEVLK KE+A  G++WE   + F +L+ L I R++L  W     +FPA
Sbjct  748  WSEAEKLGTLESLEVLKFKENAFTGDFWE-PKSGFSALQVLWIERSELESWEASVVNFPA  806

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG--FDLSIY  333
            L +L L  C  L+AVPL   D+ SL  M L  T+ KA  SA+ +R+ K   G    LSIY
Sbjct  807  LRQLVLISCDKLDAVPLELADIPSLVEMRLDNTS-KAVKSAKNVRDSKTSKGMKLKLSIY  865

Query  332  PPAD  321
            PP +
Sbjct  866  PPEN  869



>gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Erythranthe guttata]
Length=888

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 71/132 (54%), Gaps = 13/132 (10%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSIGRTDLVKWTCEKSS  516
            + WKH+  LG L  L+VLKLK+ A  G++WE      F SL FL I RTDL  WT     
Sbjct  755  LSWKHMSTLGKLGALKVLKLKDFAFVGKFWEAGVEGKFASLEFLLIARTDLEFWTASSDC  814

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ--------  360
            FP L  L L +C  LE +PL     KSL+++++   +K AAASAR I  +K+        
Sbjct  815  FPGLKCLVLKNCERLEEIPLLLH--KSLQILDIERVSKTAAASARKIEAEKECMHGQQHR  872

Query  359  --GDGFDLSIYP  330
                GF L I P
Sbjct  873  AKRGGFKLIIAP  884



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ +  LG L  LEVL+LK  A +G  W LN   FK L+ L I R +LV W     S P 
Sbjct  111  WEDMTTLGQLPNLEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINRKNLVLWEASSESLPR  170

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L  L L +C  LE +P    D+ ++K++EL   ++ AA SA  + E++Q  G
Sbjct  171  LEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQQSLG  222



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS-  516
            + W  +  LG L  LEVLKLK +A KG+ W   +  F+SL+FL IG T L  W    +  
Sbjct  568  LPWNQMSTLGKLANLEVLKLKINAFKGDRWRTESGGFQSLQFLHIGSTGLSSWDVAAADH  627

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDG-  351
             P L  L L HC  L  +P +   + +L++++L CTN   A+SA+ I     +Q Q  G 
Sbjct  628  LPVLKSLVLKHCPDLRRLPPSLGHISTLQLIDLSCTNPSVASSAKDIENLKLKQAQQKGN  687

Query  350  ----FDLSIYPP  327
                F L +YPP
Sbjct  688  KSNRFMLLVYPP  699



>ref|XP_009803158.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=895

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 3/123 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW    +LG L  LEVLKLKE+A KG  WE+    F +L+ L I   DL  W   +  FP
Sbjct  771  DWSEADILGQLECLEVLKLKENAFKGMSWEVERGAFNNLQVLWIEGADLKNWEASEYHFP  830

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--QGDGFDLSI  336
             L  L L  C +L+AVP    DV S + M+L  T +KAA SAR I+ +K  +   F L++
Sbjct  831  KLRHLVLKFCENLQAVPYELADVPSFEEMKLENT-RKAAESAREIQRRKLMKSIKFKLTL  889

Query  335  YPP  327
             PP
Sbjct  890  SPP  892



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ +  LG L  +EVL+LK  A +G  W LN   FK L+ L I  T+LV W     S P 
Sbjct  111  WEDMTTLGQLPNVEVLRLKCFAFQGRNWNLNEGGFKKLKLLQINETNLVHWEASSESLPR  170

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L  L L +C  LE +P    D+ +LK+ EL   ++ AA S+  I E++Q  G
Sbjct  171  LEFLILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPSSEEIGEEQQSLG  222



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 69/134 (51%), Gaps = 12/134 (9%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +LG L  LEVLKLK+ A  G+ W+     F+SL+ L IG TDL  W  + + F
Sbjct  284  LGWDQMSILGKLQYLEVLKLKDYAFTGDDWQTEEGGFRSLKVLFIGATDLKCWEAQATDF  343

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE------------  369
            P L +L L  C  L+ +P  F D+K L+ + L  T     +SAR IR+            
Sbjct  344  PELRRLILRQCKQLQRIPPDFVDMKKLEDIHLEHTTGSVISSARRIRQLQIDMLQRQNLN  403

Query  368  QKQGDGFDLSIYPP  327
             K+     +++YPP
Sbjct  404  DKKTTPTRINVYPP  417



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -3

Query  680  HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
            H+  +G L  LE+LKL+E   K   WE N   F  L+FL +   DLV W  + ++FP L+
Sbjct  731  HLNAIGKLLNLEILKLQECKFKSLRWEPNEGEFCQLQFLRMDLVDLVNWVVDDTNFPRLD  790

Query  500  KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
             L +  C  LE +PLA  D+ +LKV+E+  ++    ASAR I++ +   G DL +
Sbjct  791  HLVIRGCRHLEEIPLAIGDIPTLKVIEVDNSSPSVLASAREIQQAQLDSGNDLEV  845



>gb|AAT40487.1| putative disease resistance protein [Solanum demissum]
Length=2607

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++G+L  LEVLKL   A +G  W +N+T F  LR+L +   +  +W+  + SFP+
Sbjct  2393  WSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPS  2452

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L +L L++C  LE +P   +DV SLK +E+   +   A SA  I+    E    D F ++
Sbjct  2453  LERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQHEDMANDAFTVT  2512

Query  338   IYPP  327
             I PP
Sbjct  2513  IQPP  2516



>ref|XP_011076796.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Sesamum indicum]
Length=880

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 75/130 (58%), Gaps = 9/130 (7%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DWKHI +LG L  L+VLKLKE A  G+ WE+    F  L FL IGRT+LV W      F
Sbjct  750  LDWKHISILGLLKNLKVLKLKEKAFVGDCWEVTGGGFHHLEFLHIGRTNLVTWVALGYQF  809

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE--QKQGD-----  354
            P L  L L +C  L  +P+   DV     ++L C +K A ASA+ IRE  ++Q D     
Sbjct  810  PKLKCLELHNCEQLRQIPVGLADVPYFHALDL-CRSKYATASAKKIREAKERQADQAVEV  868

Query  353  -GFDLSIYPP  327
             GF LSI+PP
Sbjct  869  EGFKLSIFPP  878



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++G L  LE+LKLK  A +GE W  +   F  L+ L I   DL  W+    SFP 
Sbjct  744  WEDLNIIGELRNLEILKLKRYACRGEEWHPSENGFTRLKLLLIEYNDLKYWSSPNDSFPV  803

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDG  351
            L +L + HC+ LE +P+ F  + SL+ +EL  CT +  A++AR   EQK+  G
Sbjct  804  LERLVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQKENLG  856



>gb|EYU40385.1| hypothetical protein MIMGU_mgv1a007613mg [Erythranthe guttata]
Length=402

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 13/130 (10%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            WKH+  LG L  L+VLKLK+ A  G++WE      F SL FL I RTDL  WT     FP
Sbjct  273  WKHMSTLGKLGALKVLKLKDFAFVGKFWEAGVEGKFASLEFLLIARTDLEFWTSSNDCFP  332

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG---------  357
            +L  L L +C  LE +PL     KSL+V+++   +  A ASAR I  +KQ          
Sbjct  333  SLKCLVLKNCEKLEEIPLLLH--KSLQVLDIERVSITAVASARKIEAEKQNMQGQQHRAK  390

Query  356  -DGFDLSIYP  330
              GF L I P
Sbjct  391  RGGFYLVIAP  400



>ref|XP_011084836.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=481

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 72/117 (62%), Gaps = 0/117 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + V+ SL  LEVLKL+  A+ GE WE ++  F+ L+FL + + +L  W+ E + F
Sbjct  282  LPWQGMAVIRSLLNLEVLKLRYIAIIGEEWEYSDGEFQRLKFLLMEKLNLRSWSVESTHF  341

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
            P L +L +  C  LE +P    D+ +L+++E+   +K AA SA  I+E+++  G DL
Sbjct  342  PCLERLVIKQCLQLEDIPCEIGDIPTLELIEVDGGSKSAADSAVFIQEEQRSLGNDL  398



>ref|XP_009604446.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=644

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 62/107 (58%), Gaps = 0/107 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW  +  L  L  LEVLKLKE+A  GE WE  + +F SL+ L I R+DLV W      F
Sbjct  411  LDWNEMGRLCKLEVLEVLKLKENAFTGELWESRDGIFPSLKVLLIERSDLVSWKASSEQF  470

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR  372
            P L +L L     L  VP+    +++L+VMEL  T + AA SAR I+
Sbjct  471  PRLVRLVLRSLHKLVEVPIELAKIRNLQVMELENTTRTAAESAREIK  517



>gb|EYU39490.1| hypothetical protein MIMGU_mgv1a0204861mg, partial [Erythranthe 
guttata]
Length=369

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = -3

Query  671  VLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLY  492
            ++GSL  L+VLKLK  A+ G+ WE     F  L+FL +  TDL  W  E S FP L  L+
Sbjct  253  IVGSLPNLQVLKLKNFALDGDTWETTEGEFSQLKFLLLHYTDLGHWISESSHFPILKCLF  312

Query  491  LSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE-QKQGDGFDLSI  336
            L HC  L  +P    D+ +L+++E+   N   A SA+ I+E Q++   +DL +
Sbjct  313  LHHCQYLSEIPDGIGDIPTLELIEVKGDNIYLAQSAKQIQEIQREYGNYDLEV  365



>emb|CDP16500.1| unnamed protein product [Coffea canephora]
Length=679

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 3/123 (2%)
 Frame = -3

Query  692  IDWK-HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS  516
            ++W  H+ +LG L  LEVLKLK+ A  G  W+     F+SL+ L IG TDL  W  +   
Sbjct  557  LEWNNHMPILGGLQSLEVLKLKDKAFVGVEWKTEKGGFRSLKVLFIGDTDLENWEVKADD  616

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
             P L  L L H  SLE +P  F+ +K+L+ ++L  TN+    SA+ I  QK      LS+
Sbjct  617  LPELRWLILKHIKSLEQMPSDFEHMKNLERIDLERTNRWLVKSAKDI--QKSRPQIKLSV  674

Query  335  YPP  327
            YPP
Sbjct  675  YPP  677



>ref|XP_011087333.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=841

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 73/132 (55%), Gaps = 13/132 (10%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTC--EKS  519
            +DWK++ VLG LN LEVLKLKE+A  G+ W++    F SL FL I RTDL  WT      
Sbjct  709  LDWKNMFVLGMLNALEVLKLKENAFMGKCWDVVAGGFNSLEFLYIARTDLQFWTLSGRGD  768

Query  518  SFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ---GD--  354
             FP L  L L +C  L  VP     V+ L+ +++    K A A+AR I ++KQ   G+  
Sbjct  769  HFPKLRCLVLKNCEKLHEVPTCL--VEKLQTLDMERVTKHAVAAARKIEQEKQMKYGEQS  826

Query  353  ----GFDLSIYP  330
                GF L I P
Sbjct  827  TRRGGFKLIIAP  838



>emb|CDP08040.1| unnamed protein product [Coffea canephora]
Length=576

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W HI  + SL  LE+LKL+  A +G+ WE+    F+ LRFLS+   D+V+W       
Sbjct  453  LPWCHISAIRSLANLEILKLQSGAFEGQTWEMEEGEFQRLRFLSLDTLDIVQWNASCDHL  512

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
            P L +L L +C  LE +P    D+ SL+++E+ C  +    SA+ I +
Sbjct  513  PRLERLVLQNCNDLEEIPFDLVDILSLQMIEVNCCAQSVEESAKEIGD  560



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 70/123 (57%), Gaps = 3/123 (2%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             ++W+ + ++G L  LEVLK+K++   G  WE     F+ LRFL     DL +W      F
Sbjct  889   VNWEEMSIIGMLPNLEVLKVKDNFFNGPKWETCEGGFRRLRFLKFSHMDLQEWIATADDF  948

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ---GDGFDL  342
             P+L KL L+ C +L  +P AF D  +L+V+E++ ++   A SA  I+E ++    D F +
Sbjct  949   PSLEKLVLNGCLALTEIPSAFGDSCTLQVIEVYRSSDTVADSACQIQESQRNWGNDEFKV  1008

Query  341   SIY  333
              IY
Sbjct  1009  FIY  1011



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W+ + ++GSL  LEVLKLK  +V+G  W      F  L+FL I  +DLV W  + S+F
Sbjct  644  VNWEDLTLIGSLQNLEVLKLKYDSVRGAVWNPIEGEFLRLKFLLIHYSDLVYWNADSSNF  703

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L KL L     LE +PL   ++ +L  + + C ++ AA SA  I E+++  G
Sbjct  704  PVLEKLVLKGMEKLEEIPLDIGEIPTLGFVHVNCCSESAAISALKIVEEQENVG  757



>gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Erythranthe guttata]
Length=859

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I+WK + ++GSL  L+VLKL++SA +G  W  N   F  L++L I  +D  +W  E   F
Sbjct  730  INWKDMTIVGSLLNLQVLKLRDSACEGYEWITNEGEFLELKYLLIDNSDPQQWITESDHF  789

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P+L  L L  C +L  +P    D+ SL+++E+   NK    SA+ I E++Q  G
Sbjct  790  PSLRFLLLHSCRNLSEIPNCVGDISSLELIEVKYGNKSLVDSAKQIEEEQQSYG  843



>ref|XP_009596917.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=896

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW    +LG L  LEVLKLKE+A +G  W++    F  L+ L I   DL  W   +  FP
Sbjct  772  DWSEADILGRLECLEVLKLKENAFEGMLWKVKRGGFNELQVLKIEGADLENWEASEYHFP  831

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--QGDGFDLSI  336
             L  L L  C +LEA+P    DV S + M+L  T +KAA SAR I  +K  +   F L++
Sbjct  832  QLRHLVLKSCENLEALPCELADVPSFEEMKLENT-RKAAKSAREIERRKLMKSIKFKLTL  890

Query  335  YPP  327
             PP
Sbjct  891  SPP  893



>emb|CDP05594.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I  +G L  LEVLKL+E A +G+ W++ +  F  L+FL +   D+V W    + F
Sbjct  1127  LPWTAISTIGGLLHLEVLKLREGAFRGQRWDVGDEEFLELKFLELSNMDVVLWKASYTPF  1186

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDL  342
             P L +L +  C+ LE +P +F +++ LK+++L   +     SA+ I ++++  G   FD+
Sbjct  1187  PKLEQLVIEDCSDLEEIPFSFSEIEGLKLIQLRRCSYDVEDSAQQILQEQRDSGNPEFDV  1246

Query  341   SI  336
              I
Sbjct  1247  LI  1248



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 0/119 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++  L  LEVLKL+E A +G  W+L    F  L+FL +    L  WT    +F
Sbjct  747  LHWEDMAIIEELPNLEVLKLREFAFQGPKWDLEEMFFPELKFLLLEALQLQIWTASDDNF  806

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            P+L +L + HC  LE +P    ++  L++++L   +  A ASA+ I++ KQ    DL +
Sbjct  807  PSLERLIIRHCYELEKIPPEIAEIGPLRLIQLVDCSPTAVASAQEIKKDKQRTKKDLEV  865



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK + ++GSL  L+VLKL+ESA  G+ WE     F  L FL I  +DL  W  E S F
Sbjct  790  LPWKDMTIVGSLPNLQVLKLRESACVGDTWETIEGEFLELNFLMIEESDLRNWITESSHF  849

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L +  C  L  +P    ++ +L+++E+   NK    SA+ I+E+++  G D
Sbjct  850  PNLKWLVIRRCRYLREIPDGIGEIATLELIEVEMRNKYLVESAKRIQEEQESLGND  905



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKL-------KESAVKGEYWELNNTVFKSLRFLSIGRTDLVKW  534
            I W+ I  +GSL  L+VLK+       KE     E WE     F SL+FL + +  LV+W
Sbjct  727  ITWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSDEEWEPTEGEFSSLQFLLLEKLKLVRW  786

Query  533  TCEKSSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGD  354
              +K+ FP L  L +  C++LE +P A  D+ +L+++EL   +    ASAR I+E +  +
Sbjct  787  KADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVASARQIQEDQSEN  846

Query  353  GFD  345
            G D
Sbjct  847  GND  849



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +L  L ELEVLKLK+ A +G  WE  +  F+ L+FL +  TDL+ W  +   F
Sbjct  760  LPWNQMTILCMLPELEVLKLKDYAFQGSEWESTDERFQQLKFLLLDGTDLIHWIVDSIQF  819

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L +C  L  +P    ++ +L+ +EL+  +  A  SA  I+E++   G D
Sbjct  820  PKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVSANRIQEEQHSMGND  875



>emb|CDP00590.1| unnamed protein product [Coffea canephora]
Length=899

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW  +  LG L  LEVLKLK++A KG  W+     F  L+FL IGRTDLV W      FP
Sbjct  764  DWSEMSTLGKLENLEVLKLKDNAFKGRLWQTEKGGFLRLKFLHIGRTDLVVWEASVDQFP  823

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASA  384
             L  L L +C  L A P    D+ SL+++       K  AS+
Sbjct  824  KLKSLVLRNCDKLRAFPHDLADIPSLQMVSKLKGATKLVASS  865



>emb|CDP21300.1| unnamed protein product [Coffea canephora]
Length=1433

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 0/108 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +G L  LEVLKL   A +G  WE+    FK L+FL +   ++ +W       
Sbjct  1312  LPWSHISTIGRLPNLEVLKLLLGAFEGLIWEMEEEQFKELKFLKLDDLNICQWNATCDHL  1371

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
             P L +L L +C  LE VP  F D+ +LKV+E+    + A  SA+ IRE
Sbjct  1372  PKLERLVLQNCKDLEEVPNDFADIGTLKVIEVHWCGQSAEESAKGIRE  1419



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 3/126 (2%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W H+  +  L  LEVLKL+  A +G  WE     F  L+FL I  TDL  W  +  SFP+
Sbjct  777  WGHMSDIAELRNLEVLKLRCYAFQGRAWETYEGEFFRLKFLLIEDTDLEYWYVDYESFPS  836

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD---LSI  336
            L +L L HC  L+ +P    ++ +L+ MEL   +    ASA+ I E++Q  G D   +SI
Sbjct  837  LERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVASAKRIAEEQQSAGNDVLQVSI  896

Query  335  YPPADN  318
               AD+
Sbjct  897  KSSADD  902



>emb|CDP16841.1| unnamed protein product [Coffea canephora]
Length=900

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 10/128 (8%)
 Frame = -3

Query  680  HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
            H+ +LG L  LEVLKLK++A  G+ W      F SL+ L IG TDL  W  + ++FP L 
Sbjct  772  HMPILGKLRYLEVLKLKDNAFVGKDWRTEEGGFHSLKVLFIGATDLECWLAKATNFPELR  831

Query  500  KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----------QGDG  351
             L L HC +L  +P  F  +K+L+ + L  TN K  +SAR I  Q+          +   
Sbjct  832  YLILKHCRTLIQIPPDFVHMKNLEKINLERTNAKLVSSARRIFSQRSKMLGLQKANETTP  891

Query  350  FDLSIYPP  327
              L +YPP
Sbjct  892  IKLIVYPP  899



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +L SL  LEVLKL+    +G  W L+   FK L+ L I +T LV W     S 
Sbjct  750  LEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLLHIHQTRLVHWQATSDSL  809

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD----  345
            P L  L L  C+ LE +P    D+ +LK+++L   ++ A  SA  I+E+++  G +    
Sbjct  810  PVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEIQEEQKSIGNEVLVV  869

Query  344  -LSIYPP  327
             +S +PP
Sbjct  870  TVSPHPP  876



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++G L  LE+L+L   A +G  WE+N++ F+ L++L++   ++ +W+    +FP 
Sbjct  1556  WYEISIVGELPNLEILRLLSRAFEGNEWEVNDSEFRVLKYLNLDNINISQWSLSNDAFPK  1615

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L  L L+ C  LE +P  F D  +LK +E+    +  + SA  I+    E    D F ++
Sbjct  1616  LEHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNSALEIQTAQHEDMANDAFTVT  1675

Query  338   IYPP  327
             I PP
Sbjct  1676  IQPP  1679



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++GSL  LEVLKLK+ A +G  WE     F  L+ L + RTD   W  E S F
Sbjct  711  LPWESMTIVGSLPNLEVLKLKKGAFRGLKWETTEGEFCRLKVLVMDRTDPRIWITESSHF  770

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            P L  L L  C +L  +P +  ++++L+ +++ C N     SA+ I+E+ Q  G +L +
Sbjct  771  PTLEVLVLRKCYTLSEIPYSICEIQTLEQIKVDCCNSSIGESAKRIQEEVQSFGNELEV  829



>emb|CDP11160.1| unnamed protein product [Coffea canephora]
Length=1430

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +G L  LEVLKL+  A +G  WE+    FK L+FL +   ++ +W       
Sbjct  1308  LPWSHISTIGGLPNLEVLKLRLGAFEGLIWEMEEEQFKELKFLKLDDLNICRWNATCDHL  1367

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
             P L +L L +C  LE +P  F D+ +L+++E+    + A  SA+ IRE
Sbjct  1368  PKLERLVLQNCKDLEEIPNDFADIGTLELIEVHWCRQSAEESAKGIRE  1415



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK + ++GSL  LEVLKLK+ A  G  W+     F  L+FL I +  LV+W  E + F
Sbjct  757  LSWKGMSIIGSLPHLEVLKLKQYAFTGAVWKPVEREFSRLKFLLIEKMRLVRWIAENTHF  816

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L  L +S C  L+A+P    D+ +LK++++   +  A  S   I E+++
Sbjct  817  PCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQILEEQR  867



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L +LEVLKL+  A  G  W+     F  L+FL IG T+L  W  + + F
Sbjct  779  LPWEDMVELSMLPKLEVLKLRNYAFSGSVWKSREGGFPRLKFLLIGSTNLEIWDADGTHF  838

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L +L L HC  L+ +P    +   L+ +EL C    A  SAR ++E++Q  G D
Sbjct  839  PNLQQLVLRHCKFLKEIPYGISEAPLLEKIELHCCKDSAVISARHLQEEQQSLGND  894



>emb|CDP11831.1| unnamed protein product [Coffea canephora]
Length=898

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW ++ +LG L  LEVLKLK+ A KG+YW+     F SL+   IG TDL +W  + + F
Sbjct  724  LDWNYMSILGDLRYLEVLKLKDYAFKGDYWKTKQGGFPSLKVFFIGATDLTRWDAKANDF  783

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMEL  417
            P L  L L  C +L+ +P  F  +K+L+++++
Sbjct  784  PELKCLILKQCKTLQRIPSDFAFMKNLEMIKV  815



>emb|CDP12797.1| unnamed protein product [Coffea canephora]
Length=1287

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 0/112 (0%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L+ LEVLKL+ +AV GE WE+    F +LRFL + + DL  WT    +F  
Sbjct  1150  WTLISRIGKLSSLEVLKLQHTAVVGEKWEMKAGEFLNLRFLGLTKLDLRSWTATSDNFSC  1209

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             L KL +  C  LE VP    +  +L+V+EL    K A  S + I +++ G G
Sbjct  1210  LEKLVVEGCWELEEVPSCLGECSNLEVIELTGCRKSAVTSVKQIHQEQMGMG  1261



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W+ + ++GSL  LEVLKLK+ A +G+ WE     F  L++L +   DLV+W   ++ F
Sbjct  958   LPWETMTIVGSLPNLEVLKLKKDACRGQEWEPVEEQFCRLKYLLLEELDLVQWRTNEAHF  1017

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
             P L  L +  C  L  +P A  D+ +L+++EL   +  A  SA+ I+E+++
Sbjct  1018  PCLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTSAKQIQEEQE  1068



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++GSL  LEVLKLKE A  G  WE     F  L+FL + R +LV W  E + F
Sbjct  757  LSWEDMSIIGSLPHLEVLKLKEHAFTGGVWEPVEGEFSRLKFLLMDRMELVWWIAENTHF  816

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L  L +  C +L+A+P    D+ +LK++++   +  A  S   I E+++
Sbjct  817  PCLEHLIIRSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQILEEQR  867



>emb|CDP08033.1| unnamed protein product [Coffea canephora]
Length=869

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +LG L  LEVLKLK+ A  GE W+     F SL+ L IG TDL  W  + + F
Sbjct  734  LGWDQMSILGKLQYLEVLKLKDYAFTGEDWQTEEGGFLSLKVLFIGATDLKCWEAQANDF  793

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
            P L  L L  C  L  +P  F D+K L+ + L  T     +SAR IR+
Sbjct  794  PELRCLILRQCKQLWRIPPDFVDMKKLEAIHLEHTTGSVISSARRIRQ  841



>ref|XP_006355046.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=887

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG +  L+VLKLKE+A  G  W++    FK L+ L I   D V W      FP
Sbjct  762  DWNQAYRLGQVKNLQVLKLKENAFTGPSWKMEPGGFKKLQVLWIEMADFVSWEASNCPFP  821

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
             L  L L  C +LEAVPL   D+ +L+ M L  T+ KA+ SAR I  +K+    DL
Sbjct  822  RLRSLVLISCLNLEAVPLELADLDNLQEMTLDNTS-KASESAREIEREKKKKQADL  876



>emb|CDP04880.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  I V+G L+ LEVLKL   A +G+ W++    F+ L+FL +   D+V+W+      
Sbjct  883  LPWDEISVIGQLSNLEVLKLLSKAFEGQQWDMREGEFQKLKFLKLDSLDIVQWSASGEHL  942

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L +L +  C  LE +P  F ++ +L+++EL C +  A  S + I + ++  G
Sbjct  943  PCLEQLVVLSCQQLEEIPSCFGEISTLQLIELKCCSASAKDSVKQILDDQRDYG  996



>ref|XP_009790395.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790397.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009790399.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790400.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790401.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790402.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1807

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +  L  L +LKL   A +G++WE+ ++ F  L++L +    + +W+    +FP 
Sbjct  1676  WNQISTIAELRNLVILKLSLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPK  1735

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----REQKQGDGFDLS  339
             L  L L+ C  LE +P  F D  SLK +E+   N   A SA+ I    RE    D F ++
Sbjct  1736  LEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVT  1795

Query  338   IYPP  327
             I PP
Sbjct  1796  IQPP  1799



>ref|XP_009790398.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana sylvestris]
Length=1807

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +  L  L +LKL   A +G++WE+ ++ F  L++L +    + +W+    +FP 
Sbjct  1676  WNQISTIAELRNLVILKLSLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPK  1735

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----REQKQGDGFDLS  339
             L  L L+ C  LE +P  F D  SLK +E+   N   A SA+ I    RE    D F ++
Sbjct  1736  LEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVT  1795

Query  338   IYPP  327
             I PP
Sbjct  1796  IQPP  1799



>emb|CDP00589.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (53%), Gaps = 12/134 (9%)
 Frame = -3

Query  692  IDWK-HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS  516
            +DW+ H+ +LG L  LEVLKLK++A  GE W+     F+ L+ L IG T+L  W  + ++
Sbjct  773  LDWQIHMPILGKLRFLEVLKLKDNAFMGEDWQTEGGGFRCLKVLFIGSTNLKSWDAKATN  832

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQ----------  366
            FP L  L L  C  L  +P  F  +K L++++L        +SAR I +Q          
Sbjct  833  FPQLRCLVLKQCKKLVRIPSDFVYMKHLEMIDLEYAKDSVVSSARRIVQQQLMEIIARPY  892

Query  365  -KQGDGFDLSIYPP  327
             K+     L++YPP
Sbjct  893  DKKTTPIKLTVYPP  906



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +L SL  LEVLKL+    +G  W L+   FK L+ L I +T LV W     S 
Sbjct  641  LEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLLHIHQTRLVHWQAASDSL  700

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI-  336
            P L  L L  C+ LE +P    D+ +LK+++L   ++ A  SA  I E+++  G ++ + 
Sbjct  701  PVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEILEEQKSIGNEVLVV  760

Query  335  -----YPPA  324
                 +PP+
Sbjct  761  TVSPDHPPS  769



>ref|XP_009626721.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009626722.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=903

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG L  LEVLKLKE+A  GE W      F  L+ L I R DL  W   +  FP
Sbjct  774  DWSEAERLGQLECLEVLKLKENAFAGESWRPERGGFSQLQILWIERADLKIWEASELHFP  833

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI-REQKQGDGFDLSIY  333
             L  L L  C  L+AVP     V SL+ M L  T  +A  SAR I R++     F L+I+
Sbjct  834  RLRHLVLISCDRLQAVPCELAGVPSLQEMSLENT-YRAVKSAREIERKKMDSTKFKLTIF  892

Query  332  PP  327
            PP
Sbjct  893  PP  894



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 0/108 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +G L  L+VLKL   A  GE W++    F  LRFL +   +LV+W       
Sbjct  1345  LPWDHISTIGRLPNLQVLKLASEAFDGESWDMREDEFPELRFLQLDSLNLVQWNASYDHL  1404

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
             P L +L L +C  L+ VP  F D+ +L+++++    K    S R+I E
Sbjct  1405  PKLAQLVLRNCKRLQEVPYDFADIPTLELIQVQQCGKSLEESVRSIGE  1452



>emb|CDP05441.1| unnamed protein product [Coffea canephora]
Length=803

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 68/121 (56%), Gaps = 1/121 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +L  L  LEVLK+K++   G  WE ++  F  L+FL +  TDL +W    S F
Sbjct  675  VNWNEMSILELLPSLEVLKIKDNFSNGPQWETSDHGFPCLKFLKLSYTDLPEWISSSSHF  734

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG-FDLSI  336
            P L KL L+ C  L+ +P    ++ +L+ ++++ +++    SAR I E     G +DL +
Sbjct  735  PNLQKLVLNGCLKLKEIPYEIGEIPTLQTIQVYRSSESTMESARQIHESNIDIGNYDLKV  794

Query  335  Y  333
            +
Sbjct  795  F  795



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W+ + ++G    LEVLKLK +A  G  W      F  L+FL I  T+L  W      F
Sbjct  1746  LSWEELNIIGQWPNLEVLKLKPNACHGLEWRPIEGRFPQLKFLLIEGTNLKCWKATNDHF  1805

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             PAL  L + HC  LE +P+ F D+ SL+++EL   + K  ASA  I+E+++  G
Sbjct  1806  PALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSAKLVASAGRIQEEQESLG  1859


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W+ + ++G    LEVLKLK +A  G  W      F  L+FL I  T+L  W      F
Sbjct  2553  LSWEELNIIGQWPNLEVLKLKPNACHGLEWRPIEGRFPQLKFLLIEGTNLKCWKATNDHF  2612

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             PAL  L + HC  LE +P+ F D+ SL+++EL     K  AS   I+E+++  G
Sbjct  2613  PALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCTAKLVASTVLIQEEQESLG  2666


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (45%), Gaps = 27/116 (23%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGE----YWELNNTVFKSLRFLSIGRTDLVKWTCEKS  519
            W  + ++G L  LEVLKL   AV  E    YW + N                        
Sbjct  845  WDDLNIVGELPNLEVLKLIFDAVGEECHLKYWNITN-----------------------D  881

Query  518  SFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            +FP L +L +  CT LE +P+ F +  SLK++EL        ASA  I+++++  G
Sbjct  882  NFPVLERLMIIDCTELEEIPIEFSETSSLKLIELKDCKPHLEASATRIQQEQEDIG  937



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W  + +L +L  LE LKL+  A +G  W L+   FK L+ L I +T+LV W     S P+
Sbjct  751  WTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQTELVHWHATSDSLPS  810

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            L  L L HC  L+ +P    D+ +LK++EL   ++ A  SA  I E++Q
Sbjct  811  LEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILEEQQ  859



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W  + +L +L  LE LKL+  A +G  W L+   FK L+ L I +T+LV W     S P+
Sbjct  693  WTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQTELVHWHATSDSLPS  752

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            L  L L HC  L+ +P    D+ +LK++EL   ++ A  SA  I E++Q
Sbjct  753  LEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILEEQQ  801



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I W  + ++G+L  LEVLKL+++A +G  WE     F  L+ L +   DLV+W   ++ F
Sbjct  601  IPWSSMTIVGALPNLEVLKLRKNACQGVEWEPVEEQFCQLKHLLLEEVDLVQWVANETHF  660

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L +L +  C  L+ +P    ++ +L+++EL   +  A  SA  I+E+++G G
Sbjct  661  PCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGLG  714



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++G L  LE+LKLK  A +GE W      F  L+ L I   DL  W     +FP 
Sbjct  785  WEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPV  844

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDG  351
            L +L +  C+ LE +P+ F  + SL+ +EL  CT +  A++AR   EQ++  G
Sbjct  845  LERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLG  897



>ref|XP_009778434.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1204

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LE+LKL   A +GE W  ++  F  L++L +G  ++  W     +FP+
Sbjct  1079  WVEISAIAALPNLEILKLLSKAFEGEEWNASDEEFPKLKYLKLGNLNITHWNISDDAFPS  1138

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSI  336
             L  + L +C  L  +P  F D  SL+ +E+F      + SAR+I E +Q +G   F ++I
Sbjct  1139  LEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGDSVSQSARSIEESQQDNGKGKFKVTI  1198

Query  335   YPP  327
               P
Sbjct  1199  QNP  1201



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++G L  LE+LKLK  A +GE W      F  L+ L I   DL  W     +FP 
Sbjct  785  WEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPV  844

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDG  351
            L +L +  C+ LE +P+ F  + SL+ +EL  CT +  A++AR   EQ++  G
Sbjct  845  LERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLG  897



>ref|XP_009799885.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-16 [Nicotiana sylvestris]
Length=1826

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +  L  L +LKL   A +G++WE+ ++ F  L++L +    + +W+    +FP 
Sbjct  1695  WNQISTIAELPNLVILKLSLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPK  1754

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----REQKQGDGFDLS  339
             L  L L+ C  LE +P  F D  SLK +E+   N   A SA+ I    RE    D F ++
Sbjct  1755  LEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVT  1814

Query  338   IYPP  327
             I PP
Sbjct  1815  IQPP  1818



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++G L  LE+LKLK  A +GE W      F  L+ L I   DL  W     +FP 
Sbjct  785  WEDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPV  844

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDG  351
            L +L +  C+ LE +P+ F  + SL+ +EL  CT +  A++AR   EQ++  G
Sbjct  845  LERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLG  897



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 68/114 (60%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I  K++  +GSL+ LE+LKL+  +++ + WEL+   F  L+ L +   ++V+W  E   F
Sbjct  684  IPSKYMTTIGSLHNLEILKLRFCSLRDDEWELSEGEFYRLKILVLEGMNIVQWRAEADHF  743

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P+L +L + HC  LE +P  F D+ +L+++++   ++   +SA  I E +Q  G
Sbjct  744  PSLEQLIIKHCRKLEEIPPGFGDIPTLQLIKVVEGSRSCESSAMQILEDQQSLG  797



>ref|XP_006367930.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X1 [Solanum tuberosum]
Length=932

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 63/120 (53%), Gaps = 3/120 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     L  L  LEVLKLKE+A  G  W L    F +L+ L I R+DL  W     +FP 
Sbjct  752  WSDANKLAQLEHLEVLKLKENAFIGNSWTLEIGCFSALQVLWIERSDLESWMASSCNFPI  811

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIYPP  327
            L  L L  C  L+AVPL   D+ + + M L   +K+A  SA+ I  +K    F L+I+PP
Sbjct  812  LRHLVLISCDKLKAVPLGLADIHNFQEMRLH-DSKEAVKSAKEIESKKP--KFKLTIFPP  868



>ref|XP_006367931.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X2 [Solanum tuberosum]
Length=932

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 63/120 (53%), Gaps = 3/120 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     L  L  LEVLKLKE+A  G  W L    F +L+ L I R+DL  W     +FP 
Sbjct  752  WSDANKLAQLEHLEVLKLKENAFIGNSWTLEIGCFSALQVLWIERSDLESWMASSCNFPI  811

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIYPP  327
            L  L L  C  L+AVPL   D+ + + M L   +K+A  SA+ I  +K    F L+I+PP
Sbjct  812  LRHLVLISCDKLKAVPLGLADIHNFQEMRLH-DSKEAVKSAKEIESKKP--KFKLTIFPP  868



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 68/114 (60%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I  K++  +GSL+ LE+LKL+  +++ + WEL+   F  L+ L +   ++V+W  E   F
Sbjct  756  IPSKYMTTIGSLHNLEILKLRFCSLRDDEWELSEGEFYRLKILVLEGMNIVQWRAEADHF  815

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P+L +L + HC  LE +P  F D+ +L+++++   ++   +SA  I E +Q  G
Sbjct  816  PSLEQLIIKHCRKLEEIPPGFGDIPTLQLIKVVEGSRSCESSAMQILEDQQSLG  869



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSS  516
            + W+ +  + +L  LEVLK+K++   G+ W LN+  +FK L+FL I  T L  W     +
Sbjct  743  LPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFKQLKFLLISWTGLKHWKAGSVN  802

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            FP L +L+L  C +LE +P  F D+ +L+ +EL   +  AA S + I+E+++  G
Sbjct  803  FPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSISAATSGKNIQEEQESIG  857



>ref|XP_009781183.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=711

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 63/117 (54%), Gaps = 0/117 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            WK I  LG L  LEVLKLK  A +G  W LN   FK L+ L I  T+LV+W     S P+
Sbjct  578  WKDISFLGKLPNLEVLKLKYFAFQGSNWNLNEGGFKKLKLLHIFMTNLVQWKATSDSLPS  637

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            L  L L HC  L+ +     D+ +L+++EL   +  AA     I E+++  G ++ +
Sbjct  638  LECLVLRHCYKLKEMASEIGDIPTLELIELHHCSHAAATCVEEILEEQKSMGNEILV  694



>gb|AAT39932.2| NB-ARC domain containing protein [Solanum demissum]
 gb|AAT39950.2| NB-ARC domain containing protein [Solanum demissum]
Length=884

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = -3

Query  671  VLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLY  492
            +L S   ++VLKL   A +G  W +N+T F  L++L +   +  +W+  + SFP+L +L 
Sbjct  758  ILNSFKLVKVLKLLNKAFEGVQWNVNDTEFPELKYLKLDSFNFAQWSISEDSFPSLERLV  817

Query  491  LSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI----REQKQGDGFDLSIYPP  327
            L++C  LE +P  F+DV SLK +E+   +   A SA  I    RE    D F ++I PP
Sbjct  818  LTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANSAEEIQTTQREDMANDAFTVTIQPP  876



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I W  + ++G+L  LEVLKL+++A +G  WE     F  L+ L +   DLV+W   ++ F
Sbjct  830  IPWSSMTIVGALPNLEVLKLRKNACQGIEWEPVEEQFCQLKHLLLEEVDLVQWVANETHF  889

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L +L +  C  L+ +P    ++ +L+++EL   +  A  SA  I+E+++G G
Sbjct  890  PRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQEGLG  943



>ref|XP_009761103.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     LG L  LEVLK KE+A  G+ W+   T F +L+ L I R++L  W     +FP 
Sbjct  753  WSEADKLGKLEALEVLKFKENAFAGDSWK-PKTGFCALQVLWIERSELESWEASDINFPM  811

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG--FDLSIY  333
            L  L L  C  LEAVPL   ++ +L+ M L  T+ KA  SA+ I+E K      F+L+I+
Sbjct  812  LRHLVLISCDKLEAVPLELANITNLQEMRLENTS-KAVKSAKDIQESKTAKSIKFNLTIF  870

Query  332  PP  327
            PP
Sbjct  871  PP  872



>ref|XP_009616094.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana tomentosiformis]
Length=1093

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LEVLKL   A +G  W +++  F  L+FL +G  ++  W     +FP+
Sbjct  966   WVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNISDDAFPS  1025

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSI  336
             L  + L +C  L  +P  F D  SL+ +E+F   +  + SAR I E +Q +G   F ++I
Sbjct  1026  LEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNGKGKFKVTI  1085

Query  335   YPP  327
               P
Sbjct  1086  QNP  1088



>ref|XP_009616092.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana tomentosiformis]
Length=1144

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LEVLKL   A +G  W +++  F  L+FL +G  ++  W     +FP+
Sbjct  1017  WVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNISDDAFPS  1076

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSI  336
             L  + L +C  L  +P  F D  SL+ +E+F   +  + SAR I E +Q +G   F ++I
Sbjct  1077  LEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNGKGKFKVTI  1136

Query  335   YPP  327
               P
Sbjct  1137  QNP  1139



>ref|XP_009616093.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=1101

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LEVLKL   A +G  W +++  F  L+FL +G  ++  W     +FP+
Sbjct  974   WVEISAISALPNLEVLKLLSEAFEGGEWNVSDEEFAKLKFLKLGNLNITLWNISDDAFPS  1033

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSI  336
             L  + L +C  L  +P  F D  SL+ +E+F   +  + SAR I E +Q +G   F ++I
Sbjct  1034  LEHIVLQNCKQLIEIPSEFGDSCSLQKIEVFMCGESVSQSARNIEESQQDNGKGKFKVTI  1093

Query  335   YPP  327
               P
Sbjct  1094  QNP  1096



>ref|XP_009773003.1| PREDICTED: protein CHUP1, chloroplastic-like [Nicotiana sylvestris]
Length=358

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -3

Query  677  ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNK  498
            + +LG L  LE+L+LK  A++G  W L+   FK L+ L I  T+LV+W     S P L  
Sbjct  1    MTMLGRLPNLEMLRLKYFAIQGTNWNLSEGGFKKLKLLHILMTNLVQWKATSDSLPNLEC  60

Query  497  LYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L + HC  L+ +P    D+ +LK++EL   ++    SA  I E++Q  G
Sbjct  61   LVIRHCYKLKEIPAEIGDIPTLKLIELHHCSQAVVTSAEEILEEQQSMG  109



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W  + +L SL  LEVLKL+    +G  W L+   FK L+ L I +T LV W     S 
Sbjct  750  LEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLLHIHQTRLVHWQAASDSL  809

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L  L L  C+ LE +P    D+ +LK+++L   ++ A  SA  I E+++  G
Sbjct  810  PVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAGEILEEQKSIG  863



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = -3

Query  668  LGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLYL  489
            +G L  LE+LKL+        WE +   F  LRFL +   +LV W  ++S F  L  L++
Sbjct  714  IGKLPNLEILKLQGCQFVSRKWEPDEGEFHRLRFLLMENLNLVNWVADESHFRRLQHLFI  773

Query  488  SHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-QGDGF  348
             HC+ LEA+PL  +D+ +L+V+E+         SAR I+E++ + DG 
Sbjct  774  QHCSDLEAIPLVIRDIPTLQVIEVHNCRPSVMNSARMIQEEQLENDGL  821



>ref|XP_009591232.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=743

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 4/122 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     LG L  LEVLK KE+A  G+ W+   T F +L+ L I R++L  W     +FP 
Sbjct  616  WSEADKLGKLESLEVLKFKENAFAGDSWK-PKTGFSALQVLWIERSELESWVASDINFPV  674

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG--FDLSIY  333
            L  L L  C  LEAVPL   ++ +L+ M L  T+ K   SA+ I+E+K      F+ +I+
Sbjct  675  LRHLVLISCDKLEAVPLELANIPNLQEMRLENTS-KVVKSAKEIQERKTSKSIKFNFTIF  733

Query  332  PP  327
            PP
Sbjct  734  PP  735



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK + VL  L  LEVLKLK +A  G  WE     F  L++L I +TDLV W    + F
Sbjct  652  LPWKDMNVLSMLPNLEVLKLKNNAFVGSDWEQYEEGFSRLKYLLIDKTDLVHWRATSTQF  711

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P+L  L L  C  L  VPL F ++  L++++++ +   A  S   I+++++  G D
Sbjct  712  PSLKHLRLFRCRCLREVPLDFAEIPYLQIIDVYGS-YDAVRSVMQIKQEQESVGND  766



>ref|XP_009800104.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800105.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800106.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1741

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L  LE+LKL   A +G +WE+ ++ F  L +L +   ++ +W+    +FP 
Sbjct  1606  WSQISTIGELPNLEILKLHLRAFEGNHWEVKDSEFPELTYLELDDINIAQWSVSDDAFPK  1665

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L  L L+ C  LE +P  F D  SL+ +E+   N   A SA+ I+    E+     F + 
Sbjct  1666  LKCLVLTKCKRLEKIPSHFDDSVSLRSIEVNWCNLSVAESAQEIQTTQHEEMANGAFTVR  1725

Query  338   IYPP  327
             I PP
Sbjct  1726  IQPP  1729



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++  L  LEVLKL++ A +G  WE +   F+ L+FL + ++DL  W  E S FP 
Sbjct  630  WEDMGIVSLLPNLEVLKLRDYAFRGYKWETSEEEFRCLKFLLLDKSDLQHWITESSHFPN  689

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            L  L L  C  L+ +P  F ++ +L+++++   N     SAR I+E +QG G D
Sbjct  690  LKCLVLYRCWCLKEIPDGFGEIPTLELIKVDDGNISLVDSARQIQEVQQGWGND  743



>ref|XP_009630520.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=889

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 63/125 (50%), Gaps = 5/125 (4%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +W     L  L  LEVLKLKE+A  G  WE     F  L+ L I R DL  W    + F 
Sbjct  757  EWSEANRLAQLECLEVLKLKENAFIGTSWESEIGGFSLLKVLWIDRADLKSWKVSNAQFQ  816

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QGDGFDL  342
             L  L L  C  LEAVP+   D++SL+ M L  T  KA  SA+ I  +K    Q   F L
Sbjct  817  NLKNLVLKSCVELEAVPIELADIRSLQEMRLEST-IKAIKSAKEIELKKQQAPQSSKFKL  875

Query  341  SIYPP  327
            +I+PP
Sbjct  876  TIFPP  880



>ref|XP_009797674.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=711

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 62/125 (50%), Gaps = 2/125 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG L  LEVLKLK+ A  GE W      F  L+ L I   DL  W   +  FP
Sbjct  582  DWSEASRLGELECLEVLKLKQDAFTGESWRPEVGGFSELQVLWIEMADLKLWEVSQLHFP  641

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-QGDGFDLSIY  333
             L  L L  C  LEAVP     + S + M L  T  KA  SAR I+ +K +   F+L+I+
Sbjct  642  RLRHLVLISCDKLEAVPYELASIHSFQEMRLENT-IKAVKSAREIQRKKLESINFNLTIF  700

Query  332  PPADN  318
            PP  +
Sbjct  701  PPESD  705



>gb|EYU23506.1| hypothetical protein MIMGU_mgv1a001122mg [Erythranthe guttata]
Length=882

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 0/117 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + V+GSL  LEVLKL    V+GE W      F  L+F SI   D+V W  + S F
Sbjct  728  VRWEDLSVIGSLPYLEVLKLIAGQVEGEVWNPVEGEFLRLKFFSILFVDIVYWNADCSHF  787

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
            P L KL L     LE +PL   ++ +L+++ L+   + AA SA  I  +++ +G D+
Sbjct  788  PVLEKLELVGMRKLEEIPLDIGEIPTLELVMLYGCTESAAISAMKIAVEQENNGNDV  844



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  +G +  LEVLKLK+ A  G+ WE  +  F +L+FL +   +L  W    + +
Sbjct  786  LPWEEMVTVGKIPNLEVLKLKDRAFSGQVWEPIDGGFLALKFLLLENNELEIWKATSTHY  845

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P+L  L L  C +L  +P    ++ +L+++EL+     A  SA+ I E++Q  G D
Sbjct  846  PSLQHLVLRLCDALIEIPCGIGEIPTLQIIELYSCGHSAVRSAKRIHEEQQSIGND  901



>gb|EYU23519.1| hypothetical protein MIMGU_mgv1a022028mg [Erythranthe guttata]
Length=872

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DWK + V+G L  LEVLKLK  +     W      F  L+FL I   DLV W  + S FP
Sbjct  731  DWKDLRVIGLLPNLEVLKLKYLSAGERVWNPVEGGFIRLKFLFIRSIDLVNWNADSSHFP  790

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
             L KL+L     LE +PL   ++ +L +++L   ++ AA SA  I E+++  G D
Sbjct  791  VLEKLFLIGMFELEEIPLDIGEIPTLGLIQLVWCSESAAISAMKIAEEQENAGND  845



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSIGRTDLVKWTCEKSS  516
            + W+ I  +  L  LEVLK+K     G +W LN N +F  L+ L I  T L  W     +
Sbjct  436  LPWEDIANIVMLPNLEVLKIKYHGFYGAFWRLNDNEIFNQLKLLLINETYLKHWDAGSVN  495

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            FP L +L L  C  LE +P  F ++ +L+ +EL      AAASA+ I+E+++  G D
Sbjct  496  FPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKCKTSAAASAKNIQEEQESMGND  552



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++G    LEVLKLK +A +G  W      F  L+FL I  T+L +W      F
Sbjct  779  LSWEELNIVGQWPNLEVLKLKPNACRGLKWHPIEGGFPRLKFLLIEGTNLTRWKATNDHF  838

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            PAL  L + HC  L  +P+ F D+ SL+++EL   N KA   A T+R Q++
Sbjct  839  PALEHLVIKHCFHLVKIPIEFADIYSLQLIEL--QNCKAKLMASTVRIQEE  887



>gb|EYU21178.1| hypothetical protein MIMGU_mgv1a019709mg [Erythranthe guttata]
Length=889

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 0/106 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I W+ + V+GSL  LEVLKLK   VKG  W      F  L+FL I  +DLV W  + S F
Sbjct  759  IRWEDLTVIGSLPNLEVLKLKNRLVKGSVWNPVEGEFLRLKFLLIQWSDLVNWNADSSHF  818

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI  375
            P L KL L     LE +PL   ++ +L ++++   ++ AA SA  I
Sbjct  819  PVLEKLVLESLKKLEEIPLDIGEIPTLGLIQVHWCSESAAISAMKI  864



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK++ ++G L  LEVLKL+ SA  GE WE +   F  L+FL +  +D   W      F
Sbjct  730  MPWKNMDIVGMLPNLEVLKLRSSACIGEEWEPSENGFHQLKFLLLHCSDPNYWKATSDHF  789

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L  C  L+ +PL F D  +L+ +E+    +    SA  I+E+++  G D
Sbjct  790  PLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTSAEQIQEEQRNLGVD  845



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = -3

Query  668  LGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLYL  489
            +G L  LE+LKL+    +   WE  +  F  L+FL +    LV WT + + FP L +L +
Sbjct  745  IGKLPNLEILKLQYCYFESGNWEGEDGEFCRLQFLLMKGLKLVNWTADDTHFPRLEELVI  804

Query  488  SHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
             +C  L+ +PLA  D+ +LKVME+      A ASAR I E +  +G D
Sbjct  805  QYCFELKEIPLAIGDIPTLKVMEVLRCGDSAKASAREIMEAQVDNGND  852



>emb|CDP10805.1| unnamed protein product [Coffea canephora]
Length=1253

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 73/128 (57%), Gaps = 11/128 (9%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTC-----  528
             + W+ +  +G+L  LEVLKL E A +GE WE+    F ++RFL +   ++VKWT      
Sbjct  1125  MPWRKMAAIGNLPNLEVLKLLEEAFEGEIWEMEAEKFPNVRFLKLASLNIVKWTASSEYE  1184

Query  527   --EKSSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQG  357
               ++  FP L KL L  C +L+ +P    +  +L+++E+  C N    +S   I+E+++ 
Sbjct  1185  YEDQDYFPRLQKLVLESCDALQEIPSCLGNSSTLEIIEVSKCPN--CTSSLEEIQEEQRS  1242

Query  356   DGF-DLSI  336
             +G+ DL I
Sbjct  1243  NGYTDLKI  1250



>ref|XP_009620237.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=928

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG L  LEVLKLKE+A  G+ W+     F  L+ L I  TDL  W   +  FP
Sbjct  803  DWSEANSLGELESLEVLKLKENAFIGKSWKPEIGGFSELQVLLIKTTDLETWEASEFHFP  862

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-QGDGFDLSIY  333
             L +L L  C  L AVP     V SL+ M L      A  SA+ I  +K +   F L+++
Sbjct  863  RLRQLVLISCDKLTAVPYELAYVHSLREMRLVNACSTAVRSAKEIERKKLESIKFKLTVF  922

Query  332  PP  327
            PP
Sbjct  923  PP  924



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKW---TCEKSS  516
            W+   VLG+L  LEVLKLK  + +G  WE +   F  L++L +   DLV W   + +   
Sbjct  760  WQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVIWKQASTDSYP  819

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FD  345
            FPAL  L    C  L+ +P    D+ SL+V+EL+  +  A   AR I++ +   G    +
Sbjct  820  FPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSGNSCLE  879

Query  344  LSIYP  330
            + I+P
Sbjct  880  VFIHP  884



>gb|EYU23504.1| hypothetical protein MIMGU_mgv1a021434mg [Erythranthe guttata]
Length=861

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 66/117 (56%), Gaps = 0/117 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + V+GSL  LEVLKL    V+GE W      F  L+FLSI   D+V W  + S F
Sbjct  708  VRWEDLSVIGSLPYLEVLKLSVGRVEGEVWNPVEGEFLRLKFLSILCFDIVYWNADCSHF  767

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
            P L KL L     LE +PL   ++ +L+++ L+   + AA SA  I  +++ +G D+
Sbjct  768  PVLEKLELMGMDKLEEIPLDIGEIPTLELVLLYRCTESAAISAMKIAVEQENNGNDV  824



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + ++G L +LEVLKL  +A KG+ WE+    F  L+FLS+    +  W      FP 
Sbjct  783  WRDLSIVGKLPKLEVLKLSGNAFKGKEWEVVEEGFPHLKFLSLDDVYIQYWRASSDHFPY  842

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            L +L+L  C SL+++P  F D+ +L ++++    +    SA+ I++  Q D +  SI
Sbjct  843  LERLFLKDCYSLDSIPRDFADITTLALIDISKCQQSVGNSAKQIQQDIQ-DNYGSSI  898



>gb|EYU29923.1| hypothetical protein MIMGU_mgv1a026346mg, partial [Erythranthe 
guttata]
Length=303

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            +DW+ +  +GSL  LEVLKL+  +V+G  W      F  L++L I  + L  W  E   F
Sbjct  181  LDWEELKGIGSLPNLEVLKLEYHSVRGSKWNPIEGQFLRLKYLRIAHSTLKYWNAESFHF  240

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            PAL  L L     L  +P    ++ +L ++ L+  +K AA SA  I E++Q  G
Sbjct  241  PALENLVLQKLHKLAEIPSGIGEIPTLGLIHLYDCSKSAAISAMGILEEQQSQG  294



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 6/122 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W+ + ++G L  LEVLKL  +A  G+ W      F  L+ L I   DL  W     +F
Sbjct  771  VNWEDLNIVGELPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKATDDNF  830

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDGFDLSI  336
            P L +L +  C  LE +P+ F D+ SL+++EL  CT +  A++AR  +EQ+     DL I
Sbjct  831  PVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQE-----DLGI  885

Query  335  YP  330
             P
Sbjct  886  KP  887



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L  LEVLKLK  A  G  WE     F SL+ L I  +DL  W+     F
Sbjct  797  LPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEHWSASNDHF  856

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L  C  L+++P    D+ +L+++EL  +++ A  SA+ I+E++Q  G D
Sbjct  857  PCLEHLVLKGCLHLDSIPHELGDIPTLQIIELENSSQSALLSAKEIQEEQQSYGND  912



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +L  L +LEVLKLK  A +G  WE  +  F+ L+FL +  TDL+ W      F
Sbjct  740  LPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQF  799

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L +C  L  +P    ++ +L  +EL+  +  A  SA  IRE++   G D
Sbjct  800  PKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGND  855



>emb|CDP05538.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I V+G L  LE+LKL+ ++  G  W++ +  F+ L+FL + + ++ +W      F
Sbjct  1098  VPWSAISVIGQLPNLEILKLRRNSFSGPRWDVEDGEFQKLKFLELWQLNIQEWNVSSEPF  1157

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMEL-FCTNKKAAASARTIREQKQGDGFDL  342
             P L +L +  C SL+ +P +  D+ +L+ +E+ +C +  AA+SA+ I E+++  G DL
Sbjct  1158  PRLEQLTIRDCYSLQEIPSSIGDIPTLEKLEVHWCFD--AASSAKHILEEQRDMGNDL  1213



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 6/122 (5%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            ++W+ + ++G L  LEVLKL  +A  G+ W      F  L+ L I   DL  W     +F
Sbjct  814  VNWEDLNIVGELPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKATDDNF  873

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDGFDLSI  336
            P L +L +  C  LE +P+ F D+ SL+++EL  CT +  A++AR  +EQ+     DL I
Sbjct  874  PVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQE-----DLGI  928

Query  335  YP  330
             P
Sbjct  929  KP  930



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +L  L +LEVLKLK  A +G  WE  +  F+ L+FL +  TDL+ W      F
Sbjct  740  LPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQF  799

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L +C  L  +P    ++ +L  +EL+  +  A  SA  IRE++   G D
Sbjct  800  PKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGND  855



>emb|CDP13440.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  I  +G L +LEVL L   A +G  WE+N   F  L+FL +   ++ +WT      
Sbjct  617  LPWDRISAIGGLEQLEVLNLVSRAFEGSEWEMNEGEFLKLKFLKLDSLNIARWTASAEPL  676

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQ  366
            P L  L L +C  LE VP  F D+ +L+ +E+    +    S R I E+
Sbjct  677  PNLEHLALRNCKDLEEVPFEFADIPNLQKIEVQFCGQSTEESVRKIEEE  725



>ref|XP_009603761.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=880

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 60/122 (49%), Gaps = 2/122 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG L  LEVLKLK+ A  GE W      F  LR L I   DL  W   +  FP
Sbjct  751  DWSEASRLGKLECLEVLKLKQDAFTGESWRPEVGGFFELRVLWIEMEDLKLWEASELHFP  810

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-QGDGFDLSIY  333
             L  L L  C  LEAVP     + S + M L  T  KA  SAR I+ +K +   F L+I+
Sbjct  811  RLRHLVLISCDKLEAVPYELASIHSFQEMRLENT-IKAVKSAREIQRKKLESINFKLTIF  869

Query  332  PP  327
            PP
Sbjct  870  PP  871



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + +L  L +LEVLKLK  A +G  WE  +  F+ L+FL +  TDL+ W      F
Sbjct  740  LPWDQMTILCKLPKLEVLKLKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQF  799

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L +C  L  +P    ++ +L  +EL+  +  A  SA  IRE++   G D
Sbjct  800  PKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIREEQISMGND  855



>ref|XP_009603760.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 60/122 (49%), Gaps = 2/122 (2%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG L  LEVLKLK+ A  GE W      F  LR L I   DL  W   +  FP
Sbjct  755  DWSEASRLGKLECLEVLKLKQDAFTGESWRPEVGGFFELRVLWIEMEDLKLWEASELHFP  814

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK-QGDGFDLSIY  333
             L  L L  C  LEAVP     + S + M L  T  KA  SAR I+ +K +   F L+I+
Sbjct  815  RLRHLVLISCDKLEAVPYELASIHSFQEMRLENT-IKAVKSAREIQRKKLESINFKLTIF  873

Query  332  PP  327
            PP
Sbjct  874  PP  875



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSS  516
            + WK +  + +L  LEVLK+K++   G+ W LN+  +FK L+FL I  T L  W     +
Sbjct  741  LPWKDMANVITLPNLEVLKIKDNGFLGDEWMLNDEEIFKQLKFLLISWTGLKHWKAGSVN  800

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            FP L +L+L  C +LE +P  F ++ +L+ +EL   +  AA S + I+E+++  G
Sbjct  801  FPKLQRLFLKRCMNLEKIPQDFGEICTLESIELHKCSISAAKSGKDIQEEQESMG  855



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 0/108 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W HI  +G L  LEVLKL   A KG  W++    FK L+FL +   ++ +W       
Sbjct  746  LPWSHISTIGRLPNLEVLKLLLDAFKGLIWDMEEEQFKELKFLKLDNLNVCQWNATCDHL  805

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
            P L +L L +C  LE +P  F D+ +L+V+E+    +    SA+ I E
Sbjct  806  PKLERLVLQNCKGLEEIPYDFADIGTLEVIEVHWCRQSVEESAQRIAE  853



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKW---TCEKSS  516
            W+   VLG+L  LEVLKLK  + +G  WE +   F  L++L +   DLV W   + +   
Sbjct  762  WQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQASTDSYP  821

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FD  345
            FPAL  L    C  L+ +P    D+ SL+V+EL+  +  A   AR I++ +   G    +
Sbjct  822  FPALQHLVFRFCNKLKEIPYEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSGNSCLE  881

Query  344  LSIYP  330
            + I+P
Sbjct  882  VFIHP  886



>ref|XP_011084823.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=557

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + V+ SL  LEVLKL++ A  GE WE +   F  L+FL +   +L  W  E S F
Sbjct  431  LPWQDMAVIHSLPNLEVLKLRDDAFMGEKWECSEGEFPRLKFLLMELLNLKCWQVESSHF  490

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVME--LFCTNKKAAASARTIREQKQGDGFDL  342
            P L +L +  C  L+ +P    D+ +L+++E  +    K AA SA  I+E+++  G DL
Sbjct  491  PRLERLIIKRCWRLDEIPCEIGDIPTLELIEVPIGLGRKSAADSAVLIQEEQRSLGNDL  549



>emb|CDP11157.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W HI  +G L  LEVLKL   A +G  W++    FK L+FL +   ++ +W       
Sbjct  751  LPWSHISTIGRLPNLEVLKLLLDAFEGLIWDMEEEQFKELKFLKLDNLNVSQWNATCDHL  810

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGD  354
            P L +L L +C  LE +P  F  + +LK++E+    + A  SA+ IRE+  GD
Sbjct  811  PKLERLVLQNCKDLEEIPDDFAAIGTLKLIEVHWCGQSAEESAKRIREET-GD  862



>emb|CDP11825.1| unnamed protein product [Coffea canephora]
Length=1245

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 7/118 (6%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWT---CEK  522
             + W  I  + +L  LEVLKL E A  GE W+L    F  LRFL +   D+VKWT   CE 
Sbjct  1117  LPWSKISAVANLPNLEVLKLLEEAFVGETWDLEGEEFPELRFLKLASLDIVKWTAFECE-  1175

Query  521   SSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQGDG  351
             +SFP L KL L  C +LE +P +  +V +L  +E+  C   K+  S   I+E++   G
Sbjct  1176  NSFPRLQKLVLEKCHNLEEIPSSLGNVSTLDTIEVIDC--PKSETSVNEIQEEQISMG  1231



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++G L  LE+LKL   A +G+ WE+ +  F  L++L +   +  +W+    +FP 
Sbjct  1602  WSEISIIGELPNLEILKLLFRAFEGDRWEVKDAEFPKLKYLILDNINFSQWSISDDAFPE  1661

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L  L L+ C  LE +P  F +  S+K +E+       A SA  I+    E+   D F ++
Sbjct  1662  LENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANSALEIQTTQHEEMANDAFTVT  1721

Query  338   IYPP  327
             I PP
Sbjct  1722  IQPP  1725



>ref|XP_011087137.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=870

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 66/115 (57%), Gaps = 1/115 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS-  516
            + W+ + ++  +  LEVLKL+  A +G  W+     FK+LRFL I   DL  WT  + S 
Sbjct  737  LPWEDMSIIACIWNLEVLKLRCYAFRGSVWQTCQKGFKNLRFLLIEDMDLEYWTGNRISF  796

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            FP L +L + HC  L+ +P  F++V +L++ME+        ASA  I +Q++G G
Sbjct  797  FPDLQRLTVGHCYKLKEIPCQFEEVLTLQMMEVVDCAPSLVASAEKIVKQQKGCG  851



>ref|XP_004237189.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
 ref|XP_010319380.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
Length=890

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 62/115 (54%), Gaps = 4/115 (3%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            DW     LG +  L+VLK+KE+A  G  W +    FK L+ L I   D V W      FP
Sbjct  764  DWNQAYRLGQVKNLQVLKMKENAFMGPSWRMEPGGFKKLQVLWIEMADFVSWEASNCPFP  823

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI---REQKQGD  354
             L  L+L  C +LEAVPL    + +L+ M L  T+ KA+ SAR I   +++KQ D
Sbjct  824  RLRSLFLISCLNLEAVPLDLAHLDNLQEMTLENTS-KASKSAREIECEKKKKQAD  877



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L  LEVLKLK  A  G  WE     F SL+ L I  +D+  W+     F
Sbjct  792  LPWESMASLCRLPNLEVLKLKNYAFTGPKWEQVEEGFGSLKLLLIEISDIKHWSASNDHF  851

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L  L L  C  L+++P    D+ +L+++EL  +++ A  SA+ I+E++Q  G
Sbjct  852  PVLEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQSMG  905



>gb|EYU29512.1| hypothetical protein MIMGU_mgv1a022452mg, partial [Erythranthe 
guttata]
Length=816

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I+W+ +  +GS   LEVL+LK+ ++ G  W      F  L++L I   +L  W  E   F
Sbjct  706  IEWEDLTTIGSSPNLEVLQLKDGSMTGSEWNPVEGEFLRLKYLFINSWELKHWNAESFHF  765

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L KLYLS    L+ +PL   ++ +L ++ L   N+ A+ SA +I E+++
Sbjct  766  PVLEKLYLSGLLHLDEIPLGIGEIPTLALIHLLSCNESASMSAMSILEEQE  816



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  +  +G L  LEVLKL   A +GE W +    F  L+FL +   ++ +W       
Sbjct  1326  LPWDCVSEIGRLPNLEVLKLLSRAFEGERWNMKEGEFLKLKFLKLDSLNIAQWKASADHL  1385

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
             P L +L L +C  LE VP  F D+ +L ++E+      A  S R ++E++ G G D
Sbjct  1386  PKLQQLVLRNCRHLEEVPSGFADIPTLVMIEMQLCRSSAEESVRILKEEQLGLGID  1441



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = -3

Query  668  LGSLNELEVLKLKESAVKGEYWELNN-TVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLY  492
            L +L  LEVLKL+++  +G  W L++   F  L+FL +    LV W     +FP L KL 
Sbjct  751  LAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLSEPRLVNWEAGSVNFPNLQKLV  810

Query  491  LSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSIYPPAD  321
            L  C  LE +PL   ++ +L+++EL C +  A  SA  IRE+++  G    D+ +Y   D
Sbjct  811  LRKCIRLEEIPLDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRVYADDD  870



>ref|XP_006356446.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1645

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 69/124 (56%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L  L++LKL     +G+ WE+ ++ F+ L++L +   ++ +W+  + +FP 
Sbjct  1514  WSQILSIGELPNLKILKLLLRTFEGDEWEVKDSEFRELKYLELENLNIAQWSVSEDAFPI  1573

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L +L L+ C  L+ +P  F D  SLK +E+   +   A SA+ I+    ++   D F ++
Sbjct  1574  LERLVLTKCKRLKKIPSHFDDAVSLKSIEVNWCSLGVANSAKEIQAFQHDEIANDAFKVT  1633

Query  338   IYPP  327
             I PP
Sbjct  1634  IQPP  1637



>emb|CDP21316.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+++  + SL +LEVLKLK  A +G  WE     F+ L+ L + +TDLV W    + FP 
Sbjct  56   WQNMTSIASLPKLEVLKLKNYAFQGPKWEPTEGGFRVLKHLLVEKTDLVSWEATSNHFPC  115

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI  375
            L  L L  C  L+ VP    ++ +LK +EL   ++ A  SA +I
Sbjct  116  LEHLVLKSCKYLKEVPYGITEISTLKRIELHNCSESAEISALSI  159



>ref|XP_004236957.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010319428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     L  L  LEVLKLKE+A  G+ W+     F  LR L I R +L  W     ++P 
Sbjct  752  WSEAEKLAQLESLEVLKLKENAFMGDTWKPEVGGFSKLRVLWIERAELETWEASNLNYPI  811

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIYPP  327
            L  L L  C  L AVP+   D+ +L+ M+L  T K   ++   + ++ Q   F LSI+PP
Sbjct  812  LRNLVLVSCDKLNAVPVELADIPNLREMKLENTIKAVKSAKDILLKKSQTVTFKLSIFPP  871



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ +  +GSL  LEV+KL   + +G  WE     F  L+FL I  T+L  W  + S FP+
Sbjct  753  WEDMTTVGSLQNLEVMKLTRCSFEGCKWETIEGEFPRLKFLKIRWTNLQHWVTDSSHFPS  812

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            L  L L  C  L  +P    ++ +LK++E+  +++    SA+ I+E++Q  G D
Sbjct  813  LEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKSAKQIKEEQQSFGND  866



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 64/112 (57%), Gaps = 0/112 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  +  L +LEVLKL+  A  G  WE     F  L+ L I  +DLV+W      F
Sbjct  702  LPWEDMTNISRLPKLEVLKLRNCAFLGPEWEPPEDEFLHLKQLLIENSDLVQWKASTIHF  761

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG  357
            P+L++L L +C  LE +P+   ++ +L+++EL   +K A  SA+ I EQ +G
Sbjct  762  PSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIGEQVEG  813



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W  + +L  L  LE LKL+  A +G  W L+   FK L+ L I + +LV W     S P 
Sbjct  642  WTKMTMLSYLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQPELVHWHATSESLPV  701

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L  L L HC  L+ +P    D+ +LK++EL   ++ A  SA  I +++Q  G
Sbjct  702  LEYLVLRHCYKLKEIPTEIGDIPTLKLIELHYCSQSAVTSAEEILDEQQSLG  753



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 67/115 (58%), Gaps = 1/115 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSS  516
            + W+ +  +  L  LEVLK+K++   G+ W+LN+  +F  L+FL I  T L  W     +
Sbjct  747  LPWEDMANIVKLPNLEVLKIKDNGFLGDVWKLNDEEIFNQLKFLLISWTGLKHWEASSVN  806

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            FP L +L+L  C +LE +P  F ++ +L+ +EL   +  AA S + I+E+++  G
Sbjct  807  FPKLQRLFLKRCMNLEEIPQDFGEICTLESIELHDCSISAAKSGKDIKEEQESMG  861



>ref|XP_009618258.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618266.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618270.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana tomentosiformis]
Length=1741

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L  LE+LKL   A +G +WE+ ++ F  L++L +   ++ +W+    +FP 
Sbjct  1606  WGQISTIGELPNLEILKLHLRAFEGNHWEVKDSEFPELKYLELDDINIAQWSVSDDAFPK  1665

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIR----EQKQGDGFDLS  339
             L  L L  C  LE +P  F D  SL+ +E+   N   A SA+ I+    E+     F + 
Sbjct  1666  LKCLVLIKCKRLEKIPSHFDDSVSLRSIEVNWCNWFVANSAQEIQTTQHEEMANGAFTVR  1725

Query  338   IYPP  327
             I PP
Sbjct  1726  IQPP  1729



>ref|XP_010320671.1| PREDICTED: uncharacterized protein LOC101257665 [Solanum lycopersicum]
Length=2437

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -3

Query  620   VKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLYLSHCTSLEAVPLAFKDV  441
             +KG  W +N+T F+ L++L +   +  KW+  + SFP+L +L L++C  LE +P  F+DV
Sbjct  2330  IKGVQWNVNDTQFRELKYLKLDSLNFAKWSISEDSFPSLERLVLTNCKRLENIPSHFEDV  2389

Query  440   KSLKVMELFCTNKKAAASARTI----REQKQGDGFDLSIYPP  327
              SLK +E+   +   A SA  I    RE    D F ++I PP
Sbjct  2390  VSLKSIEVNWCSWSVANSAEEIQTTQREDMANDAFTVTIQPP  2431



>gb|EPS70910.1| hypothetical protein M569_03853 [Genlisea aurea]
Length=723

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            I W+ I ++G L EL  +KL  +A +GE W  N   FK L+ L I   DL  WT EK  F
Sbjct  467  IPWESISIVGKLPELRTMKLMNNAFRGENWIANENEFKKLQHLVIDGADLKFWTAEKDHF  526

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L  L +  C  L+ +P     + ++K++E+   +  A  SA  I+++ Q
Sbjct  527  PRLEHLTILDCIHLDGIPPQIPLIDTIKMIEVDDASSSALISAGEIKKEMQ  577



>emb|CDP04878.1| unnamed protein product [Coffea canephora]
Length=1428

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + WKH+  +G L  LEVLKL  +A +G  W++    F  L+FL +   D+V+W       
Sbjct  1263  LPWKHMSAIGRLQNLEVLKLLSNAFEGRRWDMKEGEFLKLKFLKLDSLDVVEWNATCDHL  1322

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSL  432
             P L +L L HC  LEAVP +F ++ ++
Sbjct  1323  PNLQQLLLRHCKELEAVPFSFGEIPTI  1349



>gb|EYU24187.1| hypothetical protein MIMGU_mgv1a001243mg [Erythranthe guttata]
Length=855

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + ++GSL  LEVLKLK  A  G  W+     F  L+ L I  TDL  W  E+  F
Sbjct  726  LKWNEMTIVGSLPNLEVLKLKRHACDGFEWKTTEGGFCQLKLLVIDSTDLRVWITERCHF  785

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI-REQKQGDGFDLSI  336
            P L +L L  C  LE +P    ++ +L+ +E+   N     SA+ I  EQ +  G +L I
Sbjct  786  PKLERLVLYDCYKLEKIPFDIGEIPTLQAIEVDLRNSSVVNSAKCIAEEQLESYGNELQI  845



>ref|XP_009788462.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=877

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 62/125 (50%), Gaps = 5/125 (4%)
 Frame = -3

Query  689  DWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFP  510
            +W     L  L  LEVLKLKE+A  G  WE     F   + L I R DL  W    + F 
Sbjct  745  EWSEANRLAQLECLEVLKLKENAFIGTSWESEIGGFSLPKVLWIDRADLKSWKVSNAQFQ  804

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QGDGFDL  342
             L  L L  C  LEAVP+   DV+SL+ M L  T  KA  SA+ I  +K    Q   F L
Sbjct  805  NLKNLVLKSCVELEAVPIELADVRSLQEMRLENT-IKAIKSAKEIELKKQQAPQSSKFKL  863

Query  341  SIYPP  327
            +I+PP
Sbjct  864  TIFPP  868



>ref|XP_009800556.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1192

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LE+ KL   A +GE W ++N  F  L++L +G  ++ +W     +F +
Sbjct  1066  WVEISAIAALPNLEIFKLLSKAFEGEEWNVSNDEFPKLKYLKLGNLNITRWNISDDAFQS  1125

Query  506   LNKLYLSHCTSLEAVPLAFKD-VKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLS  339
             L  + L +C  L  +P  F D  +SL+ +E+F   +  + SAR I E +Q  G   F ++
Sbjct  1126  LEHIVLQNCKLLTEIPSEFGDSCRSLQKIEVFMCGETVSQSARNIEESQQDGGKGKFKVT  1185

Query  338   IYPP  327
             I  P
Sbjct  1186  IQNP  1189



>emb|CDP10800.1| unnamed protein product [Coffea canephora]
Length=1253

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 72/128 (56%), Gaps = 11/128 (9%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTC-----  528
             + W  +  +G+L  LEVLKL + A +GE WE+    F S+RFL +   ++VKWT      
Sbjct  1125  LPWSKMAAIGNLPNLEVLKLLKQAFEGEIWEMEAEKFPSVRFLKLASLNIVKWTASSEYE  1184

Query  527   --EKSSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQG  357
               ++  FP L KL L  C +L+ +P    +  +L+++E+  C N    +S   I+E+++ 
Sbjct  1185  YEDQYYFPRLQKLVLESCDALQEIPSCLGNSSTLEIIEVSKCPN--CTSSLEEIQEEQRS  1242

Query  356   DGF-DLSI  336
             +G+ DL I
Sbjct  1243  NGYTDLKI  1250



>ref|XP_009608248.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=402

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = -3

Query  680  HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
            H+  + +L +LEVLKL    +    WE+N+  F  L+FL +      +W     +FP L 
Sbjct  231  HLTEVATLPKLEVLKLLGVTISSNIWEVNDEKFPKLKFLKLENPSFSEWNASDDAFPCLE  290

Query  500  KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG----DGFDLSI  336
             L L  C  L+ +P  F D  SLK +E+   N++   SA  +RE+ +G     GF+L I
Sbjct  291  HLVLKKCRYLKEIPSRFGDASSLKSVEIISCNEELVKSAEAVREELEGMLGTSGFELFI  349



>ref|XP_010320926.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Solanum lycopersicum]
Length=1785

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++  L  L +LKL   A +G++WE+ ++ F  L++L +    +V+W+    +FP 
Sbjct  1652  WTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPK  1711

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ----GDGFDLS  339
             L  L L+ C  LE +P  F+D   L  +E+   N   A SA+ I+  +      D F ++
Sbjct  1712  LEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVT  1771

Query  338   IYPP  327
             I PP
Sbjct  1772  IQPP  1775



>ref|XP_009800554.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800555.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1233

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  + +L  LE+ KL   A +GE W ++N  F  L++L +G  ++ +W     +F +
Sbjct  1107  WVEISAIAALPNLEIFKLLSKAFEGEEWNVSNDEFPKLKYLKLGNLNITRWNISDDAFQS  1166

Query  506   LNKLYLSHCTSLEAVPLAFKD-VKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLS  339
             L  + L +C  L  +P  F D  +SL+ +E+F   +  + SAR I E +Q  G   F ++
Sbjct  1167  LEHIVLQNCKLLTEIPSEFGDSCRSLQKIEVFMCGETVSQSARNIEESQQDGGKGKFKVT  1226

Query  338   IYPP  327
             I  P
Sbjct  1227  IQNP  1230



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 67/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I  +G L  LEVLKL   A +G+ W +    FK+L+FLS+   ++ +W     +F
Sbjct  1367  LQWIRISTIGRLPNLEVLKLHSGAFEGKIWNVEEE-FKNLKFLSLDNLNIAQWNASCHNF  1425

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSIY  333
             P L +L L +C  LE +P  F  + SL+++E+    K A  SA  I+E    D  D+ ++
Sbjct  1426  PKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVHWCGKSAEESAEQIKE----DYGDIKVF  1481

Query  332   PPADN  318
               + N
Sbjct  1482  IRSSN  1486



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 65/111 (59%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++G L  LEVLKLK+ A +G+ WE     F  L++L +   DLV+W  +++ F
Sbjct  859  LPWERMTIVGLLPCLEVLKLKKDACRGQEWETVEEQFCRLKYLLLEELDLVQWRTKEAPF  918

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L  L +  C  L  +P A  D+ +L+++EL   +  A   A+ I+E+++
Sbjct  919  PRLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTWAKQIQEEQE  969



>emb|CDP05534.1| unnamed protein product [Coffea canephora]
Length=691

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = -3

Query  677  ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNK  498
            I  +G L  LEVLKL++SA     W++ +  F  L+FL +    + KW      FP+L +
Sbjct  573  ISAIGQLPNLEVLKLRKSAFLDLKWDMEDGEFIKLKFLQLSEVQIEKWNACSEPFPSLQR  632

Query  497  LYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ---GDGFDLSI  336
            L L +C  LE +   F D+ +L++M ++  + KA +SA+ I E++Q    DGF++ I
Sbjct  633  LVLINCKGLEEILSIFGDIPTLRIMRMYWCH-KATSSAQQIFEEQQDMGNDGFEVYI  688



>ref|XP_004239116.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
 ref|XP_010320925.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
Length=1825

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++  L  L +LKL   A +G++WE+ ++ F  L++L +    +V+W+    +FP 
Sbjct  1692  WTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPK  1751

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ----GDGFDLS  339
             L  L L+ C  LE +P  F+D   L  +E+   N   A SA+ I+  +      D F ++
Sbjct  1752  LEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVT  1811

Query  338   IYPP  327
             I PP
Sbjct  1812  IQPP  1815



>emb|CDP00696.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = -3

Query  659  LNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLYLSHC  480
            L  LEVLKLK  A  G  WE     F  L  L I  TDLV W      FP L  L L  C
Sbjct  2    LPRLEVLKLKYFAFHGPKWEPKTKGFCRLTHLLIENTDLVHWEATVHHFPRLQYLVLKSC  61

Query  479  TSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG  357
              LE +P+  K++ +L+ +EL   NK     AR I+EQ +G
Sbjct  62   KLLEEIPVDVKEIGTLQRIELHHCNKTTEILAREIQEQVEG  102



>gb|AAC49408.1| PRF [Solanum lycopersicum]
Length=1824

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++  L  L +LKL   A +G++WE+ ++ F  L++L +    +V+W+    +FP 
Sbjct  1691  WTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPK  1750

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ----GDGFDLS  339
             L  L L+ C  LE +P  F+D   L  +E+   N   A SA+ I+  +      D F ++
Sbjct  1751  LEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVT  1810

Query  338   IYPP  327
             I PP
Sbjct  1811  IQPP  1814



>gb|AAF76312.1|AF220603_4 Prf [Solanum lycopersicum]
Length=1825

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++  L  L +LKL   A +G++WE+ ++ F  L++L +    +V+W+    +FP 
Sbjct  1692  WTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPK  1751

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ----GDGFDLS  339
             L  L L+ C  LE +P  F+D   L  +E+   N   A SA+ I+  +      D F ++
Sbjct  1752  LEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVT  1811

Query  338   IYPP  327
             I PP
Sbjct  1812  IQPP  1815



>gb|AAF76308.1| Prf [Solanum pimpinellifolium]
Length=1824

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I ++  L  L +LKL   A +G++WE+ ++ F  L++L +    +V+W+    +FP 
Sbjct  1691  WTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPK  1750

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ----GDGFDLS  339
             L  L L+ C  LE +P  F+D   L  +E+   N   A SA+ I+  +      D F ++
Sbjct  1751  LEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVT  1810

Query  338   IYPP  327
             I PP
Sbjct  1811  IQPP  1814



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L  LEVLKLK  A  G  WE     F SL+ L I   DL  W+     F
Sbjct  800  LPWESMTSLCRLPNLEVLKLKPYAFTGTKWEQVEEGFCSLKLLQIEMFDLEHWSASNDHF  859

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            P L  L L  C  L+++P    D+ +L+++EL  +++ A  SA+ I+E++Q  G
Sbjct  860  PVLEHLVLKCCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQNIG  913



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W+   ++G L  LEVLKLK  A  G  WE     F  L  L I  TDLV W      F
Sbjct  1001  LPWEDTSLIGMLPRLEVLKLKHFAFHGPKWEPKTKGFCRLTHLLIENTDLVHWEATVHHF  1060

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG  357
             P L  L L  C  LE +P   +++ +L+ +EL   NK     AR I+EQ +G
Sbjct  1061  PRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILAREIQEQVEG  1112



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSS  516
            + W+ +  + +L  L+VLK+K++   G+ W L++  +F  L+FL I RT+L +W     +
Sbjct  759  LPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLLIDRTNLKRWKAGSVN  818

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            FP L  L L  C  LE +P    ++ +L+ +EL      AA S + I+E+++  G D
Sbjct  819  FPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVKEIQEEQESMGND  875



>gb|EYU17763.1| hypothetical protein MIMGU_mgv1a002610mg [Erythranthe guttata]
Length=654

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 14/130 (11%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  +  L  + +LEVLKLK+ A  G  W + + VF SL+FL I   DLV W      F
Sbjct  522  LQWSDMSTLAKIEKLEVLKLKQGAFVGIQWTVRD-VFPSLQFLLIDDADLVIWEASAKHF  580

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGD-------  354
            P+L  L +  C  L+ +PL     K+L+ +++    K A ASAR I+E+K+ D       
Sbjct  581  PSLTCLSIKKCQKLKEIPLEL--AKNLQRLDIDFLRKSATASARAIQERKKKDQEHEQKV  638

Query  353  ----GFDLSI  336
                GF LS+
Sbjct  639  RWGVGFQLSV  648



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++G L  LEVLKL   A  GE W      F  L+ L I   DL  W     +F
Sbjct  775  VRWEDLNIVGELPNLEVLKLMWKACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATDDNF  834

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQ  360
            P L +L   HC SLE +P+ F  + SL+++EL  CT +  A++ R   EQ++
Sbjct  835  PVLERLLFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEASAVRIQEEQEE  886



>emb|CDP04885.1| unnamed protein product [Coffea canephora]
Length=989

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WKH+  +G L  LEVLKL  +A +G  W++    F  L+FL +   ++V+W       
Sbjct  870  LPWKHMSAIGRLQNLEVLKLLSNAFEGRIWDMREGEFLKLKFLKLDSLNVVEWNATCDHL  929

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQ  366
              L +L L HC  LEAVP +F ++ +L ++++         S R I EQ
Sbjct  930  LNLQQLVLRHCKELEAVPFSFGEIPTLLMIQVQRCGLSTEESVRDIEEQ  978



>ref|XP_009777062.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=1424

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = -3

Query  680   HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
             H+  + +L +LEVLKL    +    WE+N+  F  L+FL +      +W     +FP L 
Sbjct  1294  HLTEVATLPKLEVLKLLGVTISSNVWEVNDEKFPQLKFLKLENPSFSEWNASDDAFPCLE  1353

Query  500   KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG----DGFDLSI  336
              L L  C  L+ +P  F D  SLK +E+   N++   SA  +RE+ +G     GF+L I
Sbjct  1354  HLVLKKCRYLKEIPSRFGDASSLKSVEIISCNEELVKSAEAVREELEGMSGTSGFELFI  1412



>ref|XP_009777064.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1349

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = -3

Query  680   HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
             H+  + +L +LEVLKL    +    WE+N+  F  L+FL +      +W     +FP L 
Sbjct  1219  HLTEVATLPKLEVLKLLGVTISSNVWEVNDEKFPQLKFLKLENPSFSEWNASDDAFPCLE  1278

Query  500   KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG----DGFDLSI  336
              L L  C  L+ +P  F D  SLK +E+   N++   SA  +RE+ +G     GF+L I
Sbjct  1279  HLVLKKCRYLKEIPSRFGDASSLKSVEIISCNEELVKSAEAVREELEGMSGTSGFELFI  1337



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 65/112 (58%), Gaps = 1/112 (1%)
 Frame = -3

Query  677  ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNK  498
            + ++GSL  LEVLKL   ++ G  WE+    +  LRFL +   D+  W  E   FP+L +
Sbjct  799  MTMIGSLANLEVLKLLNMSLVGALWEVVEEEYSCLRFLMMEWLDIKTWLAESGCFPSLER  858

Query  497  LYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDL  342
            L + HC++LE +P    D+ +L+V+E+   ++ A  SA  I E++Q  G D+
Sbjct  859  LVIRHCSALENIPSGIGDIPTLRVIEV-DDSEMAEDSAEEILEEQQDLGNDV  909



>ref|XP_009777063.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=1394

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = -3

Query  680   HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
             H+  + +L +LEVLKL    +    WE+N+  F  L+FL +      +W     +FP L 
Sbjct  1264  HLTEVATLPKLEVLKLLGVTISSNVWEVNDEKFPQLKFLKLENPSFSEWNASDDAFPCLE  1323

Query  500   KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG----DGFDLSI  336
              L L  C  L+ +P  F D  SLK +E+   N++   SA  +RE+ +G     GF+L I
Sbjct  1324  HLVLKKCRYLKEIPSRFGDASSLKSVEIISCNEELVKSAEAVREELEGMSGTSGFELFI  1382



>ref|XP_009779606.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=906

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ + ++G L  LEVLKL  +A  GE W      F  L+ L I   DL  W     +F
Sbjct  776  VRWEDLNIVGELPSLEVLKLMWNACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATDDNF  835

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQK  363
            P L +L +  C  LE +P+ F D+ SL+++EL  CT +  A++AR  +EQ+
Sbjct  836  PVLERLLIRECHMLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQE  886



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I  +G L  LEVLKL   A  G+ WE+    F+SL++L +    + +W       
Sbjct  1355  LPWSQISTIGKLPHLEVLKLLSRAFDGQIWEMTEGEFQSLKYLKLDNLWIAQWKASNDHL  1414

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             P L  L L  C  LE VP +  D+++L+ +E+   ++ AA S + I ++++  G
Sbjct  1415  PCLRHLVLQRCKKLEEVPSSLGDIRTLERIEVHWCSQSAAVSVKEIEDEQRDIG  1468



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 0/108 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI V+G L  LEVLKL   A +G+ WE+    F+ L+FL +   ++ +W       
Sbjct  1269  LPWDHISVIGRLPNLEVLKLLSGAFEGKRWEMREEEFRELKFLKLDALNIAEWEACCDHL  1328

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
             P L +L L +C  L  +P  F+ + +L+V+E+    + A  SA+ I E
Sbjct  1329  PKLERLVLQNCKDLMQIPYDFESITTLEVIEVHWCGESAEESAKEIGE  1376


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I  +G L +LEVLKL   A +G  W++ +  F+ L+FL +   ++ +W       
Sbjct  2352  LPWNRISAIGKLPKLEVLKLLSGAFEGPIWDMGDEEFQELKFLKLDSLNVAQWNASCDHL  2411

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMEL  417
             P L +L L +C  LE +P  F ++  L+++E+
Sbjct  2412  PKLERLVLQNCKELEKIPHDFAEISMLEMIEI  2443



>emb|CDP10323.1| unnamed protein product [Coffea canephora]
Length=686

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  +  L  LEVLKLK  A +G  W+L + VF+ L+ L I +TD+V+W  E   F
Sbjct  568  LPWEDMTNVAKLPNLEVLKLKNYAFRGSTWKLTDEVFRCLKQLLIEKTDIVQWEAEDDHF  627

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE  369
            P L  L L  C  L  +P    ++ +L+ +EL   N+ A  SA+  ++
Sbjct  628  PCLQFLILRSCEFLAELPYVLGEIPTLERIELHYCNESAELSAQEFKD  675



>emb|CDP08023.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +G L  LEVLKL   A +G  W++ +  F+ L+FL +   ++V+W       
Sbjct  1366  LPWSHISAIGKLENLEVLKLLSGAFEGRTWKMEDGEFQKLKFLCLDTLNIVEWIASYEQL  1425

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQ  366
             P L +L + +C  L+ +P    ++ SL+ +E+    + A  SA  IRE+
Sbjct  1426  PRLQRLVIQNCKELKELPDDLANITSLETIEVHWCGQSAEESANNIREE  1474



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  +  +G L  LEVLKL  ++ +G+ W++    F  L+FL +   D+  W   +   
Sbjct  1142  LPWSAVSAIGKLPNLEVLKLLHASFEGKTWDMKEEEFLKLKFLKLESLDIAHWNASEDHL  1201

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
             P L  L +  C +L  +PL   D+ +L+ +EL    + A  SART++E+++  G D
Sbjct  1202  PCLETLVVKKCHALTEIPLCLGDIPTLQRIELQNCTRSAWISARTVKEKQKEMGND  1257



>ref|XP_009609967.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=468

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNN-TVFKSLRFLSIGRTDLV-KWTCEKSSF  513
            WK I  L  L  LE LKLK +AVKG  W L++   F+SL+ L I  T     W     +F
Sbjct  356  WKDISTLAMLPNLEELKLKYNAVKGGVWRLSDEDKFESLKLLLIATTTFFHHWEASSDNF  415

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L +L L++C  L+ +P  F ++ SL+ +EL   N  A  SAR I++++Q
Sbjct  416  PNLKRLVLNNCHYLKQIPTDFGEICSLESIELHYCNTTAEDSARKIKQEQQ  466



>emb|CDP04753.1| unnamed protein product [Coffea canephora]
Length=1258

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L  L+VLKLK  A  GE W      F SLR L + R D  +WT    +FP 
Sbjct  1130  WSEISTIGKLPNLQVLKLKHEAFAGEEWVKEEGEFPSLRVLKLARLDFRRWTAASDNFPR  1189

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             L +L L +C  LE VP    +  +L+ +E+    +   +S   I+E++   G
Sbjct  1190  LEQLVLYNCRELEEVPSCLGECPTLEAIEVGRCGESVVSSVEKIQEEQMDMG  1241



>emb|CDP08019.1| unnamed protein product [Coffea canephora]
Length=1758

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  + SL  LEVLKL   A  G  W++    F+ L+FLS+   D+ +W       
Sbjct  1635  LPWTHISAISSLPNLEVLKLLSGAFMGRTWDMMEDEFQKLKFLSLETLDIAEWNASYDHL  1694

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI  375
             P L +L L HC  LE +P    D+ SL+ +E+    +    SA  I
Sbjct  1695  PRLERLVLQHCKDLEKIPEDLSDITSLETIEVHWCGQSVEESAIEI  1740


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W HI  +G L  L+VLKL   A +G+ W++    F++L+FL +   ++ +W      F
Sbjct  1193  LPWSHISTIGRLPNLKVLKLLSGAFEGKIWDVEEE-FQNLKFLRLDNLNIAQWNASCDDF  1251

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGD  354
             P L +L L +C  LE +P  F ++ +L ++E+    + A  SA+ I E++ GD
Sbjct  1252  PKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVHWCGRSAEESAKKI-EEEYGD  1303



>emb|CDP13141.1| unnamed protein product [Coffea canephora]
Length=692

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W HI  +G L  LEVLKL   A  G+ W++    F++L+FLS+   ++ +W      F
Sbjct  560  LPWSHISTIGRLPNLEVLKLLSGAFVGKIWKVEEE-FQNLKFLSLDSLNIAQWNASCDDF  618

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKK  399
            P L +L L +C  LE +P  F D+ +L+++E+ C  ++
Sbjct  619  PKLERLILQNCKDLEEIPAEFADIYTLEMIEVHCPYQE  656



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (55%), Gaps = 1/117 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            WK + ++G L +LEVLKL  +  KGE WE+    F  L+FL + +  +  W      FP 
Sbjct  782  WKDLSIVGKLPKLEVLKLSYNPFKGEEWEVVAEGFPHLKFLFLDKVYIRYWRASSDHFPY  841

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            L +L+L  C  L+++P  F D+ +L ++++    +    SA+ I++  Q D +  SI
Sbjct  842  LERLFLRACYFLDSIPRDFADITTLALIDITRCQQSVGNSAKQIQQDIQ-DNYGSSI  897



>gb|EPS69725.1| hypothetical protein M569_05040 [Genlisea aurea]
Length=121

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -3

Query  668  LGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLYL  489
            LG L++LE+LKLKESA  GE W+++ + F SL +L I R+DL  WT  ++SF  L  L +
Sbjct  4    LGMLSKLEILKLKESAFIGEKWQIDGSGFHSLEYLYIERSDLTLWTVSENSFEKLRYLVI  63

Query  488  SHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAAS  387
             +C  L  +P     V+ LK +E+   ++ A +S
Sbjct  64   KNCEKLLNIPDGL--VRKLKTLEVERVSRDAMSS  95



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVK-WTCEKSSFP  510
            W+ + ++G L +LEVLKL  +A  G+ W      F  L+ L I     +K W     +FP
Sbjct  722  WEDMDIIGELPDLEVLKLMLNACCGQEWHPIAGGFTRLKLLLIKHNYHLKYWKATNDNFP  781

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMEL-FCTNKKAAASARTIREQKQ  360
             L +L +++CT LE +P+ F D+ SL+++EL +CT +  A++AR  +EQ+ 
Sbjct  782  VLERLVITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQEQED  832



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L  LEVLKLK  A  G  WE     F SL+ L I  +DL +W+     F
Sbjct  833  LPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHF  892

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L  C  L+++P     + +L+++EL  +++ A  SA+ I+E++Q  G D
Sbjct  893  PCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGND  948



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W+ +  L  L  LEVLKLK  A  G  WE     F SL+ L I  +DL +W+     F
Sbjct  848  LPWESMTSLCRLPNLEVLKLKNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHF  907

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
            P L  L L  C  L+++P     + +L+++EL  +++ A  SA+ I+E++Q  G D
Sbjct  908  PCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGND  963



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 3/122 (2%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W ++ ++  L  LEVLKL  +A  GE W  N  VF  L+ L I    L  W     +FP 
Sbjct  778  WSYLDIIAELPNLEVLKLVLNACHGEEWNPNVRVFTQLKVLLIQANYLESWKATNDNFPV  837

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMEL-FCTNKKAAASARTIREQKQ--GDGFDLSI  336
            L +L L  C+ L+ +P+ F D+ + +++EL  C    A ++AR  +EQ+    D  D+ I
Sbjct  838  LERLVLGSCSYLKEIPIEFADINTSQLIELDSCPPILAESAARIQQEQEDLGNDPIDVHI  897

Query  335  YP  330
             P
Sbjct  898  IP  899



>gb|EYU31572.1| hypothetical protein MIMGU_mgv1a024734mg [Erythranthe guttata]
Length=826

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + W  + ++GSL  LEVLKLK  +VKG  W      F  L+FL I + D++ W  + S F
Sbjct  699  LHWDDLTMIGSLPYLEVLKLKRGSVKGREWNPVEGEFLRLKFLLIYKCDIIYWNADSSHF  758

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            P L  L L     L+ +P    ++ +L V+ L+  ++ A  SA  I E+++
Sbjct  759  PVLESLVLVGLVDLDEIPSDIGEITTLGVVSLYDCSESATLSAMKIAEEQE  809



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 65/119 (55%), Gaps = 3/119 (3%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTD---LVKWTCEK  522
            ++W+ + +L  L  LEVLKLK+ A +G  W+L++        L     +   L +W    
Sbjct  624  LEWEDMNILSKLPNLEVLKLKDHAFRGHIWKLSDEDADGFLKLKFLLLEHMHLEQWEATS  683

Query  521  SSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFD  345
              FP+L  L L+HC SLE +P  F ++++L+++EL    +    SA  I+E++Q  G D
Sbjct  684  YHFPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQIQEEQQSFGND  742



>gb|EYU23534.1| hypothetical protein MIMGU_mgv1a023257mg, partial [Erythranthe 
guttata]
Length=913

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
            + WK + ++GSL  LEVL L + +     W      F  L++L I   DLV+W  + S F
Sbjct  754  VHWKDLTIIGSLPNLEVLNLDDVSAVEPVWNPVEGEFLRLKYLFISYIDLVQWNADSSHF  813

Query  512  PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTI  375
            P L KL+L+    LE VPL   ++ +L  ++L   ++ AA SA  I
Sbjct  814  PVLEKLFLTQMYKLEEVPLDIGEIPTLGFLQLLECSESAAISAMRI  859



>ref|XP_009618066.1| PREDICTED: putative late blight resistance protein homolog R1B-23, 
partial [Nicotiana tomentosiformis]
Length=738

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRT-DLVKWTCEKSSFP  510
            W     LG L  LEVLKLKE A  G+ W+     F  L+ L I +  +L  W     +FP
Sbjct  615  WSEANRLGQLESLEVLKLKEDAFIGDSWQPEVGGFSQLQVLWIEKAAELETWEASNLNFP  674

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK--QGDGFDLSI  336
             L  L L  C  L+AVP    D+ +LK M L  T+ KA  SA+ I E K  +   F+L++
Sbjct  675  ILRHLVLISCDKLQAVPRGLADIPNLKEMRLENTS-KAVKSAKDILESKTSKSSKFNLTV  733

Query  335  YPP  327
            +PP
Sbjct  734  FPP  736



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = -3

Query  668  LGSLNELEVLKLKESAVKGEYWELNN-TVFKSLRFLSIGRTDLVKWTCEKSSFPALNKLY  492
            L +L  LEVLKL+++  +G  W L++   F  L+FL +    L+ W     +FP L KL 
Sbjct  747  LAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLAEPRLLNWEAGSVNFPNLQKLV  806

Query  491  LSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FDLSIYPPAD  321
            L  C  LE +P+   ++ +L+++EL C +  A  SA  IRE+++  G    D+ +Y   D
Sbjct  807  LRKCICLEEIPIDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRVYVDDD  866



>gb|EYU17689.1| hypothetical protein MIMGU_mgv1a024130mg [Erythranthe guttata]
Length=872

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 3/120 (3%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSSFP  510
            W+ +  +  L  LEVLKL+  A +G  WE++ + +F+ LR+L I  TDLV WT E  SFP
Sbjct  747  WEDMNKIALLPNLEVLKLQCHAFRGSIWEMHGSALFRELRYLLIEDTDLVHWTAEDGSFP  806

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIRE--QKQGDGFDLSI  336
             L +L + HC  LE +P        L+++E+   N      A  I E  +K+ +  D+ I
Sbjct  807  WLKRLSIKHCYKLERIPRRLITYGFLELIEVVDCNPSVVNVALEIEESREKRNNYIDVRI  866



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = -3

Query  677   ICVLGSLNELEVLKLKESAVKGEYWELNNT-VFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
             +  +G L+ LE L LK++ ++GE W +     F++L+ L++ R +L KW   + SFPAL 
Sbjct  1622  LSTIGILSNLEELYLKDAIIEGEEWNMGEEDTFQNLKCLTLQRVNLAKWEVREESFPALE  1681

Query  500   KLYLSHCTSLEAVPLAFKDVKSLKVMEL  417
             KL L  C  LE +P +F D+ SLK +EL
Sbjct  1682  KLRLRDCRKLEEIPPSFGDICSLKSIEL  1709



>ref|XP_009594808.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=262

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 0/115 (0%)
 Frame = -3

Query  680  HICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALN  501
             I  + SL  LEVLKL++ A + + WE+ +  F  L+FL +    L KW   + +F  L 
Sbjct  144  RISTIASLLNLEVLKLQQVAFEMDEWEVRDNEFPQLKFLELENLKLSKWEVSEEAFCCLE  203

Query  500  KLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            KL L  C+ LEA+P  F+D   L+ +E+   +K  A S   I+E++  +G+   I
Sbjct  204  KLVLHGCSHLEAIPDCFEDQGYLQYIEVKSCSKVVADSVGDIKEKRVQNGYKCDI  258



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 0/112 (0%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L +LEVLKL   +V G+ WE+    F +LR L +   D  +WT    +FP 
Sbjct  1128  WVEISTIGKLPKLEVLKLLTDSVVGKEWEMTEGEFPTLRILKLRDLDFRRWTASSDNFPR  1187

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             L KL +  C  LE VP    + ++L+++E+    +  A S + I+++++  G
Sbjct  1188  LEKLVVHWCRELEEVPFCLGECQALEMIEVRGCRESVANSVKQIQQEQRDMG  1239



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -3

Query  677  ICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPALNK  498
            +  +GSL  L VLKL+  + +G  WE     F  L+FL I  T+L  W  + S FP L +
Sbjct  780  MATIGSLPNLHVLKLRRCSFRGGKWETTEGEFAQLKFLKIESTNLKHWVTDSSHFPTLER  839

Query  497  LYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
            L L HC  L  +P    ++ +L+++E+   ++    SA+ I+++++  G
Sbjct  840  LLLYHCPELYEIPNVIGEIPTLELIEVKSWDEFLGNSAKRIKQEQEDSG  888



>emb|CDP11636.1| unnamed protein product [Coffea canephora]
Length=984

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W HI  +G L  LEVLKL     +   WE+ +  F  L+FL +  +++V W       P 
Sbjct  862  WDHISTIGCLENLEVLKLLSITFESTQWEMQDGEFPELKFLKLHNSNIVDWNASCDHLPN  921

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            L +L L  C +L  VP+ F D+ +L+V+E+           R ++E++Q
Sbjct  922  LQQLVLQKCDNLREVPIDFVDITTLQVIEVQRCGDSVEELVRRLKEEEQ  970



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +G L  LEVLKL+  A  GE WE+    F +LRFL +   D+ +WT    +F  
Sbjct  1037  WSSISRIGKLPNLEVLKLRYQAFVGEKWEVEEGEFPNLRFLKLSSLDIHRWTASSDNFSL  1096

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             L KL L  C  LE VP    +  +L+++E+    K    + + I++++   G
Sbjct  1097  LEKLVLHDCVKLEEVPSCLGESPTLEMIEVSSCGKSTVNAIKQIQQEQMDMG  1148



>ref|XP_006349898.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=386

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = -3

Query  683  KHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSI--GRTDLVKWTCEKSSFP  510
            +H+  +GSL  L+VLKLK  + +   WE+ +  F  LR L +  G+    +WT  + SF 
Sbjct  248  QHLSEIGSLQNLQVLKLKGISFETCKWEVRDGEFPQLRALKLHAGQAHFEEWTVAEDSFA  307

Query  509  ALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK----QGDGFDL  342
             L +L LS C  L+ +P  F D+ SLK +E+   N+    SAR IRE +    Q   F++
Sbjct  308  NLERLVLSDCVFLKEIPSCFGDISSLKSIEVRNCNENVDKSARDIRETQVEDYQNSEFEI  367

Query  341  SIY  333
             I+
Sbjct  368  FIH  370



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 66/116 (57%), Gaps = 3/116 (3%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSI-GRTDLVKWTCEKS  519
             + W+ + VL +L  LEVLK  +SA  G  W LN + VF+ L++L I    DL +W     
Sbjct  1172  LPWEEMDVLANLPNLEVLK-ADSAFNGTDWTLNEDVVFQKLKYLRIWSADDLERWEATSD  1230

Query  518   SFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
             +FP L KL L H   LE +P +  ++ +LK++++   N     SAR I +++QG G
Sbjct  1231  NFPMLEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSARNILQEQQGWG  1286


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 4/122 (3%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELN-NTVFKSLRFLSIGRTD-LVKWTCEKS  519
            + W+ + VL +L  LEVLK  + A  G  W+LN + VF+ L++L I R D L  W     
Sbjct  326  LPWEDMAVLANLPNLEVLK-ADHAFTGTDWDLNEDVVFQKLKYLRIKRADDLEMWEAASD  384

Query  518  SFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG-FDL  342
            SFP L +L L H   LE +P +F ++ +LK++++   +     SAR I E +Q  G ++L
Sbjct  385  SFPMLEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNILEDQQSWGNYEL  444

Query  341  SI  336
             I
Sbjct  445  QI  446



>gb|EYU21170.1| hypothetical protein MIMGU_mgv1a025737mg [Erythranthe guttata]
Length=817

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ + V+GSL  LEVLKL   +VKG  W      F  L+FLSI  +DLV W    S FP 
Sbjct  672  WEDLTVIGSLPCLEVLKLSMGSVKGTVWNPVEGEFLRLKFLSIYWSDLVYWNAGSSHFPI  731

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            L KL L     L+ +P+   ++ +L+ + +    + AA SA  I E+++
Sbjct  732  LEKLVLELMFGLDEIPIEIGEIPTLEFIHVRRCTESAAVSAMKIAEEQE  780



>ref|XP_009763533.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763534.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763535.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763536.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763537.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763538.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763539.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763540.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=1747

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = -3

Query  686   WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
             W  I  +  L  LE+LKL   A +G+ WE+ ++ F  L++L +   ++ +W+  + +FP 
Sbjct  1618  WYQISTIAELPNLEILKLLLRAFEGDEWEVKDSEFPELKYLELDDLNIARWSVSEDAFPM  1677

Query  506   LNKLYLSHCTSLEAVPLAFKDVKSLKVMEL-FCTNKKAAAS-ARTIREQKQGDGFDLSIY  333
             L  L L+ C  L+ +P  F +  SL+ +E+ +C+   +A    RT  E    D   ++++
Sbjct  1678  LEHLVLTKCKKLKEIPSQFDNAISLRRIEVNWCSWPNSAQEIQRTHHEDMTNDALTIAVH  1737

Query  332   PP  327
             PP
Sbjct  1738  PP  1739



>ref|XP_009610033.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=731

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ I  +G L  LE L L    ++ + W++N   F++L  L +    +VKW   + +FP 
Sbjct  608  WRRISTIGELPNLENLNLDSCHIEEDKWDVNVGEFRNLNILKLQSLGIVKWNASEDAFPN  667

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK  363
            L +L L HC  LE++P +F+ + SL+++E+   ++ +  SA  I+E +
Sbjct  668  LKRLVLRHCGKLESIPSSFESLYSLQLIEVENCSQSSTNSAMEIKETQ  715



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (56%), Gaps = 1/117 (1%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            WK + ++G L +LEVLKL  +A KG+ WE+    F  L+ L + +  +  W      FP 
Sbjct  777  WKDLSIVGKLPKLEVLKLSYNAFKGKEWEVVEEGFPHLKSLFLYKVYIRYWRARSDHFPY  836

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGFDLSI  336
            L +L+L  C SL+++P  F D+ +L ++++    +    SA+ I++  Q D +  SI
Sbjct  837  LERLFLGGCYSLDSIPRDFADITTLALIDISYCRQSVGNSAKQIQQDIQ-DNYGSSI  892



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKW---TCEKSS  516
            W+   VLG+L  LEVLKLK+ + +G  WE +   F  L++L +   DLV W   + +   
Sbjct  750  WEDARVLGNLPNLEVLKLKDFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQASTDSYP  809

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG---FD  345
            FP L  L L  C  L+ +P    D+ SL+V++L   +  A   AR I +++   G    +
Sbjct  810  FPVLQHLVLRFCYKLKEIPYEIGDIPSLQVIKLHSCSPYATRLARMIEKEQIDSGNSCLE  869

Query  344  LSIYP  330
            + I+P
Sbjct  870  VFIHP  874



>ref|XP_009610032.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=734

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W+ I  +G L  LE L L    ++ + W++N   F++L  L +    +VKW   + +FP 
Sbjct  611  WRRISTIGELPNLENLNLDSCHIEEDKWDVNVGEFRNLNILKLQSLGIVKWNASEDAFPN  670

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQK  363
            L +L L HC  LE++P +F+ + SL+++E+   ++ +  SA  I+E +
Sbjct  671  LKRLVLRHCGKLESIPSSFESLYSLQLIEVENCSQSSTNSAMEIKETQ  718



>ref|XP_011071970.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=906

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAV-KGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSS  516
            +DW  +  LG ++ L+VLKLK  A  +G  W++ +  F+ L+FL I  TDL+ W      
Sbjct  774  LDWSDMSTLGEIDTLQVLKLKNKAFSRGSRWKVQDGSFEKLQFLLIANTDLIYWVASAGH  833

Query  515  FPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQ  360
            FP+L  L L +C  L  +PL     +SL+ +++      A  SA+ I+E+K+
Sbjct  834  FPSLRCLVLRNCEKLSEIPLCL--AESLEKLDIAHVPDSAFDSAKKIQEKKE  883



>emb|CDP12798.1| unnamed protein product [Coffea canephora]
Length=1266

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 0/114 (0%)
 Frame = -3

Query  692   IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSF  513
             + W  I  +G L  LEVLKL+  A+  E WE+    F SLRFL + + DL  WT    +F
Sbjct  1140  MPWSEISTIGKLPSLEVLKLRNKAIDREKWEMKAGEFLSLRFLELSQLDLRSWTATSDNF  1199

Query  512   PALNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDG  351
               L KL +  C  LE VP    +  +L+++EL    + A  S + I+ ++   G
Sbjct  1200  SRLEKLVVQSCWKLEEVPSCLGECLNLEMIELKWCRESAVTSVKQIQREQMDAG  1253



>emb|CDP10809.1| unnamed protein product [Coffea canephora]
Length=644

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 69/128 (54%), Gaps = 11/128 (9%)
 Frame = -3

Query  692  IDWKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTC-----  528
            + W  +  +G+L  LEVLKL   + +GE WE+    F  +RFL +    +VKWT      
Sbjct  516  LPWSKMATIGNLPNLEVLKLLRRSFEGEIWEMEVEKFPKVRFLKLASLHIVKWTASSEYE  575

Query  527  --EKSSFPALNKLYLSHCTSLEAVPLAFKDVKSLKVMELF-CTNKKAAASARTIREQKQG  357
              E+  FP L KL L  C +L+ +P    +  +L+++E+  C N    +S   I+E+++ 
Sbjct  576  YEEQDYFPRLQKLVLESCDALQEIPSCLGNSSTLEIIEVSKCPN--CTSSLEEIQEEQRS  633

Query  356  DGF-DLSI  336
            +G+ DL I
Sbjct  634  NGYTDLKI  641



>ref|XP_006360433.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=358

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = -3

Query  683  KHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPAL  504
            + I  +  L  LEVLKL++ A +   WE+ +  F  L+ L +    L KW   + +F  L
Sbjct  239  EEIATIAKLVNLEVLKLRQVAFEMGEWEVRDQEFSQLKLLELENLQLSKWEVSEEAFDRL  298

Query  503  NKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQGDGF--DLSIY  333
             KL L  C  LEA+P +F+++  L+ +E+   ++  A SAR I+E ++G G   D+ I+
Sbjct  299  EKLVLRGCLHLEAIPDSFQELSCLRYIEVKSCSEDVADSARIIKETREGYGHKCDVKIF  357



>ref|XP_004236959.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=884

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 64/121 (53%), Gaps = 3/121 (2%)
 Frame = -3

Query  686  WKHICVLGSLNELEVLKLKESAVKGEYWELNNTVFKSLRFLSIGRTDLVKWTCEKSSFPA  507
            W     LG L  LEVLKLKE+A  G+ W+     F  LR L I R +L  W     ++P 
Sbjct  752  WSEAEKLGQLESLEVLKLKENAFVGDTWKPELGGFCKLRVLWIERAELETWEASNLNYPI  811

Query  506  LNKLYLSHCTSLEAVPLAFKDVKSLKVMELFCTNKKAAASARTIREQKQG--DGFDLSIY  333
            L  L L  C  L AVP+   D+ +L+ M+L  T  KA  SA+ I E+K+   + F  SI+
Sbjct  812  LRNLVLVSCDKLNAVPVELADIPNLREMKLENT-IKAVKSAKDILERKKSKDEKFKCSIF  870

Query  332  P  330
            P
Sbjct  871  P  871



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156