BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4155

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618741.1|  PREDICTED: chalcone synthase                       215   6e-64   Nicotiana tomentosiformis
emb|CAA74847.1|  anther-specific protein                                213   2e-63   Nicotiana sylvestris
ref|XP_009785374.1|  PREDICTED: chalcone synthase                       213   5e-63   Nicotiana sylvestris
gb|ACY74337.1|  putative chalcone synthase                              207   4e-61   Artemisia annua [sweet Annie]
gb|AGO05924.1|  anther-specific protein                                 208   4e-61   Capsicum annuum
emb|CAN83038.1|  hypothetical protein VITISV_034337                     206   9e-61   Vitis vinifera
ref|XP_002276642.1|  PREDICTED: chalcone synthase isoform X2            206   1e-60   Vitis vinifera
ref|XP_010692112.1|  PREDICTED: chalcone synthase                       206   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010661353.1|  PREDICTED: chalcone synthase isoform X1            206   2e-60   
emb|CBI16627.3|  unnamed protein product                                206   2e-60   Vitis vinifera
ref|XP_011094451.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone syn...    205   4e-60   
ref|XP_008375736.1|  PREDICTED: chalcone synthase                       204   1e-59   Malus domestica [apple tree]
ref|XP_007052226.1|  Chalcone and stilbene synthase family protein      203   3e-59   
emb|CAA50308.1|  anther specific protein                                197   4e-59   Brassica napus [oilseed rape]
ref|XP_010540240.1|  PREDICTED: chalcone synthase                       201   1e-58   
ref|XP_011017423.1|  PREDICTED: chalcone synthase-like                  203   1e-58   Populus euphratica
ref|XP_002302511.1|  chalcone and stilbene synthase family protein      201   1e-58   
ref|XP_006347928.1|  PREDICTED: octaketide synthase 3-like              201   1e-58   Solanum tuberosum [potatoes]
ref|XP_006445367.1|  hypothetical protein CICLE_v10020530mg             201   1e-58   Citrus clementina [clementine]
ref|XP_004229766.1|  PREDICTED: chalcone synthase 6-4                   201   3e-58   
gb|KJB24855.1|  hypothetical protein B456_004G165000                    199   7e-58   Gossypium raimondii
gb|KDP28845.1|  hypothetical protein JCGZ_14616                         199   7e-58   Jatropha curcas
ref|XP_006375238.1|  chalcone and stilbene synthase family protein      199   8e-58   
ref|XP_009141701.1|  PREDICTED: chalcone synthase                       199   1e-57   Brassica rapa
emb|CDX93339.1|  BnaC04g45570D                                          198   2e-57   
ref|XP_010456330.1|  PREDICTED: chalcone synthase-like isoform X2       198   2e-57   
gb|KHF97528.1|  Chalcone synthase 9                                     198   3e-57   Gossypium arboreum [tree cotton]
ref|XP_010456329.1|  PREDICTED: chalcone synthase-like isoform X1       198   3e-57   Camelina sativa [gold-of-pleasure]
gb|AEE69028.1|  polyketide synthase                                     198   3e-57   Hypericum perforatum
ref|XP_002511627.1|  pentatricopeptide repeat-containing protein,...    206   5e-57   
ref|XP_010474836.1|  PREDICTED: chalcone synthase isoform X2            197   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010474834.1|  PREDICTED: chalcone synthase isoform X1            197   8e-57   Camelina sativa [gold-of-pleasure]
gb|ABP98922.1|  polyketide synthase                                     196   1e-56   Hypericum perforatum
gb|ADF43044.1|  chalcone synthase 3 protein                             196   1e-56   Brassica rapa subsp. rapa
emb|CDY18415.1|  BnaA04g21720D                                          196   1e-56   Brassica napus [oilseed rape]
ref|XP_010934708.1|  PREDICTED: chalcone synthase-like                  194   1e-56   
ref|XP_006418482.1|  hypothetical protein EUTSA_v10007831mg             196   2e-56   Eutrema salsugineum [saltwater cress]
gb|AFN26935.1|  polyketide synthase                                     196   2e-56   Hypericum perforatum
emb|CDP09465.1|  unnamed protein product                                195   2e-56   Coffea canephora [robusta coffee]
ref|XP_006290098.1|  hypothetical protein CARUB_v10003743mg             194   5e-56   Capsella rubella
ref|XP_003607498.1|  Chalcone synthase                                  194   6e-56   Medicago truncatula
ref|XP_010053966.1|  PREDICTED: chalcone synthase-like                  194   9e-56   Eucalyptus grandis [rose gum]
gb|AAM63363.1|  putative chalcone synthase                              192   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191915.1|  Chalcone and stilbene synthase family protein         192   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140778.1|  hypothetical protein PHAVU_008G141200g             192   4e-55   Phaseolus vulgaris [French bean]
ref|XP_012083857.1|  PREDICTED: pentatricopeptide repeat-containi...    200   8e-55   
gb|AGR67381.1|  chalcone synthase-like protein                          185   1e-54   Citrus reshni [Cleopatra mandarin]
gb|EYU31920.1|  hypothetical protein MIMGU_mgv1a007619mg                191   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_004492184.1|  PREDICTED: chalcone synthase-like                  191   2e-54   Cicer arietinum [garbanzo]
ref|XP_002875049.1|  hypothetical protein ARALYDRAFT_490563             190   2e-54   
gb|AAB23817.1|  chalcone synthase homolog {C-terminal}                  186   2e-54   Brassica napus [oilseed rape]
ref|XP_011042452.1|  PREDICTED: pentatricopeptide repeat-containi...    199   3e-54   Populus euphratica
ref|XP_010107936.1|  Chalcone synthase A                                190   3e-54   Morus notabilis
gb|EPS63204.1|  hypothetical protein M569_11580                         189   5e-54   Genlisea aurea
ref|XP_006396201.1|  hypothetical protein EUTSA_v10028565mg             189   5e-54   Eutrema salsugineum [saltwater cress]
emb|CDX83215.1|  BnaA03g22910D                                          189   5e-54   
ref|XP_010501268.1|  PREDICTED: pentatricopeptide repeat-containi...    197   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_011470532.1|  PREDICTED: pentatricopeptide repeat-containi...    197   8e-54   Fragaria vesca subsp. vesca
ref|XP_010258840.1|  PREDICTED: chalcone synthase-like                  189   9e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006396202.1|  hypothetical protein EUTSA_v10028565mg             188   1e-53   
ref|XP_003516799.1|  PREDICTED: chalcone synthase-like                  188   2e-53   Glycine max [soybeans]
ref|XP_010466554.1|  PREDICTED: chalcone synthase-like                  184   2e-53   
ref|XP_008444217.1|  PREDICTED: chalcone synthase                       187   4e-53   Cucumis melo [Oriental melon]
ref|XP_004142644.1|  PREDICTED: chalcone synthase                       186   7e-53   Cucumis sativus [cucumbers]
gb|ADF43043.1|  chalcone synthase 2 protein                             186   1e-52   Brassica rapa subsp. rapa
ref|XP_009133969.1|  PREDICTED: chalcone synthase                       186   1e-52   Brassica rapa
emb|CDY21499.1|  BnaC03g26980D                                          186   1e-52   Brassica napus [oilseed rape]
ref|XP_006396200.1|  hypothetical protein EUTSA_v10028565mg             188   3e-52   
ref|XP_008775196.1|  PREDICTED: chalcone synthase-like                  182   1e-51   Phoenix dactylifera
gb|AAY96728.1|  chalcone synthase family protein                        182   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96721.1|  chalcone synthase family protein                        182   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96741.1|  chalcone synthase family protein                        182   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96720.1|  chalcone synthase family protein                        182   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96723.1|  chalcone synthase family protein                        182   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171707.1|  polyketide synthase A                                 181   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889339.1|  chalcone synthase family protein                   181   1e-50   
gb|AAY96748.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96729.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96717.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81868.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis halleri subsp. gemmifera
ref|XP_008232397.1|  PREDICTED: pentatricopeptide repeat-containi...    187   2e-50   
gb|AAY96719.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAY96725.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006837297.1|  PREDICTED: chalcone synthase                       179   2e-50   Amborella trichopoda
gb|AAZ81862.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81861.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81872.1|  chalcone synthase family protein                        180   2e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81871.1|  chalcone synthase family protein                        180   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAY96746.1|  chalcone synthase family protein                        180   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81869.1|  chalcone synthase family protein                        180   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81867.1|  chalcone synthase family protein                        180   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81859.1|  chalcone synthase family protein                        180   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81863.1|  chalcone synthase family protein                        179   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81860.1|  chalcone synthase family protein                        179   3e-50   Arabidopsis halleri subsp. gemmifera
gb|AAZ81870.1|  chalcone synthase family protein                        179   4e-50   Arabidopsis halleri subsp. gemmifera
ref|NP_001150611.1|  chalcone synthase G                                179   5e-50   Zea mays [maize]
ref|XP_008678397.1|  PREDICTED: chalcone synthase G isoform X1          179   7e-50   Zea mays [maize]
gb|AAY96745.1|  chalcone synthase family protein                        178   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219350.1|  hypothetical protein PRUPE_ppa019432mg             177   1e-49   
ref|NP_001064891.1|  Os10g0484800                                       177   1e-49   
gb|AAZ81873.1|  chalcone synthase family protein                        177   4e-49   Arabidopsis halleri subsp. gemmifera
ref|XP_006285956.1|  hypothetical protein CARUB_v10007475mg             176   5e-49   Capsella rubella
gb|EAY78973.1|  hypothetical protein OsI_34081                          176   7e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_006661875.1|  PREDICTED: stilbene synthase 4-like                176   8e-49   Oryza brachyantha
ref|XP_004982809.1|  PREDICTED: stilbene synthase 4-like                175   1e-48   
gb|AAZ23686.1|  chalcone synthase family protein                        175   2e-48   Arabidopsis halleri subsp. gemmifera
ref|XP_002869122.1|  chalcone synthase family protein                   175   2e-48   
gb|ERN16348.1|  hypothetical protein AMTR_s00182p00053650               173   2e-48   Amborella trichopoda
ref|XP_010437562.1|  PREDICTED: chalcone synthase-like                  175   2e-48   
emb|CDX69091.1|  BnaC01g03620D                                          174   2e-48   
ref|NP_001131211.1|  uncharacterized protein LOC100192519               174   3e-48   Zea mays [maize]
gb|AAZ23702.1|  chalcone synthase family protein                        174   3e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23721.1|  chalcone synthase family protein                        174   3e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23704.1|  chalcone synthase family protein                        174   3e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CAB45446.1|  chalcone synthase-like protein                         174   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23705.1|  chalcone synthase family protein                        174   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567971.1|  protein LESS ADHESIVE POLLEN 5                        174   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23717.1|  chalcone synthase family protein                        174   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57002.1|  Stilbene synthase 4                                     174   4e-48   Triticum urartu
gb|ABK28665.1|  unknown                                                 174   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432375.1|  PREDICTED: chalcone synthase-like                  174   4e-48   
gb|ACB38748.1|  chalcone synthase-like protein                          174   5e-48   Triticum aestivum [Canadian hard winter wheat]
gb|AFW68541.1|  hypothetical protein ZEAMMB73_283153                    174   7e-48   
emb|CDX75466.1|  BnaA01g02360D                                          173   8e-48   
ref|XP_006854881.2|  PREDICTED: chalcone synthase                       173   9e-48   Amborella trichopoda
gb|AAZ23683.1|  chalcone synthase family protein                        173   1e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_002467058.1|  hypothetical protein SORBIDRAFT_01g018950          172   1e-47   
emb|CDY34811.1|  BnaA09g41780D                                          172   1e-47   Brassica napus [oilseed rape]
ref|XP_002529257.1|  Chalcone synthase, putative                        172   2e-47   Ricinus communis
gb|AAZ23699.1|  chalcone synthase family protein                        172   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108194.1|  PREDICTED: chalcone synthase-like                  172   2e-47   Brassica rapa
ref|XP_004505681.1|  PREDICTED: chalcone synthase-like                  172   2e-47   Cicer arietinum [garbanzo]
gb|AAZ23682.1|  chalcone synthase family protein                        172   3e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_010268693.1|  PREDICTED: chalcone synthase                       172   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_007131762.1|  hypothetical protein PHAVU_011G039700g             172   3e-47   Phaseolus vulgaris [French bean]
gb|AAZ23684.1|  chalcone synthase family protein                        172   3e-47   Arabidopsis halleri subsp. gemmifera
gb|AAZ23685.1|  chalcone synthase family protein                        172   3e-47   Arabidopsis halleri subsp. gemmifera
gb|AAZ23692.1|  chalcone synthase family protein                        172   3e-47   Arabidopsis halleri subsp. gemmifera
emb|CDY58814.1|  BnaAnng15370D                                          172   3e-47   Brassica napus [oilseed rape]
ref|XP_011092869.1|  PREDICTED: chalcone synthase                       171   3e-47   Sesamum indicum [beniseed]
ref|XP_007131590.1|  hypothetical protein PHAVU_011G026000g             171   3e-47   Phaseolus vulgaris [French bean]
ref|XP_009138330.1|  PREDICTED: chalcone synthase-like                  171   4e-47   Brassica rapa
emb|CDY40656.1|  BnaA03g53070D                                          171   5e-47   Brassica napus [oilseed rape]
gb|ADF43047.1|  chalcone synthase 6 protein                             171   5e-47   Brassica rapa subsp. rapa
gb|KFK30118.1|  hypothetical protein AALP_AA7G219100                    171   5e-47   Arabis alpina [alpine rockcress]
ref|XP_010933363.1|  PREDICTED: chalcone synthase                       170   5e-47   
ref|XP_006412179.1|  hypothetical protein EUTSA_v10025417mg             171   6e-47   Eutrema salsugineum [saltwater cress]
ref|XP_009799363.1|  PREDICTED: chalcone synthase                       171   6e-47   Nicotiana sylvestris
ref|XP_010447028.1|  PREDICTED: chalcone synthase                       171   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009108697.1|  PREDICTED: chalcone synthase-like                  171   7e-47   Brassica rapa
ref|XP_003574084.1|  PREDICTED: chalcone synthase-like                  171   7e-47   Brachypodium distachyon [annual false brome]
gb|AAZ23693.1|  chalcone synthase family protein                        171   7e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_002305482.1|  hypothetical protein POPTR_0004s17460g             170   1e-46   Populus trichocarpa [western balsam poplar]
gb|AAZ23688.1|  chalcone synthase family protein                        170   1e-46   Arabidopsis halleri subsp. gemmifera
ref|XP_009350954.1|  PREDICTED: chalcone synthase                       170   1e-46   Pyrus x bretschneideri [bai li]
emb|CDX72506.1|  BnaC07g45280D                                          169   2e-46   
ref|XP_008780014.1|  PREDICTED: chalcone synthase                       169   2e-46   
gb|KHN32314.1|  Chalcone synthase                                       168   2e-46   Glycine soja [wild soybean]
emb|CAA62921.1|  chalcone synthase-like                                 169   3e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDO96957.1|  unnamed protein product                                169   3e-46   Coffea canephora [robusta coffee]
ref|XP_011046865.1|  PREDICTED: chalcone synthase-like                  169   3e-46   Populus euphratica
ref|XP_006423581.1|  hypothetical protein CICLE_v10028633mg             169   4e-46   Citrus clementina [clementine]
ref|XP_003537759.1|  PREDICTED: chalcone synthase-like                  168   4e-46   Glycine max [soybeans]
ref|XP_006487398.1|  PREDICTED: chalcone synthase 6-like                168   4e-46   Citrus sinensis [apfelsine]
emb|CDY17490.1|  BnaC03g65730D                                          169   5e-46   Brassica napus [oilseed rape]
ref|XP_007041944.1|  Chalcone and stilbene synthase family protein      168   5e-46   Theobroma cacao [chocolate]
ref|XP_008344150.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    175   6e-46   
gb|KEH30597.1|  chalcone synthase family protein                        168   7e-46   Medicago truncatula
ref|XP_010088676.1|  Chalcone synthase 9                                168   8e-46   Morus notabilis
ref|XP_008372871.1|  PREDICTED: chalcone synthase                       167   1e-45   Malus domestica [apple tree]
ref|XP_006379273.1|  chalcone and stilbene synthase family protein      167   1e-45   
gb|KHN05473.1|  Chalcone synthase D                                     166   2e-45   Glycine soja [wild soybean]
ref|XP_004289833.1|  PREDICTED: chalcone synthase                       167   2e-45   Fragaria vesca subsp. vesca
ref|XP_007199914.1|  hypothetical protein PRUPE_ppa006852mg             166   3e-45   Prunus persica
ref|XP_004230925.1|  PREDICTED: chalcone synthase                       166   4e-45   Solanum lycopersicum
gb|KJB47606.1|  hypothetical protein B456_008G033300                    166   7e-45   Gossypium raimondii
ref|XP_003557301.2|  PREDICTED: probable inorganic phosphate tran...    171   1e-44   
ref|XP_012084392.1|  PREDICTED: chalcone synthase                       165   1e-44   Jatropha curcas
ref|XP_002276653.1|  PREDICTED: chalcone synthase                       164   2e-44   Vitis vinifera
ref|XP_006359643.1|  PREDICTED: chalcone synthase 2-like                164   2e-44   Solanum tuberosum [potatoes]
ref|XP_009621338.1|  PREDICTED: chalcone synthase                       164   3e-44   Nicotiana tomentosiformis
ref|XP_008236187.1|  PREDICTED: chalcone synthase                       163   5e-44   Prunus mume [ume]
gb|KGN63621.1|  hypothetical protein Csa_1G006310                       163   6e-44   Cucumis sativus [cucumbers]
ref|XP_004138289.2|  PREDICTED: chalcone synthase                       163   6e-44   Cucumis sativus [cucumbers]
gb|AAB80804.1|  chalcone synthase homolog PrChS1                        162   8e-44   Pinus radiata
ref|XP_008453147.1|  PREDICTED: chalcone synthase                       162   1e-43   Cucumis melo [Oriental melon]
ref|XP_010028685.1|  PREDICTED: chalcone synthase                       162   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010530789.1|  PREDICTED: chalcone synthase                       162   1e-43   
ref|NP_001059449.2|  Os07g0411300                                       161   3e-43   
gb|EEC81903.1|  hypothetical protein OsI_25733                          161   3e-43   Oryza sativa Indica Group [Indian rice]
gb|EAZ39507.1|  hypothetical protein OsJ_23944                          161   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010690460.1|  PREDICTED: chalcone synthase                       160   5e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS66734.1|  hypothetical protein M569_08037                         160   8e-43   Genlisea aurea
gb|EYU40405.1|  hypothetical protein MIMGU_mgv1a008045mg                158   3e-42   Erythranthe guttata [common monkey flower]
ref|XP_006664811.1|  PREDICTED: chalcone synthase LF2-like              158   4e-42   Oryza brachyantha
emb|CAJ15412.1|  unnamed protein product                                158   8e-42   Triticum aestivum [Canadian hard winter wheat]
gb|AAV49989.1|  putative chalcone synthase                              156   5e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ13966.1|  unnamed protein product                                155   5e-41   Aegilops tauschii
gb|EMT21347.1|  hypothetical protein F775_52323                         155   7e-41   
ref|XP_002461886.1|  hypothetical protein SORBIDRAFT_02g009850          155   9e-41   Sorghum bicolor [broomcorn]
emb|CAJ13548.1|  unnamed protein product                                154   1e-40   Triticum turgidum [cone wheat]
dbj|BAJ95097.1|  predicted protein                                      154   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001781520.1|  predicted protein                                  154   2e-40   
gb|ACJ22498.1|  chalcone synthase                                       154   3e-40   Triticum aestivum [Canadian hard winter wheat]
gb|ACN35784.1|  unknown                                                 150   1e-39   Zea mays [maize]
ref|XP_004956033.1|  PREDICTED: chalcone synthase 1-like                151   2e-39   Setaria italica
ref|NP_001149508.1|  chalcone synthase                                  150   4e-39   Zea mays [maize]
tpg|DAA60357.1|  TPA: hypothetical protein ZEAMMB73_750242              150   4e-39   
tpg|DAA60355.1|  TPA: chalcone synthase                                 150   5e-39   
ref|XP_009401221.1|  PREDICTED: chalcone synthase                       149   8e-39   
dbj|BAE80096.1|  Chalcone synthase                                      148   2e-38   Silene latifolia
ref|XP_010497459.1|  PREDICTED: chalcone synthase RJ5-like              136   1e-36   
ref|XP_002985571.1|  hypothetical protein SELMODRAFT_122361             137   2e-34   
emb|CBI37938.3|  unnamed protein product                                134   4e-34   Vitis vinifera
gb|ADG38688.1|  AT4G00040-like protein                                  128   2e-32   Neslia paniculata [ball mustard]
gb|AEN82337.1|  AT4G00040-like protein                                  126   1e-31   Capsella rubella
gb|ADG38683.1|  AT4G00040-like protein                                  125   1e-31   Capsella grandiflora
gb|ADG38685.1|  AT4G00040-like protein                                  125   3e-31   Capsella grandiflora
dbj|BAG32254.1|  chalcone synthase                                    94.0    6e-25   Raphanus sativus
gb|ACF94728.1|  chalcone synthase 6                                     107   6e-25   Robinia pseudoacacia [black locust]
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                108   4e-24   Cicer arietinum [garbanzo]
ref|XP_003601648.1|  Chalcone synthase                                  107   8e-24   Medicago truncatula
gb|AIS35912.1|  chalcone synthase                                       107   8e-24   Phalaenopsis equestris
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    107   9e-24   Freesia hybrid cultivar
ref|WP_039311134.1|  hypothetical protein                               103   1e-23   
dbj|BAA87922.1|  chalcone synthase                                      107   1e-23   Psilotum nudum
gb|AIB06737.1|  chalcone synthases-1                                    107   2e-23   Mangifera indica
gb|AHA61354.1|  chalcone synthase                                       106   2e-23   Phyllanthus emblica [amla]
gb|ADF43046.1|  chalcone synthase 5 protein                             105   2e-23   Brassica rapa subsp. rapa
gb|AAY83389.1|  chalcone synthase                                       106   2e-23   Phalaenopsis hybrid cultivar
sp|P48392.1|CHS3_GERHY  RecName: Full=Chalcone synthase 3; AltNam...    106   3e-23   Gerbera hybrid cultivar
gb|AID16080.1|  chalcone synthase                                       105   3e-23   Morus alba
gb|AEF14414.1|  chalcone synthase                                       105   4e-23   Onobrychis viciifolia
gb|ABS82270.1|  resveratrol-forming stilbene synthase                   105   5e-23   Polygonum cuspidatum
gb|ADY02639.1|  chalcone synthase                                       105   5e-23   Parrya nudicaulis
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          105   6e-23   Rubus idaeus [European raspberry]
gb|AFC37244.1|  chalcone synthase 3                                     105   6e-23   Camellia chekiangoleosa
gb|ACC76753.1|  STS                                                     105   6e-23   Polygonum cuspidatum
gb|ACF94727.1|  chalcone synthase                                       103   6e-23   Robinia pseudoacacia [black locust]
ref|XP_007161427.1|  hypothetical protein PHAVU_001G067800g             105   6e-23   Phaseolus vulgaris [French bean]
dbj|BAJ17656.1|  chalcone synthase                                      105   6e-23   Gynura bicolor
sp|P30078.1|CHSY_MALDO  RecName: Full=Chalcone synthase; AltName:...    103   7e-23   Malus domestica [apple tree]
ref|XP_010692195.1|  PREDICTED: chalcone synthase-like                  105   7e-23   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD20740.1|  chalcone synthase                                      105   7e-23   Matthiola incana
sp|P17818.1|CHSY_MATIN  RecName: Full=Chalcone synthase; AltName:...    105   7e-23   Matthiola incana
gb|AAF78070.2|  chalcone synthase                                       103   7e-23   Allium cepa
gb|ADZ45298.1|  chalcone synthase 1                                     105   7e-23   Glycyrrhiza uralensis [Chinese licorice]
gb|ADZ45294.1|  chalcone synthase 3                                     105   7e-23   Glycyrrhiza uralensis [Chinese licorice]
gb|AAT84969.1|  stilbene synthase                                       101   7e-23   Vitis vinifera
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               105   7e-23   Cicer arietinum [garbanzo]
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   105   8e-23   Pyrus x bretschneideri [bai li]
gb|ADZ45296.1|  chalcone synthase 2                                     105   8e-23   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         105   8e-23   Populus trichocarpa [western balsam poplar]
gb|AGA35552.1|  type III polyketide synthases                           104   9e-23   Fallopia multiflora [Chinese knotweed]
sp|P13417.1|CHS3_SINAL  RecName: Full=Chalcone synthase 3; AltNam...    104   9e-23   Sinapis alba [bai jie]
gb|AAT84781.1|  stilbene synthase                                       100   9e-23   Vitis vinifera
gb|KFK37661.1|  hypothetical protein AALP_AA3G012000                    104   9e-23   Arabis alpina [alpine rockcress]
prf||1609233A  chalcone synthase 3                                      104   9e-23
ref|XP_009125955.1|  PREDICTED: chalcone synthase 3-like                104   1e-22   Brassica rapa
gb|AHC28523.1|  chalcone synthase 1                                     104   1e-22   Rheum australe [Himalayan rhubarb]
gb|AAC31913.1|  chalcone synthase B1                                    104   1e-22   Brassica napus [oilseed rape]
gb|AAT84839.1|  stilbene synthase                                       100   1e-22   Vitis vinifera
gb|AAT84883.1|  stilbene synthase                                       100   1e-22   Vitis vinifera
gb|AGW24283.1|  chalcone synthase                                       104   1e-22   Melastoma malabathricum
gb|AGC72957.1|  chalcone synthase                                       104   1e-22   Arabis verna
gb|AAT84770.1|  stilbene synthase                                       100   1e-22   Vitis vinifera
gb|ACF94722.1|  chalcone synthase                                       103   1e-22   Robinia pseudoacacia [black locust]
sp|P19168.1|CHS3_SOYBN  RecName: Full=Chalcone synthase 3; AltNam...    104   1e-22   Glycine max [soybeans]
gb|AAT84810.1|  stilbene synthase                                       100   1e-22   Vitis vinifera
gb|KJB28223.1|  hypothetical protein B456_005G035100                    103   1e-22   Gossypium raimondii
sp|Q9ZS40.1|CHS2_DAUCA  RecName: Full=Chalcone synthase 2; AltNam...    104   1e-22   Daucus carota [carrots]
ref|XP_003524935.1|  PREDICTED: chalcone synthase                       104   1e-22   
ref|XP_003531223.1|  PREDICTED: chalcone synthase 1                     103   2e-22   Glycine max [soybeans]
ref|XP_003531219.1|  PREDICTED: chalcone synthase 5-like                103   2e-22   
sp|P16107.1|CHSY_PETCR  RecName: Full=Chalcone synthase; AltName:...    104   2e-22   Petroselinum crispum
gb|KHN12336.1|  Chalcone synthase 1                                     103   2e-22   Glycine soja [wild soybean]
gb|AAQ62588.1|  chalcone synthase CHS4                                  103   2e-22   Glycine max [soybeans]
gb|AAF23584.1|AF112109_1  chalcone synthase                             103   2e-22   Aubrieta deltoidea
ref|XP_003531225.1|  PREDICTED: chalcone synthase 1 isoform X1          103   2e-22   
gb|AAG43406.1|  chalcone synthase                                       103   2e-22   
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    103   2e-22   
ref|XP_006585154.1|  PREDICTED: chalcone synthase 3-like isoform X2     103   2e-22   
emb|CAA32496.1|  chalcone synthase                                      103   2e-22   
dbj|BAF03068.1|  chalcone synthase                                      100   2e-22   
gb|AAG43355.1|AF144537_1  chalcone synthase                             103   2e-22   
ref|NP_001275296.1|  chalcone synthase 2                                103   2e-22   
gb|AEW12813.1|  chalcone synthase                                       103   2e-22   
ref|NP_001276296.1|  chalcone synthase                                  103   2e-22   
gb|ACM41825.1|  chalcone synthase                                       103   2e-22   
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      103   2e-22   
sp|P22925.2|CHSD_PETHY  RecName: Full=Chalcone synthase D; AltNam...    104   2e-22   
gb|AAT84837.1|  stilbene synthase                                       100   2e-22   
gb|ABB30178.1|  chalcone synthase 1                                     103   2e-22   
ref|XP_006399896.1|  hypothetical protein EUTSA_v10013745mg             103   2e-22   
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    103   2e-22   
gb|ADG02377.1|  chalcone synthase                                       103   2e-22   
gb|ACF94726.1|  chalcone synthase                                       102   2e-22   
gb|ABN79673.1|  chalcone synthase                                       103   2e-22   
gb|ACF94721.1|  chalcone synthase                                       103   2e-22   
gb|AIM48929.1|  chalcone synthase                                       103   2e-22   
gb|ABB89213.1|  chalcone synthase                                       103   2e-22   
gb|AGZ15299.1|  chalcone synthase                                       103   2e-22   
gb|AHL69646.1|  chalcone synthase 1                                     103   2e-22   
gb|ABM63466.1|  aromatic polyketide synthase                            103   2e-22   
sp|C6KI62.1|CHSL1_CANSA  RecName: Full=Chalcone synthase-like pro...    103   2e-22   
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    103   2e-22   
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   103   2e-22   
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  103   2e-22   
gb|AAG43359.1|AF144541_1  chalcone synthase                             103   2e-22   
gb|AGL50915.1|  chalcone synthase                                       103   2e-22   
gb|AAC31911.1|  chalcone synthase A1                                    103   2e-22   
gb|AGC72958.1|  chalcone synthase                                       103   2e-22   
gb|ADY02641.1|  chalcone synthase                                       103   2e-22   
gb|AFH68066.1|  chalcone synthase                                       103   2e-22   
gb|ADH03587.1|  chalcone synthase                                       103   2e-22   
dbj|BAB92996.1|  chalcone synthase                                      103   3e-22   
gb|AFQ92052.1|  chalcone synthase                                       103   3e-22   
gb|ACM41826.1|  benzalacetone synthase                                  102   3e-22   
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   103   3e-22   
gb|AFP97667.1|  stilbene synthase                                       103   3e-22   
gb|ABQ95964.1|  chalcone synthase                                       103   3e-22   
gb|ABQ95960.1|  chalcone synthase                                       103   3e-22   
gb|ABQ95962.1|  chalcone synthase                                       103   3e-22   
gb|ABQ95961.1|  chalcone synthase                                       103   3e-22   
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     103   3e-22   
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  103   3e-22   
gb|AAT84776.1|  stilbene synthase                                     99.8    3e-22   
gb|ABO21005.1|  chalcone synthase                                       103   3e-22   
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         103   3e-22   
sp|P48385.2|CHSY_CALCH  RecName: Full=Chalcone synthase; AltName:...    103   3e-22   
emb|CDX78547.1|  BnaA03g04590D                                          103   3e-22   
gb|ABQ95967.1|  chalcone synthase                                       103   3e-22   
gb|ABG76200.1|  chalcone synthase                                       103   3e-22   
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  103   3e-22   
ref|XP_003601647.1|  Chalcone synthase                                  103   3e-22   
emb|CDX69618.1|  BnaA10g19670D                                          103   3e-22   
ref|XP_009131369.1|  PREDICTED: chalcone synthase 3-like                103   3e-22   
gb|AAT84943.1|  stilbene synthase                                     99.8    3e-22   
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    103   3e-22   
gb|AIA22214.1|  chalcone synthase                                       103   3e-22   
gb|ADV29810.1|  chalcone synthase                                       103   3e-22   
ref|XP_009121714.1|  PREDICTED: chalcone synthase 1                     103   3e-22   
gb|AAP74755.1|  chalcone synthase                                       102   3e-22   
gb|ADF43042.1|  chalcone synthase 1 protein                             103   3e-22   
gb|AGI02994.1|  chalcone synthase                                       103   3e-22   
ref|XP_010916793.1|  PREDICTED: chalcone synthase RJ5-like              100   3e-22   
gb|AAT84804.1|  stilbene synthase                                     99.8    3e-22   
gb|ADK45325.1|  PKS                                                     103   3e-22   
gb|AHL83549.1|  chalcone synthase                                       103   3e-22   
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           103   3e-22   
dbj|BAC66467.1|  chalcone synthase                                      103   3e-22   
gb|AAW30010.1|  stilbenecarboxylate synthase 2                          103   3e-22   
gb|AAT84834.1|  stilbene synthase                                     99.4    3e-22   
gb|AFU52909.1|  chalcone synthase                                       103   3e-22   
gb|KHN07720.1|  Chalcone synthase 6                                     102   4e-22   
pdb|2P0U|A  Chain A, Crystal Structure Of Marchantia Polymorpha S...    103   4e-22   
gb|AAT84917.1|  stilbene synthase                                     99.4    4e-22   
gb|AAT84908.1|  stilbene synthase                                     99.4    4e-22   
ref|XP_003610855.1|  Chalcone synthase                                  103   4e-22   
gb|KJB28222.1|  hypothetical protein B456_005G035100                    103   4e-22   
gb|KHG25969.1|  Chalcone synthase 1                                     103   4e-22   
dbj|BAE17123.1|  chalcone synthase                                      103   4e-22   
gb|AEC13058.1|  chalcone synthase protein                               103   4e-22   
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    103   4e-22   
gb|AFC37242.1|  chalcone synthase 1                                     103   4e-22   
gb|AFC87828.1|  chalcone synthase                                       103   4e-22   
gb|AHY39238.1|  stilbenecarboxylate synthase 2                          103   4e-22   
gb|AAT84835.1|  stilbene synthase                                     99.4    4e-22   
gb|AIV42295.1|  chalcone synthase                                       103   4e-22   
gb|AAT84755.1|  stilbene synthase                                     99.4    4e-22   
gb|ACM62742.1|  chalcone synthase                                       103   4e-22   
gb|AEO96985.1|  chalcone synthase                                       102   4e-22   
gb|AHZ31750.1|  chalcone synthase                                       103   4e-22   
pdb|3A5S|A  Chain A, Benzalacetone Synthase (I207lL208F)                102   4e-22   
dbj|BAI66465.1|  chalcone synthase                                      102   4e-22   
gb|AAO13091.1|  chalcone synthase                                       102   4e-22   
pdb|3A5Q|A  Chain A, Benzalacetone Synthase From Rheum Palmatum         102   4e-22   
sp|Q94FV7.1|BAS_RHEPA  RecName: Full=Polyketide synthase BAS; Alt...    102   4e-22   
gb|AGV53049.1|  chalcone synthase                                       102   4e-22   
gb|AFN21537.1|  stilbene synthase                                       102   4e-22   
gb|AFD64563.1|  chalcone synthase                                       102   4e-22   
emb|CDY09836.1|  BnaC09g43250D                                          102   4e-22   
dbj|BAB84112.1|  chalcone synthase                                      102   4e-22   
gb|ACC76754.1|  CHS2                                                    102   4e-22   
gb|AIY22756.1|  chalcone synthase                                       102   4e-22   
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           102   4e-22   
sp|B0LDU6.1|PKS5_RUBID  RecName: Full=Polyketide synthase 5; Shor...    102   4e-22   
gb|AAT84759.1|  stilbene synthase                                     99.4    4e-22   
gb|ACZ51476.1|  chalcone synthase                                       102   4e-22   
ref|XP_003518828.1|  PREDICTED: chalcone synthase 6-like                102   4e-22   
gb|AAG43352.1|AF144534_1  chalcone synthase                             102   4e-22   
gb|ACZ48699.1|  chalcone synthase                                       102   5e-22   
gb|AAG43354.1|AF144536_1  chalcone synthase                             102   5e-22   
gb|AAO63021.1|  chalcone synthase B                                     102   5e-22   
dbj|BAJ14519.1|  chalcone synthase 2                                    102   5e-22   
gb|ABQ28695.1|  chalcone synthase                                       102   5e-22   
gb|ACS36661.1|  CHS4                                                    102   5e-22   
dbj|BAO58435.1|  chalcone synthase                                      102   5e-22   
gb|AAT84771.1|  stilbene synthase                                     99.0    5e-22   
dbj|BAA31259.1|  chalcone synthase                                      102   5e-22   
gb|AIC75908.1|  chalcone synthase                                       102   5e-22   
gb|ABF59868.1|  chalcone synthase                                       102   5e-22   
gb|ACZ51475.1|  chalcone synthase                                       102   5e-22   
gb|AAT84989.1|  stilbene synthase                                     99.0    5e-22   
gb|ADU05554.1|  chalcone synthase                                       102   5e-22   
dbj|BAF98441.1|  chalcone synthase                                      100   5e-22   
gb|AAT84787.1|  stilbene synthase                                     99.0    5e-22   
gb|AAT84801.1|  stilbene synthase                                     99.0    5e-22   
gb|AAT84867.1|  stilbene synthase                                     99.0    5e-22   
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       102   5e-22   
gb|AAT84984.1|  stilbene synthase                                     99.0    5e-22   
gb|AAF23557.1|AF112082_1  chalcone synthase                             102   5e-22   
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   102   5e-22   
gb|AAT84866.1|  stilbene synthase                                     99.0    5e-22   
dbj|BAJ21532.1|  chalcone synthase type 2                               102   5e-22   
gb|ABB70116.1|  chalcone synthase                                       100   5e-22   
gb|ACQ84148.2|  chalcone synthase                                       102   5e-22   
gb|AAY16976.1|  chalcone synthase                                       102   5e-22   
gb|AAP37051.1|  chalcone synthase                                       102   5e-22   
gb|AAT84805.1|  stilbene synthase                                     99.0    6e-22   
ref|XP_003533807.1|  PREDICTED: chalcone synthase 6                     102   6e-22   
gb|AAT84859.1|  stilbene synthase                                     99.0    6e-22   
gb|AEO96989.1|  chalcone synthase                                       102   6e-22   
ref|XP_003516867.1|  PREDICTED: chalcone synthase 6-like                102   6e-22   
gb|ABB13608.1|  chalcone synthase 2                                     102   6e-22   
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    102   6e-22   
dbj|BAM17286.1|  chalcone synthase                                      102   6e-22   
gb|ADB44077.1|  chalcone synthase                                       102   6e-22   
gb|AAT84911.1|  stilbene synthase                                     99.0    6e-22   
gb|AAT84885.1|  stilbene synthase                                     99.0    6e-22   
emb|CAL15003.1|  chalcone synthase                                      102   6e-22   
gb|AAT84880.1|  stilbene synthase                                     99.0    6e-22   
gb|ADT63062.1|  chalcone synthase                                       102   6e-22   
gb|AAO63020.1|  putative chalcone synthase A                            102   6e-22   
gb|ABF69124.1|  chalcone synthase                                       102   6e-22   
gb|AAC31912.1|  chalcone synthase A2                                    102   6e-22   
sp|O22652.1|CHSY_RAPSA  RecName: Full=Chalcone synthase; AltName:...    102   6e-22   
sp|P13416.1|CHS1_SINAL  RecName: Full=Chalcone synthase 1; AltNam...    102   7e-22   
gb|KFK25629.1|  hypothetical protein AALP_AA8G139500                    102   7e-22   
gb|AGU91424.1|  chalcone synthase                                       102   7e-22   
gb|AAC31914.1|  chalcone synthase B2                                    102   7e-22   
emb|CAA32731.1|  chalcone synthase                                      102   7e-22   
dbj|BAK08888.1|  chalcone synthase 2                                    102   7e-22   
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      102   7e-22   
emb|CDX91090.1|  BnaC02g05070D                                          102   7e-22   
gb|AAB36038.1|  chalcone synthase                                       102   7e-22   
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                102   7e-22   
gb|AAG43348.1|AF144530_1  chalcone synthase                             102   7e-22   
gb|AAT84905.1|  stilbene synthase                                     98.6    7e-22   
gb|AAT84946.1|  stilbene synthase                                     98.6    7e-22   
gb|KHN07531.1|  Chalcone synthase 6                                     101   7e-22   
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    102   7e-22   
gb|AAL67805.1|AF461105_1  chalcone synthase                             102   7e-22   
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     102   7e-22   
gb|AEB00658.1|  chalcone synthase                                       101   7e-22   
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    102   7e-22   
gb|AAG43353.1|AF144535_1  chalcone synthase                             102   8e-22   
gb|AFK33946.1|  unknown                                                 102   8e-22   
gb|AAT84796.1|  stilbene synthase                                     98.6    8e-22   
gb|AAU93767.1|  chalcone synthase                                       102   8e-22   
gb|AAF23559.1|AF112084_1  chalcone synthase                             102   8e-22   
gb|AKA43763.1|  CHS1                                                    102   8e-22   
gb|AAT84826.1|  stilbene synthase                                     98.6    8e-22   
gb|AAT84982.1|  stilbene synthase                                     98.6    8e-22   
gb|AGC72947.1|  chalcone synthase                                       102   8e-22   
gb|AFE56210.1|  chalcone synthase                                       102   8e-22   
sp|Q9SEP4.1|CHSY_ARAAL  RecName: Full=Chalcone synthase; AltName:...    102   8e-22   
gb|AFL72079.1|  chalcone synthase                                       102   8e-22   
gb|AAT84762.1|  stilbene synthase                                     98.6    8e-22   
gb|ABE03664.1|  chalcone synthase                                       102   8e-22   
gb|AAT84836.1|  stilbene synthase                                     98.6    8e-22   
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    102   8e-22   
sp|Q9AU09.1|PKS3_RUBID  RecName: Full=Polyketide synthase 3; Shor...    102   8e-22   
ref|NP_001267879.1|  chalcone synthase                                  102   8e-22   
emb|CAR64527.1|  chalcone synthase                                      102   8e-22   
gb|AAT84785.1|  stilbene synthase                                     98.6    8e-22   
gb|AAK49457.1|  chalcone synthase                                       102   8e-22   
gb|AAT84840.1|  stilbene synthase                                     98.6    8e-22   
gb|AAT84775.1|  stilbene synthase                                     98.6    8e-22   
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    102   8e-22   
gb|AGC72946.1|  chalcone synthase                                       102   9e-22   
gb|AGI02993.1|  chalcone synthase                                       102   9e-22   
gb|AAT75302.1|  chalcone synthase                                       102   9e-22   
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    102   9e-22   
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    102   9e-22   
gb|AAT84878.1|  stilbene synthase                                     98.6    9e-22   
gb|AAT84944.1|  stilbene synthase                                     98.6    9e-22   
gb|AJO53275.1|  chalcone synthase                                       102   9e-22   
gb|AAT84886.1|  stilbene synthase                                     98.2    9e-22   
gb|AIY62394.1|  chalcone synthase                                       101   9e-22   
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     102   9e-22   
gb|AAT84760.1|  stilbene synthase                                     98.2    9e-22   
gb|AAT84928.1|  stilbene synthase                                     98.2    9e-22   
gb|AAT84852.1|  stilbene synthase                                     98.2    9e-22   
sp|P51079.1|CHS6_MEDSA  RecName: Full=Chalcone synthase 6-4; AltN...    101   9e-22   
gb|AIB06736.1|  chalcone synthases-1                                    102   9e-22   
dbj|BAE53636.1|  chalcone synthase                                      102   9e-22   
gb|ACN30003.1|  chalcone synthase                                       102   9e-22   
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    102   9e-22   
gb|AAT84922.1|  stilbene synthase                                     98.2    9e-22   



>ref|XP_009618741.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=395

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR++EEGINFKLGRDLPEKI++NIE+FCKKL+ KA+       YN+
Sbjct  252  ATQQFLPGTNNVIDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKLMAKADLKETK--YND  309

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L+SEKLDCSRRALMDFGNVSSNTIFYV+EYMR+EL  K+
Sbjct  310  LFWAVHPGGPAILNRLENTLKLQSEKLDCSRRALMDFGNVSSNTIFYVMEYMREELKNKK  369

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGLALAFGPGITFEGILLR+L
Sbjct  370  DEGE--------EWGLALAFGPGITFEGILLRSL  395



>emb|CAA74847.1| anther-specific protein [Nicotiana sylvestris]
 emb|CAA74846.1| anther-specific protein [Nicotiana sylvestris]
Length=363

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR++EEGINFKLGRDLPEKI++NIE+FCKK+I KA+       YN+
Sbjct  220  ATQQFLPGTNNVIDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKIIAKADLREAK--YND  277

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L+SEKLDCSRRALMD+GNVSSNTIFYV+EYMR+EL  K+
Sbjct  278  LFWAVHPGGPAILNRLENTLKLQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKK  337

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  338  NGGE--------EWGLALAFGPGITFEGILLRSL  363



>ref|XP_009785374.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=395

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR++EEGINFKLGRDLPEKI++NIE+FCKK+I KA+       YN+
Sbjct  252  ATQQFLPGTNNVIDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKIIAKADLREAK--YND  309

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L+SEKLDCSRRALMD+GNVSSNTIFYV+EYMR+EL  K+
Sbjct  310  LFWAVHPGGPAILNRLENTLKLQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKK  369

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  370  NGGE--------EWGLALAFGPGITFEGILLRSL  395



>gb|ACY74337.1| putative chalcone synthase [Artemisia annua]
Length=378

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 12/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KI++NIE FCKKL+ KA    +   +N+
Sbjct  236  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIDDNIEAFCKKLMEKAGKLED---FND  292

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L+ EKLDCSRRAL DFGNVSSNTI YV+EYMRDELM K 
Sbjct  293  LFWAVHPGGPAILNRLEATLKLKGEKLDCSRRALTDFGNVSSNTIIYVMEYMRDELMNKE  352

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +         WGLALAFGPGITFEGILLR+L
Sbjct  353  KSEE---------WGLALAFGPGITFEGILLRSL  377



>gb|AGO05924.1| anther-specific protein [Capsicum annuum]
Length=396

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT++VIDGR++EEGINFKLGRDLPEKI++NIE+FCKKLI K +       YN+
Sbjct  252  ALQQFLPGTKNVIDGRLTEEGINFKLGRDLPEKIQDNIEEFCKKLIEKGDQLKET-KYND  310

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+RLERTL L+S KLDCSRRALMD+GNVSSNTIFYV+EYMR EL  K+
Sbjct  311  LFWAVHPGGPAILDRLERTLKLQSGKLDCSRRALMDYGNVSSNTIFYVIEYMRQELQNKK  370

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  371  DGGE--------EWGLALAFGPGITFEGILLRSL  396



>emb|CAN83038.1| hypothetical protein VITISV_034337 [Vitis vinifera]
Length=359

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+
Sbjct  220  AVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGL----VEFND  275

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KR
Sbjct  276  LFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KR  333

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  334  KGGE--------EWGLALAFGPGITFEGILIRSL  359



>ref|XP_002276642.1| PREDICTED: chalcone synthase isoform X2 [Vitis vinifera]
Length=389

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+
Sbjct  250  AVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGL----VEFND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KR
Sbjct  306  LFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  364  KGGE--------EWGLALAFGPGITFEGILIRSL  389



>ref|XP_010692112.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=389

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 126/154 (82%), Gaps = 12/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDG I+EEGINFKLGRDLP KIE+NIE+FCKKL+ KA        YNE
Sbjct  248  AVQQFLPGTHNVIDGCITEEGINFKLGRDLPNKIEDNIEEFCKKLMSKAGLK----DYNE  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E TL L+ +KL+CSRRALMD+GNVSSNT+FYV+EYMRDEL  K+
Sbjct  304  LFWAVHPGGPAILNRVENTLKLKGDKLNCSRRALMDYGNVSSNTVFYVMEYMRDELKSKQ  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  364  NGGE--------EWGLALAFGPGITFEGILLRSL  389



>ref|XP_010661353.1| PREDICTED: chalcone synthase isoform X1 [Vitis vinifera]
Length=409

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+
Sbjct  270  AVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGL----VEFND  325

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KR
Sbjct  326  LFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KR  383

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  384  KGGE--------EWGLALAFGPGITFEGILIRSL  409



>emb|CBI16627.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+
Sbjct  250  AVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKAGL----VEFND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KR
Sbjct  306  LFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  364  KGGE--------EWGLALAFGPGITFEGILIRSL  389



>ref|XP_011094451.1| PREDICTED: LOW QUALITY PROTEIN: chalcone synthase [Sesamum indicum]
Length=383

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 126/154 (82%), Gaps = 13/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP T +VIDGR+SEEGI FKLGRDLP+KIE NIEDFCKKL+ KA        YNE
Sbjct  243  AVQQFLPETSNVIDGRLSEEGIYFKLGRDLPQKIEENIEDFCKKLMVKAGLKE----YNE  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  LGL S+KLDCSRRALMDFGNVSSNTIFYV+EYMR+EL  K+
Sbjct  299  LFWAVHPGGPAILNRLESNLGLDSQKLDCSRRALMDFGNVSSNTIFYVMEYMREEL-RKK  357

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGILLR+L
Sbjct  358  ENGE--------EWGLALAFGPGITFEGILLRSL  383



>ref|XP_008375736.1| PREDICTED: chalcone synthase [Malus domestica]
Length=398

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINFKLGRDLP+KI+ NIE+FCKKL   A        +NE
Sbjct  253  AVQQFLPGTHNVIDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLTVPAKAELK--NFNE  310

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN++E TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+EL +K+
Sbjct  311  LFWAVHPGGPAILNKMESTLKLSSDKLECSRRALMDYGNVSSNTIFYVMENMREELKLKK  370

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G+        EWGLALAFGPGITFEGILLR+L
Sbjct  371  KEGR------DEEWGLALAFGPGITFEGILLRSL  398



>ref|XP_007052226.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX96383.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=386

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KAN       +N+
Sbjct  247  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLVSKANLTE----FND  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L + KL+CSRRALMD+GNVSSNTIFYV+EYMR+EL  K 
Sbjct  303  LFWAVHPGGPAILNRLENTLKLNNGKLECSRRALMDYGNVSSNTIFYVMEYMREEL--KA  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGILLR+L
Sbjct  361  EGGE--------EWGLALAFGPGITFEGILLRSL  386



>emb|CAA50308.1| anther specific protein [Brassica napus]
Length=191

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQF+PGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA +++  + +N+
Sbjct  45   AVQQFVPGTQTVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDDS--MEFND  102

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAILNRLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  103  MFWTVHPGGPAILNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---K  159

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEG+LLR+L
Sbjct  160  KKGD-----GAQEWGLGLAFGPGITFEGLLLRSL  188



>ref|XP_010540240.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540242.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540243.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540244.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540245.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540246.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540247.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540248.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540249.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=393

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 127/154 (82%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE+NIE+FC+KL GKA      L  N+
Sbjct  246  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEDNIEEFCRKLKGKAGGEA--LELND  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  + L+  KL+CSRRALMD+GNVSSNTIFYV+EY+RD+L  K 
Sbjct  304  MFWAVHPGGPAILNRLETKMKLKPGKLECSRRALMDYGNVSSNTIFYVMEYVRDDLRKKA  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             QG+        EWGLALAFGPGITFEG+L+R+L
Sbjct  364  IQGE----AEDEEWGLALAFGPGITFEGVLMRSL  393



>ref|XP_011017423.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=451

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 125/154 (81%), Gaps = 15/154 (10%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE+NIE+FC KL+ KA   +    +NE
Sbjct  313  SVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCNKLMSKAGLTD----FNE  368

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L  EKL+CSRRALMD+GNVSSNTI YVLEYMRDEL  KR
Sbjct  369  LFWAVHPGGPAILNRLESKLKLNEEKLECSRRALMDYGNVSSNTIVYVLEYMRDEL--KR  426

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+         WGLALAFGPGITFEGILLR+L
Sbjct  427  GGGE---------WGLALAFGPGITFEGILLRSL  451



>ref|XP_002302511.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 ref|XP_006387497.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
 gb|EEE81784.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP46411.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
Length=388

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 15/154 (10%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + QQFLPGTQ+VIDGR+SEEGI+FKLGRDLP+KIE+NIE+FC KL+ KA        +NE
Sbjct  250  SVQQFLPGTQNVIDGRLSEEGIHFKLGRDLPQKIEDNIEEFCNKLMSKAGLT----DFNE  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L  EKL+CSRRALMD+GNVSSNTI YVLEYMRDEL  KR
Sbjct  306  LFWAVHPGGPAILNRLESKLKLNEEKLECSRRALMDYGNVSSNTIVYVLEYMRDEL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+         WGLALAFGPGITFEGILLR+L
Sbjct  364  GGGE---------WGLALAFGPGITFEGILLRSL  388



>ref|XP_006347928.1| PREDICTED: octaketide synthase 3-like [Solanum tuberosum]
Length=396

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 131/154 (85%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT++VIDGR+++EGINFKLGRDLPEKI++NIE+FCKKLI K +    +  YN+
Sbjct  252  AMQQFLPGTKNVIDGRLTDEGINFKLGRDLPEKIQDNIEEFCKKLIAKNDELKGS-NYND  310

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+RLE+T+ L++EKL+CSR+ALMDFGNVSSNTIFYV+E MR+EL  K+
Sbjct  311  LFWAVHPGGPAILDRLEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVMENMREELKNKK  370

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  371  DGGE--------EWGLALAFGPGITFEGILLRSL  396



>ref|XP_006445367.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 ref|XP_006464463.1| PREDICTED: stilbene synthase 3-like [Citrus sinensis]
 gb|ESR58607.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 gb|KDO85610.1| hypothetical protein CISIN_1g016361mg [Citrus sinensis]
Length=390

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 126/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+ KA        +N+
Sbjct  251  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGLQ----DFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L ++KL+CSRRALMD+GNVSSNTIFYV++YMR+EL  KR
Sbjct  307  LFWAVHPGGPAILNRLESNLKLNNQKLECSRRALMDYGNVSSNTIFYVMDYMREEL--KR  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        EWGLALAFGPGITFEGILLR L
Sbjct  365  KGDE--------EWGLALAFGPGITFEGILLRGL  390



>ref|XP_004229766.1| PREDICTED: chalcone synthase 6-4 [Solanum lycopersicum]
Length=394

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT++VIDGR+++EGINFKLGRDLPEKI+ NIE+FCKKLI K +    +  YN+
Sbjct  248  AMQQFLPGTKNVIDGRLTDEGINFKLGRDLPEKIQENIEEFCKKLIAKRDELQGS-NYND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+RLE+T+ L++EKL+CSR+ALMDFGNVSSNTIFYV+E MR+E+  K+
Sbjct  307  LFWAVHPGGPAILDRLEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVIENMREEMKNKK  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  367  DAGE--------EWGLALAFGPGITFEGILLRSL  392



>gb|KJB24855.1| hypothetical protein B456_004G165000 [Gossypium raimondii]
Length=386

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQSVIDG ++EEGINFKLGRDLP+KIE+NIE+FC+KL+ KA+  +    +NE
Sbjct  247  AVQQFLPGTQSVIDGCLTEEGINFKLGRDLPQKIEDNIEEFCRKLMSKASLTD----FNE  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE TL L   KL+CSR+AL DFGNVSSNTIFYV+EYMR+EL  KR
Sbjct  303  MFWAVHPGGPAILNRLESTLKLNKGKLECSRKALKDFGNVSSNTIFYVMEYMREEL--KR  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGILLR+L
Sbjct  361  EGGE--------EWGLALAFGPGITFEGILLRSL  386



>gb|KDP28845.1| hypothetical protein JCGZ_14616 [Jatropha curcas]
Length=392

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQ LPGTQ+VIDG +SEEGINFKLGRDLP++IE+NIE+FCKKL+ KA        +N+
Sbjct  253  AVQQSLPGTQNVIDGCLSEEGINFKLGRDLPQRIEDNIEEFCKKLMSKAGLTE----FND  308

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L +EKL+CSRRALMD+GNVSSNT+FYV++YMR+E  MKR
Sbjct  309  LFWAVHPGGPAILNRLESTLKLNTEKLECSRRALMDYGNVSSNTVFYVIDYMREE--MKR  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  367  DGGE--------EWGLALAFGPGITFEGILLRSL  392



>ref|XP_006375238.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP53035.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=389

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KA        +N+
Sbjct  250  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLTE----FND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L +EKL+CSRRAL+++GNVSSNTI YVLEYM++EL  KR
Sbjct  306  LFWAVHPGGPAILNRLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEEL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGILLR+L
Sbjct  364  EGGE--------EWGLALAFGPGITFEGILLRSL  389



>ref|XP_009141701.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=393

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQF+PGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA +++  + +N+
Sbjct  247  AVQQFVPGTQTVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDDS--MEFND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAILNRLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  305  MFWTVHPGGPAILNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---K  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEG+LLR+L
Sbjct  362  KKGD-----GAQEWGLGLAFGPGITFEGLLLRSL  390



>emb|CDX93339.1| BnaC04g45570D [Brassica napus]
Length=393

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQF+PGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA +++  + +N+
Sbjct  247  AVQQFVPGTQTVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDDS--MEFND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAILNRLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  305  MFWTVHPGGPAILNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---K  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEG+LLR+L
Sbjct  362  KKGD-----GAQEWGLGLAFGPGITFEGLLLRSL  390



>ref|XP_010456330.1| PREDICTED: chalcone synthase-like isoform X2 [Camelina sativa]
Length=384

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+
Sbjct  239  ALQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLND  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K 
Sbjct  299  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKG  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+R+L
Sbjct  359  TEGE--------EWGLGLAFGPGITFEGFLMRSL  384



>gb|KHF97528.1| Chalcone synthase 9 [Gossypium arboreum]
Length=386

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQSVIDG ++EEGINFKLGRDLP+KIE+NIE+FC+KL+ KA+  +    +NE
Sbjct  247  AVQQFLPGTQSVIDGCLTEEGINFKLGRDLPQKIEDNIEEFCRKLMSKASLTD----FNE  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE TL L   KL+CSR+AL DFGNVSSNTIFYV+EYMR+EL  KR
Sbjct  303  MFWAVHPGGPAILNRLESTLKLNKGKLECSRKALKDFGNVSSNTIFYVMEYMREEL--KR  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGLALAFGPGITFEGILLR+L
Sbjct  361  GGGE--------EWGLALAFGPGITFEGILLRSL  386



>ref|XP_010456329.1| PREDICTED: chalcone synthase-like isoform X1 [Camelina sativa]
Length=394

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLND  308

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K 
Sbjct  309  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKG  368

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+R+L
Sbjct  369  TEGE--------EWGLGLAFGPGITFEGFLMRSL  394



>gb|AEE69028.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQS++DG++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+
Sbjct  245  ATQQFLPGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FND  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGP ILNR+E  LGL ++KL+CSRRALMDFGNVSSNT+FYV+EY+R+EL  KR
Sbjct  301  LFWAVHPGGPEILNRVESRLGLNADKLECSRRALMDFGNVSSNTVFYVMEYLREEL--KR  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        EWGLALAFGPGITFEG+LLR+L
Sbjct  359  KGSE--------EWGLALAFGPGITFEGVLLRSL  384



>ref|XP_002511627.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1163

 Score =   206 bits (525),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFLPGTQ VIDGR+SEEGINFKLGRDLP+KIE+NIE+FCKKL+ KA        +N+
Sbjct  1024  AVQQFLPGTQHVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCKKLMSKAGLTE----FND  1079

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILNRLE TL L +EKL+CSR+ALMD+GNVSSNT+FYV+EYMR+EL  KR
Sbjct  1080  LFWAVHPGGPAILNRLESTLKLNAEKLECSRKALMDYGNVSSNTVFYVIEYMREEL--KR  1137

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             K  +        EWGLALAFGPGITFEGILLR+L
Sbjct  1138  KGSE--------EWGLALAFGPGITFEGILLRSL  1163



>ref|XP_010474836.1| PREDICTED: chalcone synthase isoform X2 [Camelina sativa]
Length=387

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  241  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+++GNVSSNTI YV+EYMRDEL   +
Sbjct  299  MFWAVHPGGPAILNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDEL---K  355

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  356  KKGE-----AAQEWGLGLAFGPGITFEGLLIRSL  384



>ref|XP_010474834.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
 ref|XP_010474835.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
Length=392

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  246  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+++GNVSSNTI YV+EYMRDEL   +
Sbjct  304  MFWAVHPGGPAILNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDEL---K  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  361  KKGE-----AAQEWGLGLAFGPGITFEGLLIRSL  389



>gb|ABP98922.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQS++DG++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+
Sbjct  245  ATQQFLPGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FND  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGP ILNR+E  LGL ++KL+CSRRAL+DFGNVSSNT+FYV+EY+R+EL  KR
Sbjct  301  LFWAVHPGGPEILNRVESRLGLNADKLECSRRALVDFGNVSSNTVFYVMEYLREEL--KR  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        EWGLALAFGPGITFEG+LLR+L
Sbjct  359  KGSE--------EWGLALAFGPGITFEGVLLRSL  384



>gb|ADF43044.1| chalcone synthase 3 protein [Brassica rapa subsp. rapa]
Length=393

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQF+PGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+ KA +++  + +N+
Sbjct  247  AVQQFVPGTQTVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGDDS--IEFND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAILNRLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  305  MFWTVHPGGPAILNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---K  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEG+LLR+L
Sbjct  362  KKGD-----GAQEWGLGLAFGPGITFEGLLLRSL  390



>emb|CDY18415.1| BnaA04g21720D [Brassica napus]
Length=393

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQF+PGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+ KA +++  + +N+
Sbjct  247  AVQQFVPGTQTVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGDDS--IEFND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAILNRLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  305  MFWTVHPGGPAILNRLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---K  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEG+LLR+L
Sbjct  362  KKGD-----GAQEWGLGLAFGPGITFEGLLLRSL  390



>ref|XP_010934708.1| PREDICTED: chalcone synthase-like [Elaeis guineensis]
Length=331

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 14/155 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT ++IDGRISEEGINFKLGRDLP+ IE +IE FC+ L+ KA        +NE
Sbjct  191  AVQQFLPGTHNIIDGRISEEGINFKLGRDLPQMIEGHIEGFCRMLMAKAGLQ----DFNE  246

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE +L LR EKL CSRRALMD+GN SSNT+FYV++YMR+EL   R
Sbjct  247  LFWAVHPGGPAILNRLESSLRLRPEKLQCSRRALMDYGNASSNTVFYVMDYMREEL---R  303

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++G         EWGL LAFGPGITFEGIL+R+LQ
Sbjct  304  REGG-------DEWGLVLAFGPGITFEGILVRSLQ  331



>ref|XP_006418482.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
 gb|ESQ36835.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
Length=395

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL D+GNVSSNTI YV+EY+RDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEGEKLESSRRALRDYGNVSSNTILYVMEYVRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGE-----SAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AFN26935.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQS++DG++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+
Sbjct  245  ATQQFLPGTQSIVDGKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FND  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGP ILNR+E  LGL ++KL+CSRRALMDFGNVSSNT+ YV+EY+R+EL  KR
Sbjct  301  LFWAVHPGGPEILNRVESRLGLNADKLECSRRALMDFGNVSSNTVLYVMEYLREEL--KR  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        EWGLALAFGPGITFEG+LLR+L
Sbjct  359  KGSE--------EWGLALAFGPGITFEGVLLRSL  384



>emb|CDP09465.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT +VIDGR+SEEGINF+LGRDLP+KIE+NIE FCKKL+ KA        +N+
Sbjct  243  AVQQFLPGTNNVIDGRLSEEGINFRLGRDLPQKIEDNIEAFCKKLMAKAGLG----DFND  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L+  KL+CSRR LMDFGNVSSNTI YV+EYMR+EL   +
Sbjct  299  LFWAVHPGGPAILNRLESTLKLKPGKLECSRRTLMDFGNVSSNTILYVMEYMREEL---Q  355

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G       G EWGLALAFGPGITFEGIL+R+L
Sbjct  356  KEG-------GEEWGLALAFGPGITFEGILVRSL  382



>ref|XP_006290098.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
 gb|EOA22996.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
Length=394

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+
Sbjct  249  AMQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELND  308

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K 
Sbjct  309  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKG  368

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGITFEG L+R+L
Sbjct  369  TGGE--------EWGLGLAFGPGITFEGFLMRSL  394



>ref|XP_003607498.1| Chalcone synthase [Medicago truncatula]
 gb|AES89695.1| chalcone synthase family protein, putative [Medicago truncatula]
Length=389

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 123/154 (80%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ+VIDGRI+EEGINFKLGRDLP+KIE+NIE+FCKKL+ K+        +NE
Sbjct  250  AVQQFLPNTQNVIDGRITEEGINFKLGRDLPQKIEDNIEEFCKKLMAKSGVKE----FNE  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILN+LE TL L  +KL+CSR+ALM+FGNVSSNTIFYV+EYMRD L   +
Sbjct  306  MFWAVHPGGPAILNKLENTLKLSGDKLECSRKALMNFGNVSSNTIFYVMEYMRDYL---K  362

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G         EWGL LAFGPGITFEG+LLR+L
Sbjct  363  NDG-------TEEWGLGLAFGPGITFEGVLLRSL  389



>ref|XP_010053966.1| PREDICTED: chalcone synthase-like [Eucalyptus grandis]
 gb|KCW78344.1| hypothetical protein EUGRSUZ_D02515 [Eucalyptus grandis]
Length=393

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 12/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ+FLPGT  VIDGR+S+EGI FKLGRDLP+KIE NIE+FCK L+  A  +     +N+
Sbjct  251  AAQRFLPGTHDVIDGRLSDEGIYFKLGRDLPQKIEANIEEFCKGLMATAGLSEG---FND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAI+N+LE TL LRS+KL+CSR+ALMD+GNVSSNTIFYV+E MRDEL MKR
Sbjct  308  VFWAVHPGGPAIMNKLESTLKLRSDKLECSRKALMDYGNVSSNTIFYVIENMRDEL-MKR  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            + G+        EWGLALAFGPGITFEGIL+R+L 
Sbjct  367  EGGE--------EWGLALAFGPGITFEGILVRSLS  393



>gb|AAM63363.1| putative chalcone synthase [Arabidopsis thaliana]
Length=385

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ VIDGR+SEEGI FKLGRDLP+KIE+N+E+FCKKL+ KA +    L  N+
Sbjct  242  AMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAGSGALEL--ND  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K 
Sbjct  300  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+RNL
Sbjct  360  TEGE--------EWGLGLAFGPGITFEGFLMRNL  385



>ref|NP_191915.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AAC19299.1| similar to plant chalcone and stilbene synthases [Arabidopsis 
thaliana]
 emb|CAB80762.1| putative chalcone synthase [Arabidopsis thaliana]
 gb|AAN72004.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37822.1| At4g00040 [Arabidopsis thaliana]
 gb|AEE81817.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=385

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ VIDGR+SEEGI FKLGRDLP+KIE+N+E+FCKKL+ KA +    L  N+
Sbjct  242  AMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAGSGALEL--ND  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K 
Sbjct  300  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+RNL
Sbjct  360  TEGE--------EWGLGLAFGPGITFEGFLMRNL  385



>ref|XP_007140778.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
 gb|ESW12772.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
Length=391

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 124/154 (81%), Gaps = 15/154 (10%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T SVIDGR+SEEGINFKLGRDLP+KIE NIEDFC+KL+ K++       +N+
Sbjct  253  AVQKFLPDTHSVIDGRLSEEGINFKLGRDLPQKIEENIEDFCRKLMAKSSVKE----FND  308

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE +L L ++KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   +
Sbjct  309  LFWAVHPGGPAILNKLESSLKLSTDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---K  365

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGITFEGILLR+L
Sbjct  366  DDGE--------EWGLGLAFGPGITFEGILLRSL  391



>ref|XP_012083857.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Jatropha curcas]
Length=1162

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQ LPGTQ+VIDG +SEEGINFKLGRDLP++IE+NIE+FCKKL+ KA        +N+
Sbjct  1023  AVQQSLPGTQNVIDGCLSEEGINFKLGRDLPQRIEDNIEEFCKKLMSKAGLTE----FND  1078

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILNRLE TL L +EKL+CSRRALMD+GNVSSNT+FYV++YMR+E  MKR
Sbjct  1079  LFWAVHPGGPAILNRLESTLKLNTEKLECSRRALMDYGNVSSNTVFYVIDYMREE--MKR  1136

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               G+        EWGLALAFGPGITFEGILLR+L
Sbjct  1137  DGGE--------EWGLALAFGPGITFEGILLRSL  1162



>gb|AGR67381.1| chalcone synthase-like protein, partial [Citrus reshni]
Length=191

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 104/121 (86%), Gaps = 6/121 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+ KA        +N+
Sbjct  74   AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGLQ----DFND  129

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L ++KL+CSRRALMD+GNVSSNTIFYV++YMR+EL  KR
Sbjct  130  LFWAVHPGGPAILNRLESNLKLNNQKLECSRRALMDYGNVSSNTIFYVMDYMREEL--KR  187

Query  339  K  337
            K
Sbjct  188  K  188



>gb|EYU31920.1| hypothetical protein MIMGU_mgv1a007619mg [Erythranthe guttata]
Length=401

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 120/155 (77%), Gaps = 5/155 (3%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI FKLGRDLP+KIE+NI++FC KL+ KA        YNE
Sbjct  251  AVQQFLPGTSEVIDGRLSEEGIYFKLGRDLPQKIEDNIKEFCDKLMAKAGVE----DYNE  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  LGL  EKLDCSRRALMD+GNVSSNT+ YV+EYMR+E+  K+
Sbjct  307  LFWAVHPGGPAILNRLEGKLGLGKEKLDCSRRALMDYGNVSSNTVLYVMEYMREEMKKKK  366

Query  339  KQGKeeeeegglewglal-AFGPGITFEGILLRNL  238
                  E+ GG E      AFGPGITFEGILLR+L
Sbjct  367  AAAAAAEDGGGGEEWGLALAFGPGITFEGILLRSL  401



>ref|XP_004492184.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=389

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 123/154 (80%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP TQ+VIDGRISEEGINFKLGRDLP+KIE+NIE+FC KL+ K +       +NE
Sbjct  250  AVQKFLPDTQNVIDGRISEEGINFKLGRDLPQKIEDNIEEFCNKLMAKCDVK----DFNE  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE  L L  +KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   +
Sbjct  306  LFWAVHPGGPAILNKLETILKLSGDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---K  362

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEGILLR+L
Sbjct  363  EDGR-------EEWGLGLAFGPGITFEGILLRSL  389



>ref|XP_002875049.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51308.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ KA + +  L  N+
Sbjct  242  ALQQFLPQTQGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKAGSGS--LELND  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K 
Sbjct  300  LFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKG  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+R+L
Sbjct  360  TEGE--------EWGLGLAFGPGITFEGFLMRSL  385



>gb|AAB23817.1| chalcone synthase homolog {C-terminal} [Brassica napus, cv. Westar, 
Peptide Partial, 222 aa]
Length=222

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  79   ALQQFLPGTQAVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGS--LELND  136

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHP GPAILN LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +RDEL  K 
Sbjct  137  LFWAVHPCGPAILNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRDELEKKG  196

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  197  RSGE--------EWGLGLAFGPGITFEGFLMRSL  222



>ref|XP_011042452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Populus euphratica]
Length=1216

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 14/154 (9%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KA        +N+
Sbjct  1077  AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLTE----FND  1132

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILNRLE  L L +EKL+CSRRAL+++GNVSSNTI YVLEYM++EL  KR
Sbjct  1133  LFWAVHPGGPAILNRLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEEL--KR  1190

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               G+        EWGLALAFGPGITFEGILLR+L
Sbjct  1191  GGGE--------EWGLALAFGPGITFEGILLRSL  1216



>ref|XP_010107936.1| Chalcone synthase A [Morus notabilis]
 gb|EXC17336.1| Chalcone synthase A [Morus notabilis]
Length=385

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 13/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP T  VIDG++SEEGINF+LGRDLP+KIE+NIE+FCKKL+ KA        YNE
Sbjct  245  AVQQFLPNTHDVIDGKLSEEGINFRLGRDLPQKIEDNIEEFCKKLMAKAGLK---FEYNE  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE  L LRSEKL  SRRALMD+GNVSSNTI YV+E MR+EL   +
Sbjct  302  LFWAVHPGGPAILNKLESCLKLRSEKLVSSRRALMDYGNVSSNTILYVIENMREEL---K  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++G         EWG  LAFGPGITFEGIL+R+L
Sbjct  359  REGS-------EEWGFGLAFGPGITFEGILIRSL  385



>gb|EPS63204.1| hypothetical protein M569_11580, partial [Genlisea aurea]
Length=373

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 119/154 (77%), Gaps = 12/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGT  VIDGR+SEEGI FKLGRDLP++IE+NIE FC++L+  A  +     YN+
Sbjct  232  AMQKFLPGTSDVIDGRLSEEGIYFKLGRDLPQRIEDNIECFCRELMSAAGLS----EYND  287

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LER L L   KLDCSRRALMDFGNVSSNTIFYV+EYMR E+  K 
Sbjct  288  LFWAVHPGGPAILNGLERRLKLDKAKLDCSRRALMDFGNVSSNTIFYVMEYMRKEMKEKG  347

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +  +        EWGL LAFGPGITFEGILLRN+
Sbjct  348  EAAE--------EWGLGLAFGPGITFEGILLRNV  373



>ref|XP_006396201.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37654.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=359

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 123/154 (80%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGTQ VIDGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L  N+
Sbjct  214  AMQKFLPGTQGVIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELND  273

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL  K 
Sbjct  274  LFWAVHPGGPAILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKG  333

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  334  RGGE--------EWGLGLAFGPGITFEGFLMRSL  359



>emb|CDX83215.1| BnaA03g22910D [Brassica napus]
Length=392

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTQGVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGS--LELND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +RDEL  K 
Sbjct  307  LFWAVHPGGPAILNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRDELEKKG  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  367  RSGE--------EWGLGLAFGPGITFEGFLMRSL  392



>ref|XP_010501268.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Camelina sativa]
Length=1119

 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 10/154 (6%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  973   AVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  1030

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+++GNVSSNTI YV+EYMRDEL   +
Sbjct  1031  MFWAVHPGGPAILNRLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDEL---K  1087

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  1088  KKGE-----AAQEWGLGLAFGPGITFEGLLIRSL  1116



>ref|XP_011470532.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=1141

 Score =   197 bits (501),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 13/154 (8%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFLP T +VIDGR+SEEGINFKLGRDLP+KI+ NIE FCKKL+ KAN       +NE
Sbjct  1001  AVQQFLPDTHNVIDGRLSEEGINFKLGRDLPQKIDENIEVFCKKLMAKANLK----DFNE  1056

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILN+LE TL L S+KL+CSR+ALMD+GNVSSNTIFYV+E MRDEL  ++
Sbjct  1057  LFWAVHPGGPAILNKLEGTLKLTSDKLECSRQALMDYGNVSSNTIFYVMEKMRDEL--RK  1114

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             K+G         EWGLALAFGPGITFEGILLR+L
Sbjct  1115  KEGS-------EEWGLALAFGPGITFEGILLRSL  1141



>ref|XP_010258840.1| PREDICTED: chalcone synthase-like [Nelumbo nucifera]
Length=401

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT ++IDGR+SEEGINFKLGRDLP+KIE+NIE FC+ L+ KAN       +N+
Sbjct  260  AVQQFLPGTHNIIDGRLSEEGINFKLGRDLPQKIEDNIESFCRMLMEKANLKE----FND  315

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE  L L+++KL CSRRALMD+GNVSSNTIFYV++YMR+EL    
Sbjct  316  LFWAVHPGGPAILNRLESCLSLKADKLQCSRRALMDYGNVSSNTIFYVMDYMREELKGGG  375

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +          EWGL LAFGPGITFEGIL+R+L
Sbjct  376  GE----------EWGLVLAFGPGITFEGILVRSL  399



>ref|XP_006396202.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37655.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=395

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 123/154 (80%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGTQ VIDGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L  N+
Sbjct  250  AMQKFLPGTQGVIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELND  309

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL  K 
Sbjct  310  LFWAVHPGGPAILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKG  369

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  370  RGGE--------EWGLGLAFGPGITFEGFLMRSL  395



>ref|XP_003516799.1| PREDICTED: chalcone synthase-like [Glycine max]
 gb|KHN22950.1| Chalcone synthase 9 [Glycine soja]
Length=388

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 15/154 (10%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FL  T +VIDGR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ K++       +N+
Sbjct  250  AVQKFLLDTHNVIDGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMAKSSAK----DFND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE TL L ++KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   +
Sbjct  306  LFWAVHPGGPAILNRLESTLKLSNDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---K  362

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEGILLR+L
Sbjct  363  EDGE--------EWGLGLAFGPGITFEGILLRSL  388



>ref|XP_010466554.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=277

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 126/154 (82%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ KA + +  L +N+
Sbjct  132  ALQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKAGSGSGLLDFND  191

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAIL+ +E  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +++EL  K 
Sbjct  192  LFWAVHPGGPAILSGIETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVKEELEKKG  251

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGITFEG L+R+L
Sbjct  252  TEGE--------EWGLGLAFGPGITFEGFLMRSL  277



>ref|XP_008444217.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=389

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ+VI+G++SEEGI+FKLGRDLP++I++NIE FC+KL+ K     N + +N+
Sbjct  250  AIQQFLPDTQNVINGKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMKK----RNLMNFND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE TL L+SEKL+CSR+ALMD+GNVSSNTIFYV+E MR+ L  KR
Sbjct  306  LFWAVHPGGPAILNKLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  364  EDGE--------EWGLALAFGPGITFEGILIRSL  389



>ref|XP_004142644.1| PREDICTED: chalcone synthase [Cucumis sativus]
 gb|KGN54531.1| hypothetical protein Csa_4G358690 [Cucumis sativus]
Length=389

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP TQ+VI+G++SEEGI+FKLGRDLP++I++NIE FC+KL+ K     N + +N+
Sbjct  250  AIQQFLPDTQNVINGKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMEK----RNLVNFND  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE TL L+SEKL+CSR+ALMD+GNVSSNTIFYV+E MR+ L  KR
Sbjct  306  LFWAVHPGGPAILNKLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENL--KR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  364  EDGE--------EWGLALAFGPGITFEGILIRSL  389



>gb|ADF43043.1| chalcone synthase 2 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 123/154 (80%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTQGVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGS--LELND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K 
Sbjct  307  LFWAVHPGGPAILNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKG  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  367  RGGE--------EWGLGLAFGPGITFEGFLMRSL  392



>ref|XP_009133969.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=392

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 123/154 (80%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTQGVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGS--LELND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K 
Sbjct  307  LFWAVHPGGPAILNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKG  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  367  RGGE--------EWGLGLAFGPGITFEGFLMRSL  392



>emb|CDY21499.1| BnaC03g26980D [Brassica napus]
Length=392

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 123/154 (80%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTQGVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGS--LELND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K 
Sbjct  307  LFWAVHPGGPAILNGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKG  366

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  367  RGGE--------EWGLGLAFGPGITFEGFLMRSL  392



>ref|XP_006396200.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37653.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=538

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 123/154 (80%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGTQ VIDGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L  N+
Sbjct  393  AMQKFLPGTQGVIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELND  452

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL  K 
Sbjct  453  LFWAVHPGGPAILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKG  512

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  513  RGGE--------EWGLGLAFGPGITFEGFLMRSL  538



>ref|XP_008775196.1| PREDICTED: chalcone synthase-like [Phoenix dactylifera]
Length=331

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 120/155 (77%), Gaps = 14/155 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT ++IDGRISEEGI+FKLGRDLP+ IE +IE FC+ L+  A        +NE
Sbjct  191  AVQQFLPGTHNIIDGRISEEGISFKLGRDLPQMIEGHIEGFCRMLMANAGLQ----DFNE  246

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE +LGLR EKL CSRRALMD+GN SSNT+FYV++Y+R+EL  + 
Sbjct  247  LFWAVHPGGPAILNRLESSLGLRPEKLQCSRRALMDYGNASSNTVFYVMDYVREELRREG  306

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
             +          EWGL LAFGPGITFEGIL+R+L+
Sbjct  307  GE----------EWGLVLAFGPGITFEGILVRSLK  331



>gb|AAY96728.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96721.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96741.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96720.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96722.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96724.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96727.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96733.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96734.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96737.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96738.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96740.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96723.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>ref|NP_171707.1| polyketide synthase A [Arabidopsis thaliana]
 gb|AAC24368.1| Similar to rice chalcone synthase homolog, gp|U90341|2507617 
and anther specific protein, gp|Y14507|2326772 [Arabidopsis 
thaliana]
 gb|ABO09877.1| At1g02050 [Arabidopsis thaliana]
 gb|AEE27371.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=395

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>ref|XP_002889339.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65598.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL  K 
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKG  367

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             + +        EWGL LAFGPGITFEG+L+R+L
Sbjct  368  DEAQ--------EWGLGLAFGPGITFEGLLIRSL  393



>gb|AAY96748.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96729.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96742.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96743.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96717.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96718.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96726.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96730.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96731.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96732.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96735.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96736.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96739.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96744.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
 gb|AAY96747.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAZ81868.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>ref|XP_008232397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Prunus mume]
Length=1150

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 11/154 (7%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFLP T +VIDGR+SEEGINFKLGRDLP+KI+ NIE+FCKKL+ KA+       +NE
Sbjct  1008  AVQQFLPDTHNVIDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLK----DFNE  1063

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILN+LE TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+EL  K+
Sbjct  1064  LFWAVHPGGPAILNKLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMREELKKKK  1123

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             ++          EWGLALAFGPGITFEGIL+R+L
Sbjct  1124  EE-------EREEWGLALAFGPGITFEGILMRSL  1150



>gb|AAY96719.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQDVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96725.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDGS--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>ref|XP_006837297.1| PREDICTED: chalcone synthase [Amborella trichopoda]
 gb|ERN00151.1| hypothetical protein AMTR_s00111p00033190 [Amborella trichopoda]
Length=383

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 118/154 (77%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGTQ +I+GR++EEGINFKLGRDLP+KIE +I+ FCK L+  AN       +N+
Sbjct  243  AVQEFLPGTQGIIEGRLTEEGINFKLGRDLPQKIEGHIDIFCKNLMKNANLTE----FND  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE  L L  EKL CSR+ALMD+GNVSSNTIFYVL+YMR+E   K 
Sbjct  299  LFWAVHPGGPAILNKLESNLRLNPEKLKCSRKALMDYGNVSSNTIFYVLDYMREE--AKE  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGITFEGIL+R L
Sbjct  357  DGGE--------EWGLVLAFGPGITFEGILVRRL  382



>gb|AAZ81862.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
 gb|AAZ81865.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
 gb|AAZ81866.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=392

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGIT EG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITLEGLLIRSL  392



>gb|AAZ81861.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLELEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81872.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81871.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAY96746.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGIT EG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITLEGLLIRSL  392



>gb|AAZ81869.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EW L LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWRLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81867.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81859.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
 gb|AAZ81864.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81863.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81860.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81870.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  +   + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDEP-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>ref|NP_001150611.1| chalcone synthase G [Zea mays]
 gb|ACG39754.1| chalcone synthase G [Zea mays]
 tpg|DAA49571.1| TPA: chalcone synthase G [Zea mays]
Length=385

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 118/155 (76%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N+
Sbjct  239  STQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK----DFND  294

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    
Sbjct  295  IFWAVHPGGPAILNRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----  350

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         EWGL LAFGPGITFEG+L+R ++
Sbjct  351  KKG-----AISEEWGLILAFGPGITFEGLLVRGVK  380



>ref|XP_008678397.1| PREDICTED: chalcone synthase G isoform X1 [Zea mays]
 gb|ACF85939.1| unknown [Zea mays]
 tpg|DAA49572.1| TPA: hypothetical protein ZEAMMB73_179866 [Zea mays]
Length=390

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 118/155 (76%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N+
Sbjct  244  STQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK----DFND  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    
Sbjct  300  IFWAVHPGGPAILNRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----  355

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         EWGL LAFGPGITFEG+L+R ++
Sbjct  356  KKGA-----ISEEWGLILAFGPGITFEGLLVRGVK  385



>gb|AAY96745.1| chalcone synthase family protein, partial [Arabidopsis thaliana]
Length=392

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 10/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VI+GR++ EGINFKLGRDLP+KIE NIE+FCKKL+GKA + +  + +N+
Sbjct  249  AVQQFLPGTQNVIEGRLTAEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDES--MEFND  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMRDEL   +
Sbjct  307  MFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDEL---K  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  364  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>ref|XP_007219350.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
 gb|EMJ20549.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
Length=362

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 4/114 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP T +VIDGR+SEEGINFKLGRDLP+KI+ NIE+FCKKL+ KA+  +    +NE
Sbjct  253  AVQQFLPDTHNVIDGRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLKD----FNE  308

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRD  358
            LFWAVHPGGPAILN+LE TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+
Sbjct  309  LFWAVHPGGPAILNKLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMRE  362



>ref|NP_001064891.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|AAL59036.1|AC087182_19 anther-specific protein YY2 [Oryza sativa Japonica Group]
 dbj|BAA23618.1| YY2 protein [Oryza sativa]
 gb|AAP54339.1| Chalcone and stilbene synthases, N-terminal domain containing 
protein, expressed [Oryza sativa Japonica Group]
 dbj|BAC78574.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF26805.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|EAZ16469.1| hypothetical protein OsJ_31939 [Oryza sativa Japonica Group]
 dbj|BAG97274.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 19/157 (12%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+I+EEGINFKLGRDLPEKIEN IE FC+ L+ +         +N+
Sbjct  248  STQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIKE----FND  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---M  349
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   M
Sbjct  304  VFWAVHPGGPAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGM  363

Query  348  MKRKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++ + G            L LAFGPGITFEG+L+R +
Sbjct  364  IREEWG------------LILAFGPGITFEGMLVRGI  388



>gb|AAZ81873.1| chalcone synthase family protein, partial [Arabidopsis halleri 
subsp. gemmifera]
Length=393

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 9/154 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA  + + + +N+
Sbjct  249  AVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGGDES-MEFND  307

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+ NVSSNTI YV+EYMR+EL   +
Sbjct  308  MFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYENVSSNTILYVMEYMREEL---K  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  365  KKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  393



>ref|XP_006285956.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
 gb|EOA18854.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
Length=396

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA        YN+
Sbjct  248  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAYK--DYNQ  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  306  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIIYVLEYMLEESKKVR  365

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               K        EWGL LAFGPG+TFEGI+ RNL
Sbjct  366  SMNK-----EENEWGLILAFGPGVTFEGIIARNL  394



>gb|EAY78973.1| hypothetical protein OsI_34081 [Oryza sativa Indica Group]
Length=389

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 116/157 (74%), Gaps = 19/157 (12%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N+
Sbjct  248  STQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIKE----FND  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---M  349
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   M
Sbjct  304  VFWAVHPGGPAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGM  363

Query  348  MKRKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++ + G            L LAFGPGITFEG+L+R +
Sbjct  364  IREEWG------------LILAFGPGITFEGMLVRGI  388



>ref|XP_006661875.1| PREDICTED: stilbene synthase 4-like [Oryza brachyantha]
Length=392

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 19/156 (12%)
 Frame = -2

Query  693  QQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNELF  514
            Q+FLPGT+ VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++F
Sbjct  251  QEFLPGTEKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIKE----FNDVF  306

Query  513  WAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMK  343
            WAVHPGGPAILNRLE  L L++EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   +++
Sbjct  307  WAVHPGGPAILNRLELCLELQTEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGVIR  366

Query  342  RKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
             + G            L LAFGPGITFEG+L+R + 
Sbjct  367  EEWG------------LILAFGPGITFEGMLVRGVN  390



>ref|XP_004982809.1| PREDICTED: stilbene synthase 4-like [Setaria italica]
Length=387

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 13/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N+
Sbjct  246  STQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRNLMDQVGIK----DFND  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    
Sbjct  302  VFWAVHPGGPAILNRLEFCLELQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----  357

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R +
Sbjct  358  KKGA-----ISEEWGLILAFGPGITFEGLLVRGV  386



>gb|AAZ23686.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23687.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_002869122.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45381.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EEDEWGLILAFGPGVTFEGIIARNL  390



>gb|ERN16348.1| hypothetical protein AMTR_s00182p00053650 [Amborella trichopoda]
Length=317

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLPGT+ +IDGR++EEGINFK+ RDLP+ IE+ IE FC KL+ K         YNE
Sbjct  170  AIQHFLPGTEKIIDGRLTEEGINFKIERDLPQIIEDYIEAFCLKLMQKVGLGEEG--YNE  227

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRALMD+GNVSSNTI YVLE+M +E +  R
Sbjct  228  MFWAVHPGGPAILNRLEKRLNLTPEKLVASRRALMDYGNVSSNTIVYVLEFMMEESLKMR  287

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGITFEGIL R+L
Sbjct  288  DTGE-----RENEWGLILAFGPGITFEGILARSL  316



>ref|XP_010437562.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  SMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>emb|CDX69091.1| BnaC01g03620D [Brassica napus]
Length=392

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGINF L R+LP+ IE+N+E FCKKLIGKA     +  YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPKD--YNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  KMKE-----VENEWGLILAFGPGVTFEGIVARNL  390



>ref|NP_001131211.1| uncharacterized protein LOC100192519 [Zea mays]
 gb|ACF79526.1| unknown [Zea mays]
Length=390

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N+
Sbjct  244  STQEFLPGTDKVIDGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK----DFND  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    
Sbjct  300  VFWAVHPGGPAILNRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----  355

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         +WGL LAFGPGITFEG+L++ ++
Sbjct  356  KKGT-----ISEDWGLILAFGPGITFEGLLVQGVK  385



>gb|AAZ23702.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23708.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKMIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23721.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23704.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>emb|CAB45446.1| chalcone synthase-like protein [Arabidopsis thaliana]
 emb|CAB80202.1| chalcone synthase-like protein [Arabidopsis thaliana]
Length=390

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  242  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  300  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  360  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  388



>gb|AAZ23705.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23709.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>ref|NP_567971.1| protein LESS ADHESIVE POLLEN 5 [Arabidopsis thaliana]
 gb|AAM63130.1| chalcone synthase-like protein [Arabidopsis thaliana]
 gb|AAZ23694.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23695.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23696.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23697.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23698.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23700.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23701.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23703.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23706.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23707.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23710.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23711.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23712.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23713.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23714.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23715.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23716.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23718.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23719.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23720.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23722.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23723.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23724.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23725.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|ABE66111.1| chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AEE86428.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>gb|AAZ23717.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMWEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>gb|EMS57002.1| Stilbene synthase 4 [Triticum urartu]
Length=390

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 13/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N+
Sbjct  249  STQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIKE----FND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RDEL    
Sbjct  305  VFWAVHPGGPAILNRLEVCLQLEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDEL----  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         EWGL LAFGPGITFEG+L+R +
Sbjct  361  KKGA-----IREEWGLILAFGPGITFEGLLVRGI  389



>gb|ABK28665.1| unknown [Arabidopsis thaliana]
Length=393

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_010432375.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  SLNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>gb|ACB38748.1| chalcone synthase-like protein [Triticum aestivum]
 gb|EMT16036.1| Stilbene synthase 4 [Aegilops tauschii]
Length=390

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 116/155 (75%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N+
Sbjct  249  STQEFLPGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIKE----FND  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RDEL    
Sbjct  305  VFWAVHPGGPAILNRLEVCLELEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDEL----  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         EWGL LAFGPGITFEG+L+R + 
Sbjct  361  KKGA-----IREEWGLILAFGPGITFEGMLVRGIN  390



>gb|AFW68541.1| hypothetical protein ZEAMMB73_283153 [Zea mays]
Length=421

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 118/155 (76%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +    +    +N+
Sbjct  275  STQEFLPGTDKVIDGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIKD----FND  330

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    
Sbjct  331  VFWAVHPGGPAILNRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----  386

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         +WGL LAFGPGITFEG+L++ ++
Sbjct  387  KKG-----TISEDWGLILAFGPGITFEGLLVQGVK  416



>emb|CDX75466.1| BnaA01g02360D [Brassica napus]
Length=392

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGINF L R+LP+ IE+N+E FCKKLIGKA     +  YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPKD--YNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMKE-----VENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_006854881.2| PREDICTED: chalcone synthase [Amborella trichopoda]
Length=382

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLPGT+ +IDGR++EEGINFK+ RDLP+ IE+ IE FC KL+ K         YNE
Sbjct  235  AIQHFLPGTEKIIDGRLTEEGINFKIERDLPQIIEDYIEAFCLKLMQKVGLGEEG--YNE  292

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRALMD+GNVSSNTI YVLE+M +E +  R
Sbjct  293  MFWAVHPGGPAILNRLEKRLNLTPEKLVASRRALMDYGNVSSNTIVYVLEFMMEESLKMR  352

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGITFEGIL R+L
Sbjct  353  DTGE-----RENEWGLILAFGPGITFEGILARSL  381



>gb|AAZ23683.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+ER L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMERRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_002467058.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
 gb|EER94056.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
Length=387

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 13/155 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N+
Sbjct  241  STQEFLPGTDKVIDGKIAEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK----DFND  296

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE  L L+ EKL  SR+AL ++GNVSSNTIFYVLEY+RDEL    
Sbjct  297  VFWAVHPGGPAILNRLEFCLELQPEKLKISRKALKNYGNVSSNTIFYVLEYLRDEL----  352

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+G         EWGL LAFGPGITFEG+L+R ++
Sbjct  353  KKGA-----ISEEWGLILAFGPGITFEGLLVRGVK  382



>emb|CDY34811.1| BnaA09g41780D [Brassica napus]
Length=392

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGINF L R+LP+ IE+N+E FCKKLIGKA        YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMKE-----VENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_002529257.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF33135.1| Chalcone synthase, putative [Ricinus communis]
Length=387

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 115/154 (75%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP  IE+NIE FC+KL+G A   +    YN+
Sbjct  240  AIQNFLPDTEKIIDGRLTEEGISFKLARELPHIIEDNIEGFCQKLMGVAGLTDK--DYNK  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  298  LFWAVHPGGPAILNRMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKMK  357

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++          EWGL LAFGPGITFEGIL RNL
Sbjct  358  EEN------VNNEWGLILAFGPGITFEGILARNL  385



>gb|AAZ23699.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDCGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----EEDEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_009108194.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++EEGINF L R+LP+ IE+N+E FCKKLIGKA     +  YN+
Sbjct  244  AIQNFLPDTEKTIDGKLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPKD--YNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----GENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_004505681.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=391

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ+FLP T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC KLI      N    YN+
Sbjct  243  AAQEFLPDTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLIDVVGLQNK--DYNK  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +  R
Sbjct  301  LFWAVHPGGPAILNRMEKRLDLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEEGLKIR  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEGIL RN+
Sbjct  361  KEG-----GGDPEWGLILAFGPGITFEGILARNM  389



>gb|AAZ23682.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_010268693.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
 ref|XP_010268695.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=398

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 115/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGK--AnnnnnNLTY  526
            A Q FLP T+  IDGR++EEGINFKL RDLP  IEN+++ FC KLI    + ++ ++  Y
Sbjct  246  AIQNFLPDTEKTIDGRLTEEGINFKLERDLPNIIENHVQGFCDKLIQAVGSGSSYDDNDY  305

Query  525  NELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMM  346
            N +FWAVHPGGPAILNRLE+ L L  EKL  SRRALM+FGN SSNTI YVLEYM +E + 
Sbjct  306  NNMFWAVHPGGPAILNRLEKRLNLLPEKLSASRRALMNFGNASSNTIVYVLEYMVEESLK  365

Query  345  KRKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +K+GK        EWGL LAFGPGITFEGIL RNL
Sbjct  366  MKKEGK-----QDSEWGLILAFGPGITFEGILARNL  396



>ref|XP_007131762.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
 gb|ESW03756.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC+KL+  +     N  YN+
Sbjct  244  AVQEFLPHTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCEKLM--SVVGFQNKEYNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  R
Sbjct  302  VFWAVHPGGPAILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEALKTR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+     G  EWGL LAFGPGITFEGIL RNL
Sbjct  362  KDGR-----GDSEWGLILAFGPGITFEGILARNL  390



>gb|AAZ23684.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23689.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23690.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23691.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>gb|AAZ23685.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>gb|AAZ23692.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>emb|CDY58814.1| BnaAnng15370D [Brassica napus]
Length=392

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++E+GINF L R+LP+ IE+N+E FCKKLIGKA   +  + YN+
Sbjct  244  AIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKAGLAH--IDYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     GG EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----GGNEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_011092869.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLPGT+ VIDG+++EEGI+FKL R LP+ IENNI+DFC +L+G A  +     +N+
Sbjct  242  ALQHFLPGTEKVIDGKLTEEGISFKLERQLPQIIENNIQDFCVQLMGSAGYSEK--DFNK  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E    R
Sbjct  300  LFWAVHPGGPAILNRLEKKLELLPEKLNASRRALTDYGNASSNTIVYVLEYMLEEAKNVR  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G  EWGL LAFGPGITFEGIL +NL
Sbjct  360  KDEQ-----GHNEWGLILAFGPGITFEGILTKNL  388



>ref|XP_007131590.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
 gb|ESW03584.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
Length=376

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC KL+  +     N  YN+
Sbjct  228  AVQEFLPHTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLM--SVVEFQNKEYNK  285

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  R
Sbjct  286  LFWAVHPGGPAILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKTR  345

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+        EWGL LAFGPGITFEGIL RNL
Sbjct  346  KDGR-----EDPEWGLILAFGPGITFEGILARNL  374



>ref|XP_009138330.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E GINF L R+LP+ IE+N+E FCKKL+GKA   + +  YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHKD--YNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  KMNE-----GENEWGLILAFGPGVTFEGIVARNL  390



>emb|CDY40656.1| BnaA03g53070D [Brassica napus]
Length=392

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E GINF L R+LP+ IE+N+E FCKKL+GKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  KMNE-----GENEWGLILAFGPGVTFEGIVARNL  390



>gb|ADF43047.1| chalcone synthase 6 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E GINF L R+LP+ IE+N+E FCKKL+GKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  KMNE-----GENEWGLILAFGPGVTFEGIVARNL  390



>gb|KFK30118.1| hypothetical protein AALP_AA7G219100 [Arabis alpina]
Length=392

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFTLSRELPQIIEDNVEGFCKKLIGKAGLGHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NANE-----GENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_010933363.1| PREDICTED: chalcone synthase [Elaeis guineensis]
Length=360

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 117/154 (76%), Gaps = 5/154 (3%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q++LPGT+  IDGR++EEGINF+LGR+LP+ IE+++E FCKK++ +      N  Y+E
Sbjct  210  AVQRYLPGTEKTIDGRLTEEGINFQLGRELPQVIEDHVEGFCKKVMREGREGGENTKYDE  269

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL+R+E  L L  EKL+ SR+AL D+GN SSNTI YVLEYM +E   +R
Sbjct  270  MFWAVHPGGPAILSRVESRLELGPEKLNASRKALRDYGNASSNTIVYVLEYMVEESRKRR  329

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++G+        EWGL LAFGPG+TFEGIL RNL
Sbjct  330  EKGE-----KDCEWGLILAFGPGVTFEGILARNL  358



>ref|XP_006412179.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
 gb|ESQ53632.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
Length=392

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEAGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     G  EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NTSE-----GENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_009799363.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=390

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP+ IE+NIEDFC KLI  +    NN  YN+
Sbjct  242  AIQHFLPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEDFCDKLI--SITRYNNREYNK  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE+ L L  +KL  SRRAL D+GN SSNTI YVLEYM +E     
Sbjct  300  LFWAVHPGGPAILNRLEKRLELSPDKLSASRRALADYGNASSNTIVYVLEYMLEE-----  354

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +GK++E +   +WGL LAFGPGITFEGIL +NL
Sbjct  355  NKGKKKENQEHSDWGLILAFGPGITFEGILTKNL  388



>ref|XP_010447028.1| PREDICTED: chalcone synthase [Camelina sativa]
Length=392

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLI KA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIVKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  SLNE-----EENEWGLILAFGPGVTFEGIIARNL  390



>ref|XP_009108697.1| PREDICTED: chalcone synthase-like [Brassica rapa]
 ref|XP_009108700.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++E+GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     GG EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  NMNE-----GGNEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_003574084.1| PREDICTED: chalcone synthase-like [Brachypodium distachyon]
Length=386

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 113/155 (73%), Gaps = 19/155 (12%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N+
Sbjct  245  STQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIKE----FND  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---M  349
            +FWAVHPGGPAILNRLE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RD L   M
Sbjct  301  VFWAVHPGGPAILNRLEICLQLDPDKLKISRKALMNYGNVSSNTVFYVLEYLRDGLKKGM  360

Query  348  MKRKQGKeeeeegglewglalAFGPGITFEGILLR  244
            ++ + G            L LAFGPGITFEG+L+R
Sbjct  361  IREEWG------------LILAFGPGITFEGMLVR  383



>gb|AAZ23693.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCK+LIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKRLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_002305482.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
 gb|EEE85993.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
Length=391

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE+NIE FC KLIG A   + +  YN+
Sbjct  244  AIQNFLPNTEKTIDGRLTEEGISFKLARELPQIIEDNIEGFCHKLIGVAGLTDKD--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K 
Sbjct  302  MFWAVHPGGPAILNRMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEE-SRKM  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G         +WGL LAFGPGITFEGIL RNL
Sbjct  361  KAGA-----ANCDWGLILAFGPGITFEGILARNL  389



>gb|AAZ23688.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRR LMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRVLMDYGNASSNSIVYVLEYMLEESKKVR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +        EWGL LAFGPG+TFEGI+  NL
Sbjct  362  NMNE-----EENEWGLILAFGPGVTFEGIIAINL  390



>ref|XP_009350954.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
 ref|XP_011037255.1| PREDICTED: chalcone synthase [Populus euphratica]
Length=391

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE NIE FC+KLIG A   + +  YN+
Sbjct  244  AIQNFLPNTEKTIDGRLTEEGISFKLARELPQIIEENIEGFCRKLIGVAGLTDKD--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K 
Sbjct  302  MFWAVHPGGPAILNRMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEE-SRKM  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G         +WGL LAFGPGITFEGIL RNL
Sbjct  361  KAG-----IANCDWGLILAFGPGITFEGILARNL  389



>emb|CDX72506.1| BnaC07g45280D [Brassica napus]
Length=392

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q F+P T+  IDGR++E GINF L R+LP+ IE+N+E FCKKLIGKA   + +  YN+
Sbjct  244  AIQNFIPDTEKTIDGRLTETGINFTLSRELPQIIEDNVESFCKKLIGKAGLADKD--YNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKSR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
                        EWGL LAFGPG+TFEGI+ RNL
Sbjct  362  SMS-----GSENEWGLILAFGPGVTFEGIVARNL  390



>ref|XP_008780014.1| PREDICTED: chalcone synthase [Phoenix dactylifera]
Length=360

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQQ+LPGT+  IDGR++EEGINF+LGR+LP+ IE+++E FCKKL+ +      +   NE
Sbjct  210  AAQQYLPGTEKTIDGRLTEEGINFRLGRELPQVIEDHVEAFCKKLMREGREGGEDAENNE  269

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL+++E  L L  +KL+ SR+AL D+GN SSNTI YVL YM +E   +R
Sbjct  270  MFWAVHPGGPAILSKVESRLELWPDKLNASRKALRDYGNASSNTIVYVLNYMVEESRKRR  329

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++G+        EWGL LAFGPG+TFEGIL RNL
Sbjct  330  EKGE-----KDCEWGLILAFGPGVTFEGILARNL  358



>gb|KHN32314.1| Chalcone synthase [Glycine soja]
Length=358

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC KLI      N    YN+
Sbjct  210  AVQEFLPHTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLISVVGFENKE--YNK  267

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  R
Sbjct  268  MFWAVHPGGPAILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKIR  327

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G LEWGL LAFGPGITFEGIL RNL
Sbjct  328  KDAR-----GDLEWGLILAFGPGITFEGILARNL  356



>emb|CAA62921.1| chalcone synthase-like [Oryza sativa Japonica Group]
Length=389

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 113/157 (72%), Gaps = 19/157 (12%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q+FLPGT  VIDG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N+
Sbjct  248  STQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIKE----FND  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---M  349
            +FWAVHPGGPAILNRLE    L+ EKL  SR+ALM++GNV SNT+FYVLEY+R EL   M
Sbjct  304  VFWAVHPGGPAILNRLEVCFELQREKLKISRKALMNYGNVRSNTVFYVLEYLRAELKKGM  363

Query  348  MKRKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++ + G            L LAFGPGITFEG+L+R +
Sbjct  364  IREEWG------------LILAFGPGITFEGMLVRGI  388



>emb|CDO96957.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            + Q FLP T+ +IDGR++EEGI+FKLGR+LP+ IE+NIE FC +L+  A  +     YN+
Sbjct  242  SMQHFLPDTEKIIDGRLTEEGISFKLGRELPQIIEDNIEGFCARLMDVAGYSEK--DYNK  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL+ SRRAL DFGN SSNTI YVLEYM +E  + R
Sbjct  300  MFWAVHPGGPAILNRMEKKLDLLPEKLNASRRALADFGNASSNTIVYVLEYMLEENKIAR  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ +    +G  EWGL LAFGPGITFEGIL R L
Sbjct  360  KEDQ----KGNEEWGLILAFGPGITFEGILTRTL  389



>ref|XP_011046865.1| PREDICTED: chalcone synthase-like [Populus euphratica]
 ref|XP_011046870.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=391

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE+NIE FC KLIG A   +    YN+
Sbjct  244  AIQNFLPNTEKTIDGRLTEEGISFKLSRELPQIIEDNIEGFCHKLIGIAGLTDK--DYNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+   L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K 
Sbjct  302  MFWAVHPGGPAILNRMEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEEC-RKM  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         +WGL LAFGPGITFEGIL RNL
Sbjct  361  KEGS-----ENCDWGLILAFGPGITFEGILARNL  389



>ref|XP_006423581.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|ESR36821.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|KDO44184.1| hypothetical protein CISIN_1g016569mg [Citrus sinensis]
Length=387

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE+NIE FC KL+G     NN   YN+
Sbjct  239  AIQNFLPNTEKTIDGRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTNN--DYNK  296

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILN+LE+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  297  MFWAVHPGGPAILNKLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMK  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             Q          +WGL LAFGPGITFEGIL RNL
Sbjct  357  SQDH-----EDTDWGLILAFGPGITFEGILARNL  385



>ref|XP_003537759.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=387

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC KLI      N    YN+
Sbjct  239  AVQEFLPHTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLISVVGFENKE--YNK  296

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  R
Sbjct  297  MFWAVHPGGPAILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKIR  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +     G LEWGL LAFGPGITFEGIL RNL
Sbjct  357  KDAR-----GDLEWGLILAFGPGITFEGILARNL  385



>ref|XP_006487398.1| PREDICTED: chalcone synthase 6-like [Citrus sinensis]
Length=387

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE+NIE FC KL+G     NN   YN+
Sbjct  239  AIQNFLPNTEKTIDGRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTNN--DYNK  296

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILN+LE+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  297  MFWAVHPGGPAILNKLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMK  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             Q          +WGL LAFGPGITFEGIL RNL
Sbjct  357  SQDH-----EDTDWGLILAFGPGITFEGILARNL  385



>emb|CDY17490.1| BnaC03g65730D [Brassica napus]
Length=392

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++E+GINF L R+LP+ IE+N++ FCKKLIGKA   +    YN+
Sbjct  244  AIQNFLPDTEKTIDGKLTEQGINFTLSRELPQIIEDNVDSFCKKLIGKAGLAHK--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R
Sbjct  302  MFWAVHPGGPAILNRMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKAR  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               +     GG EWGL LAFGPG+TFEGI+ RN+
Sbjct  362  NMNE-----GGNEWGLILAFGPGVTFEGIVARNI  390



>ref|XP_007041944.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX97775.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=391

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++EEGI+FKL R+LP+ IE+N+E FC+KL+G     +    YN 
Sbjct  242  AIQNFLPNTEKTIDGKLTEEGISFKLARELPQIIEDNVEGFCEKLMGIVGLTDK--DYNN  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E + ++
Sbjct  300  MFWAVHPGGPAILNRMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKRK  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             + +        EWGL LAFGPG+TFEGIL RNL
Sbjct  360  TESR-----EDSEWGLILAFGPGVTFEGILARNL  388



>ref|XP_008344150.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02060, chloroplastic [Malus domestica]
Length=1210

 Score =   175 bits (443),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 117/154 (76%), Gaps = 6/154 (4%)
 Frame = -2

Query  699   AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             A QQFL  T +VIDGR+ EEGINFKLGRDLP+KI+ NIE FCKKL+  AN       +NE
Sbjct  1063  AVQQFLXETHNVIDGRLFEEGINFKLGRDLPQKIDZNIEVFCKKLVVAANAELR--DFNE  1120

Query  519   LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             LFWAVHPGGPAILN+LE TL   S+KL+ SRRAL D+GNVSSNTIFYV+E MR+EL +K 
Sbjct  1121  LFWAVHPGGPAILNKLESTLKRSSDKLESSRRALXDYGNVSSNTIFYVMENMREELXLKL  1180

Query  339   KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             K+          E  LALAFGPGITFEGILLR+L
Sbjct  1181  KKXX----XREEECXLALAFGPGITFEGILLRSL  1210



>gb|KEH30597.1| chalcone synthase family protein [Medicago truncatula]
Length=390

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            +AQ+F+P T+  IDGR++EEGI+F L R+LP+ IE+N+E FC +L+      N    YN+
Sbjct  243  SAQEFIPDTEKKIDGRLTEEGISFTLARELPQIIEDNVEGFCDRLMDAVELENKE--YNK  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E+ L L  EKL+ SR+ALMD+GN SSNTI YVLEYM DE    R
Sbjct  301  LFWAVHPGGPAILNRVEKRLELSPEKLNASRKALMDYGNASSNTIIYVLEYMLDESKKIR  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G      G  EWGL LAFGPGITFEGIL RNL
Sbjct  361  KEG------GYPEWGLILAFGPGITFEGILARNL  388



>ref|XP_010088676.1| Chalcone synthase 9 [Morus notabilis]
 gb|EXB36843.1| Chalcone synthase 9 [Morus notabilis]
Length=393

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGT   IDGR++EEGI+FKL R+LP+ IE+++E FC+KL+G    +     YN+
Sbjct  244  AMQRFLPGTDKTIDGRLTEEGISFKLARELPQVIEDSVEGFCEKLMGVKGFDKEW--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL+ SR+ALMD+GN SSNTI YVLEYM +E     
Sbjct  302  MFWAVHPGGPAILNRIEKRLDLDPEKLNASRKALMDYGNASSNTIVYVLEYMLEE-----  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
               K + ++   EWGL LAFGPGITFEGIL RNL
Sbjct  357  -SSKMKVDQEENEWGLILAFGPGITFEGILARNL  389



>ref|XP_008372871.1| PREDICTED: chalcone synthase [Malus domestica]
Length=392

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGT+  IDGR++EEGI+FKL R+LP+ IE++IE FC +L+G    +N    YN+
Sbjct  244  ALQEFLPGTEKTIDGRVTEEGISFKLERELPQIIEDHIEGFCGRLMGVVGYDNKE--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL+ SRRAL D+GN SSNTI YVLEY+ +E    +
Sbjct  302  MFWAVHPGGPAILNRMEKRLDLSPEKLNASRRALADYGNASSNTIVYVLEYIIEESKKMK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G+     G   WG+ LAFGPG+TFEGIL RNL
Sbjct  362  KEGE-----GDGGWGMILAFGPGVTFEGILARNL  390



>ref|XP_006379273.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP57070.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=391

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE+NIE FC KLIG A   +    YN+
Sbjct  244  AIQNFLPNTEKTIDGRLTEEGISFKLSRELPQIIEDNIEGFCHKLIGNAGLTDK--DYNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+   L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K 
Sbjct  302  MFWAVHPGGPAILNRMEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEEC-RKM  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G         +WGL LAFGPGITFEGIL R L
Sbjct  361  KEGS-----ENCDWGLILAFGPGITFEGILARKL  389



>gb|KHN05473.1| Chalcone synthase D [Glycine soja]
Length=330

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FL  T+  IDGR++EEGI+FKL R+LP+ IE+N+E FC KL+      N    YN+
Sbjct  182  AVQEFLRHTEKKIDGRLTEEGISFKLARELPQIIEDNVEGFCDKLMSVVGFENKE--YNK  239

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLE+M +E +  R
Sbjct  240  LFWAVHPGGPAILNRIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEFMIEESLKIR  299

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K G+     G LEWGL LAFGPGITFEGIL RNL
Sbjct  300  KDGR-----GDLEWGLILAFGPGITFEGILARNL  328



>ref|XP_004289833.1| PREDICTED: chalcone synthase [Fragaria vesca subsp. vesca]
Length=393

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLPGT+  IDGR++EEGI+FKL R+LP+ IE+N+E FC++L+     +     YN+
Sbjct  244  ALQEFLPGTEKTIDGRLTEEGISFKLARELPQIIEDNVEGFCERLMDVVGFDKKE--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKLD SRRALMD+GN SSNTI YVLEYM +E   K+
Sbjct  302  MFWAVHPGGPAILNRMEKRLDLFPEKLDASRRALMDYGNASSNTIVYVLEYMIEESKKKK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ +    +   EWGL LAFGPGITFEGIL RNL
Sbjct  362  KKKE----QSNGEWGLILAFGPGITFEGILARNL  391



>ref|XP_007199914.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
 gb|EMJ01113.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
Length=393

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKLGR+LP+ IE++IE FC +L+G    +N    YN+
Sbjct  244  AIQEFLPDTEKTIDGRVTEEGISFKLGRELPQIIEDHIEGFCGRLMGVLGYDNKE--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E     
Sbjct  302  MFWAVHPGGPAILNRLEKRLDLFPEKLNASRRALTDYGNASSNTIVYVLEYMIEE----S  357

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ K+E++EG  EWGL LAFGPGITFEGIL RNL
Sbjct  358  KKIKKEQQEGDGEWGLILAFGPGITFEGILARNL  391



>ref|XP_004230925.1| PREDICTED: chalcone synthase [Solanum lycopersicum]
Length=383

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 107/154 (69%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP+ IE+NIEDFC KLI  +   +    YN+
Sbjct  242  AIQHFLPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEDFCDKLINISGIKDRE--YNK  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE+ L L  +KL  SRRAL D+GN SSNTI YVLEYM +E     
Sbjct  300  LFWAVHPGGPAILNRLEKKLDLSPDKLSASRRALADYGNASSNTIVYVLEYMLEEKKDIT  359

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G            L LAFGPGITFEGIL +NL
Sbjct  360  DWG------------LILAFGPGITFEGILTKNL  381



>gb|KJB47606.1| hypothetical protein B456_008G033300 [Gossypium raimondii]
Length=396

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDG+++EEGI+FKL R+LP+ IE+N+E FC+KL+  A        YN+
Sbjct  244  AIQNFLPDTEKTIDGKLTEEGISFKLARELPQIIEDNVESFCEKLM--ATVGLTYKDYNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E++ K+
Sbjct  302  MFWAVHPGGPAILNRIEKRLDLFPEKLSASRRALMDYGNASSNTIVYVLEYMIEEILKKK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +Q K+E +E   EWGL LAFGPG+TFEGIL RNL
Sbjct  362  QQ-KKESQEEESEWGLILAFGPGVTFEGILARNL  394



>ref|XP_003557301.2| PREDICTED: probable inorganic phosphate transporter 1-3 [Brachypodium 
distachyon]
Length=930

 Score =   171 bits (432),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 95/162 (59%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnN  535
            A Q+FLPGT+  IDGR++EEGI F+LGR+LP  IE ++EDFC+KLI     G   + +  
Sbjct  767  ALQRFLPGTEKTIDGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLIKERDQGGDGHTHAQ  826

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  827  LTYDDMFWAVHPGGPAILTKMEGRLGLDGAKLTASRSALRDFGNASSNTIVYVLENMVEE  886

Query  354  LMMKR--KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
               +R  +Q    E     EWGL LAFGPGITFEGIL RNLQ
Sbjct  887  SRRRRELQQAAGAEGGQECEWGLILAFGPGITFEGILARNLQ  928



>ref|XP_012084392.1| PREDICTED: chalcone synthase [Jatropha curcas]
 gb|KDP27594.1| hypothetical protein JCGZ_19599 [Jatropha curcas]
Length=391

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 8/155 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP  IE+NIE FC+KL+  A   +    YN 
Sbjct  244  AIQNFLPDTEKIIDGRMTEEGISFKLARELPHIIEDNIESFCQKLMRGAGVGDKG--YNN  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
             FWAVHPGGPAILNR+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +   
Sbjct  302  FFWAVHPGGPAILNRIEKRLQLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKIN  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            K+ +        +WGL LAFGPGIT EG+L RNL 
Sbjct  362  KENE------DCQWGLILAFGPGITLEGVLARNLS  390



>ref|XP_002276653.1| PREDICTED: chalcone synthase [Vitis vinifera]
Length=392

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE++IE FC KLI     ++    YN+
Sbjct  244  AIQNFLPDTEKTIDGRLTEEGISFKLARELPQIIEDHIEAFCDKLIRNVGFSDE--DYNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E    +
Sbjct  302  IFWAVHPGGPAILNRMEKRLDLLPEKLNASRRALADYGNASSNTIVYVLEYMLEESSKTK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +Q +     G  EWGL LAFGPGITFEGIL RNL
Sbjct  362  RQDQ-----GDGEWGLILAFGPGITFEGILARNL  390



>ref|XP_006359643.1| PREDICTED: chalcone synthase 2-like [Solanum tuberosum]
Length=380

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 107/154 (69%), Gaps = 14/154 (9%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP+ IE+NIE FC KLI  +  N+    YN+
Sbjct  239  AIQHFLPDTEKIIDGRLTEEGISFKLERELPQIIEDNIEGFCDKLISISGINDRE--YNK  296

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE+ L L  EKL  SRRAL D+GN SSNTI YVLEYM +E     
Sbjct  297  LFWAVHPGGPAILNRLEKKLDLSPEKLSASRRALADYGNASSNTIVYVLEYMLEEKKDIT  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G            L LAFGPGITFEGIL +NL
Sbjct  357  DWG------------LILAFGPGITFEGILTKNL  378



>ref|XP_009621338.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=390

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP+ IE NIEDFC KLI  +    N+  YN+
Sbjct  242  AIQHFLPDTEKIIDGRLTEEGISFKLERELPQIIEENIEDFCDKLI--SITGYNDREYNK  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILNRLE+ L L  EKL  SRRAL D+GN SSNTI YVLEY     M++ 
Sbjct  300  LFWAVHPGGPAILNRLEKKLELSPEKLSASRRALADYGNASSNTIVYVLEY-----MLEE  354

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ K++E +    WGL LAFGPGITFEGIL +NL
Sbjct  355  KKDKKKENQEDSNWGLILAFGPGITFEGILTKNL  388



>ref|XP_008236187.1| PREDICTED: chalcone synthase [Prunus mume]
Length=393

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 119/154 (77%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T+  IDGR++EEGI+FKL R+LP+ IE++IE FC +L+G    +N    YN+
Sbjct  244  AIQEFLPDTEKTIDGRVTEEGISFKLARELPQIIEDHIEGFCGRLMGVLGYDNKE--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  +KL+ SRRAL D+GN SSNTI YVLEYM +E     
Sbjct  302  MFWAVHPGGPAILNRLEKRLDLFPDKLNASRRALTDYGNASSNTIVYVLEYMIEE----S  357

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ K+E++EG  EWGL LAFGPGITFEGIL RNL
Sbjct  358  KKIKKEQQEGDGEWGLILAFGPGITFEGILARNL  391



>gb|KGN63621.1| hypothetical protein Csa_1G006310 [Cucumis sativus]
Length=392

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
              Q+F+P TQ++IDG++SEEGI+F + R+LP+ IE+NIE FC+  +     +     YN+
Sbjct  244  TTQKFIPDTQNIIDGKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGLHEKE--YNK  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  302  IFWAVHPGGPAILNRLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGI+FEGIL RNL
Sbjct  362  MEGR-----KIEEWGLILAFGPGISFEGILARNL  390



>ref|XP_004138289.2| PREDICTED: chalcone synthase [Cucumis sativus]
Length=395

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
              Q+F+P TQ++IDG++SEEGI+F + R+LP+ IE+NIE FC+  +     +     YN+
Sbjct  247  TTQKFIPDTQNIIDGKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGLHEKE--YNK  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  305  IFWAVHPGGPAILNRLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMK  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+        EWGL LAFGPGI+FEGIL RNL
Sbjct  365  MEGR-----KIEEWGLILAFGPGISFEGILARNL  393



>gb|AAB80804.1| chalcone synthase homolog PrChS1 [Pinus radiata]
Length=390

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 111/154 (72%), Gaps = 13/154 (8%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLP T   I+GR++EEGINFKLGR+LP+ IE++IE FC+KL+ KA  +     YNE
Sbjct  249  AVQQFLPDTHGTINGRLTEEGINFKLGRELPQIIEDHIEGFCRKLMDKAGVD----DYNE  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW VHPGGPAILNRLE+ L L  EKL  SR+AL D+GN SSNTI YVL+ MR +L    
Sbjct  305  LFWGVHPGGPAILNRLEKKLSLGPEKLYYSRQALADYGNASSNTIVYVLDAMR-QLKGGE  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            KQ          EWGL LAFGPGITFEGIL R+L
Sbjct  364  KQSP--------EWGLILAFGPGITFEGILARSL  389



>ref|XP_008453147.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=395

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
              Q+F+P TQ++IDG++SEEGI+F + R+LP+ IE+NIE FC+  +     +     YN+
Sbjct  247  TTQKFIPDTQNIIDGKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGLHEKE--YNK  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  +
Sbjct  305  MFWAVHPGGPAILNRLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMK  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWGL LAFGPGI+FEGIL RNL
Sbjct  365  MDGR-----KTEEWGLILAFGPGISFEGILARNL  393



>ref|XP_010028685.1| PREDICTED: chalcone synthase [Eucalyptus grandis]
 gb|KCW55471.1| hypothetical protein EUGRSUZ_I01371 [Eucalyptus grandis]
Length=393

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R+LP+ IE+NIE FC KL+     +N    YN 
Sbjct  245  AIQHFLPDTEKIIDGRLTEEGISFKLARELPQIIEDNIEGFCSKLMEPIGLSNK--DYNR  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  +KL  SR+AL D+GN SSNTI YVL+YM +E M  +
Sbjct  303  IFWAVHPGGPAILNRLEKRLDLLPDKLRASRQALKDYGNASSNTIVYVLDYMLEESMKMK  362

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K  +        E+GL LAFGPG+TFEGIL RNL
Sbjct  363  KDDQ-----SQDEFGLILAFGPGVTFEGILARNL  391



>ref|XP_010530789.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010530790.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=392

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  I GR++EEGINFKL R+LP+ IE+N+E+FC KL+  A    +   YN+
Sbjct  244  AIQNFLPETEKTIVGRLTEEGINFKLARELPQIIEDNVENFCSKLMKVAGLTPD--DYNQ  301

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNR+E+ L L  EKL  SRRALMD+GN SSN+I YVLEY+ +E    +
Sbjct  302  MFWAVHPGGPAILNRMEKRLDLSPEKLSPSRRALMDYGNASSNSIVYVLEYLLEESRKAK  361

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             + +      G EWGL LAFGPG+TFEGIL RNL
Sbjct  362  NEDE-----RGEEWGLILAFGPGVTFEGILARNL  390



>ref|NP_001059449.2| Os07g0411300 [Oryza sativa Japonica Group]
 dbj|BAC21541.1| putative chalcone synthase [Oryza sativa Japonica Group]
 dbj|BAF21363.2| Os07g0411300 [Oryza sativa Japonica Group]
Length=405

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T   IDGR++EEGI F+LGR+LP  IE N+E FC+KL+ +     + LTY +
Sbjct  247  ALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGD  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E    R
Sbjct  307  MFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE---TR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++ +E  EE   EWGL LAFGPGITFEGIL RNLQ
Sbjct  364  QRREEAAEEEDCEWGLILAFGPGITFEGILARNLQ  398



>gb|EEC81903.1| hypothetical protein OsI_25733 [Oryza sativa Indica Group]
Length=405

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T   IDGR++EEGI F+LGR+LP  IE N+E FC+KL+ +     + LTY +
Sbjct  247  ALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGD  306

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E    R
Sbjct  307  MFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE---TR  363

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++ +E  EE   EWGL LAFGPGITFEGIL RNLQ
Sbjct  364  QRREEAAEEEDCEWGLILAFGPGITFEGILARNLQ  398



>gb|EAZ39507.1| hypothetical protein OsJ_23944 [Oryza sativa Japonica Group]
Length=410

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T   IDGR++EEGI F+LGR+LP  IE N+E FC+KL+ +     + LTY +
Sbjct  252  ALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGD  311

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E    R
Sbjct  312  MFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE---TR  368

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++ +E  EE   EWGL LAFGPGITFEGIL RNLQ
Sbjct  369  QRREEAAEEEDCEWGLILAFGPGITFEGILARNLQ  403



>ref|XP_010690460.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 110/154 (71%), Gaps = 7/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+FKL R LP+ IE+NIE FC KL+     +N    YN+
Sbjct  247  AIQHFLPDTEKIIDGRLTEEGISFKLDRALPQIIEDNIESFCGKLMENIGLSNK--DYNK  304

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  +KL  SRRAL D+GN SSNTI YV+EYM +E     
Sbjct  305  IFWAVHPGGPAILNRLEKRLDLSPDKLIASRRALADYGNASSNTIVYVMEYMMEEGAKMN  364

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ K        +WGL LAFGPG+TFEGIL +NL
Sbjct  365  KEHK-----NDDQWGLILAFGPGVTFEGILAKNL  393



>gb|EPS66734.1| hypothetical protein M569_08037, partial [Genlisea aurea]
Length=381

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ VIDG+++EEGI+FKL + LP  IE+NI+DFC+KL+G A  +     +N+
Sbjct  232  AIQHFLPDTEKVIDGQLTEEGISFKLEKQLPCIIEHNIQDFCEKLMGHAEFSKP--DFNK  289

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  EKL  SRRAL D+GN SSNTI YVLEY+ +E    R
Sbjct  290  MFWAVHPGGPAILNRLEKRLELSPEKLGASRRALADYGNASSNTIVYVLEYLLEEGNNTR  349

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              G+        EWG  LAFGPGIT EGIL R L
Sbjct  350  TNGE----IEENEWGFILAFGPGITLEGILTRKL  379



>gb|EYU40405.1| hypothetical protein MIMGU_mgv1a008045mg [Erythranthe guttata]
Length=386

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDG+++EEGI+FKL + LP+ IE+NI+DFC +L+G          +NE
Sbjct  237  AIQHFLPDTEKIIDGKLTEEGISFKLEKQLPQIIEDNIQDFCVELMGYGGFCEK--DFNE  294

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFWAVHPGGPAILN+LE+ L L  EKL  SRRAL D+GN SSNTI YVLEYM +E    +
Sbjct  295  LFWAVHPGGPAILNKLEKKLELLPEKLKSSRRALSDYGNASSNTIVYVLEYMLEEAKNFK  354

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +G+     G  EWGL LAFGPGIT EGIL +NL
Sbjct  355  NKGQ----NGNCEWGLILAFGPGITLEGILAKNL  384



>ref|XP_006664811.1| PREDICTED: chalcone synthase LF2-like [Oryza brachyantha]
Length=407

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q+FLP T   IDGR++EEGI F+LGR+LP  IE N+E FC+KL+ + +     LTY++
Sbjct  247  ALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLM-QEHPQQRQLTYDD  305

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   +R
Sbjct  306  MFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRR  365

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            +      EE   EWGL LAFGPGITFEGIL RNL+
Sbjct  366  ETAT--AEEEDCEWGLILAFGPGITFEGILARNLE  398



>emb|CAJ15412.1| unnamed protein product [Triticum aestivum]
Length=421

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 9/164 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnN  535
            A Q+FLPGT+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N 
Sbjct  252  ALQRFLPGTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNM  311

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  312  LTYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE  371

Query  354  LMMKRKQGKeeeeegglewgla----lAFGPGITFEGILLRNLQ  235
               + +  + E E  G +        LAFGPGITFEGIL RNLQ
Sbjct  372  SRQRAEAPEPEPEPEGADQECEWGLILAFGPGITFEGILARNLQ  415



>gb|AAV49989.1| putative chalcone synthase [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 114/175 (65%), Gaps = 20/175 (11%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI----GKAnnnnnNL  532
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI    G A   +  L
Sbjct  252  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVPL  311

Query  531  TYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL  352
            TY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E 
Sbjct  312  TYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEES  371

Query  351  M----------------MKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
                              +R++  E E E   EWGL LAFGPGITFEGIL RNLQ
Sbjct  372  RRQRMTEAPVLENMVEESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQ  426



>emb|CAJ13966.1| unnamed protein product [Aegilops tauschii]
Length=420

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnN  535
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N 
Sbjct  252  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNM  311

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  312  LTYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE  371

Query  354  LMMKRKQGKeeeeegglewgl---alAFGPGITFEGILLRNLQ  235
               + +  + E E  G E       LAFGPGITFEGIL RNLQ
Sbjct  372  SRQRAEAPEPEPEPEGEEECEWGLILAFGPGITFEGILARNLQ  414



>gb|EMT21347.1| hypothetical protein F775_52323 [Aegilops tauschii]
Length=401

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnN  535
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N 
Sbjct  233  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNM  292

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  293  LTYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE  352

Query  354  LMMKRKQGKeeeeegglewgl---alAFGPGITFEGILLRNLQ  235
               + +  + E E  G +       LAFGPGITFEGIL RNLQ
Sbjct  353  SRQRAEAPEPEPEPEGGQECEWGLILAFGPGITFEGILARNLQ  395



>ref|XP_002461886.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
 gb|EER98407.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
Length=418

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 110/160 (69%), Gaps = 5/160 (3%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnn-----N  535
            A Q+FLP T+  I+GR++EEGI F+LGR+LP  IE ++EDFC KL+ +     +      
Sbjct  250  ALQRFLPDTEKTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCHKLMKEREEVGDDDRGPE  309

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            L+Y ++FWAVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  310  LSYGDMFWAVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEE  369

Query  354  LMMKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
               ++       +    EWGL LAFGPGITFEGIL RNLQ
Sbjct  370  TRRRKLLAAPAGDGEDCEWGLILAFGPGITFEGILARNLQ  409



>emb|CAJ13548.1| unnamed protein product [Triticum turgidum]
Length=418

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 6/161 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnN  535
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N 
Sbjct  252  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNM  311

Query  534  LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDE  355
            LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E
Sbjct  312  LTYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE  371

Query  354  LMMKRKQGKeeeeegglew-glalAFGPGITFEGILLRNLQ  235
               + +  + E E G     GL LAFGPGIT EGIL RNLQ
Sbjct  372  SRQRTEAPEPEAEGGQECEWGLILAFGPGITLEGILARNLQ  412



>dbj|BAJ95097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 114/174 (66%), Gaps = 19/174 (11%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGK---AnnnnnNLT  529
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI +   A    + LT
Sbjct  250  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVLT  309

Query  528  YNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELM  349
            Y+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E  
Sbjct  310  YDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESR  369

Query  348  ----------------MKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
                             +R++  E E E   EWGL LAFGPGITFEGIL RNLQ
Sbjct  370  RQSMTEAPVLENMVEESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQ  423



>ref|XP_001781520.1| predicted protein [Physcomitrella patens]
 gb|EDQ53700.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 6/154 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q F+PGT   IDGR+SEEGI+FKLGR+LP+ IE+NI+ FC  ++ +A      L YN+
Sbjct  270  AGQSFIPGTNKTIDGRLSEEGISFKLGRELPKLIESNIQGFCDPILKRAGG----LKYND  325

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILN +++ L L  EKL  +R+ L D+GN+SS+T  YVL+YMR +  +K 
Sbjct  326  IFWAVHPGGPAILNAVQKQLDLAPEKLQTARQVLRDYGNISSSTCIYVLDYMRHQ-SLKL  384

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+   +      EWGL LAFGPG+T EG LLRNL
Sbjct  385  KEAN-DNVNTEPEWGLLLAFGPGVTIEGALLRNL  417



>gb|ACJ22498.1| chalcone synthase [Triticum aestivum]
Length=422

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-----  535
            A Q+FLP T+  IDGR++EEGI F+LGR+LP  IE ++E FC+KLI +            
Sbjct  252  ALQRFLPDTEKTIDGRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDHG  311

Query  534  --LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMR  361
              LTY+++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M 
Sbjct  312  EQLTYDKMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMV  371

Query  360  DELMMKRKQGKeeeeegglewgl---alAFGPGITFEGILLRNLQ  235
            +E   + +  + E E  G +       LAFGPGITFEGIL RNLQ
Sbjct  372  EESRQRTEAPEPEPEPEGGQECEWGLILAFGPGITFEGILARNLQ  416



>gb|ACN35784.1| unknown [Zea mays]
Length=339

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-----  535
            A Q+FLP T+  I+GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +      
Sbjct  170  ALQRFLPDTERTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGP  229

Query  534  --LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMR  361
              ++Y ++FWAVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M 
Sbjct  230  EPMSYGDMFWAVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMV  289

Query  360  DELMMKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++   +R+    ++     EWGL LAFGPGITFEGIL RNLQ
Sbjct  290  ED-TRRRRLLAADDGGEDCEWGLILAFGPGITFEGILARNLQ  330



>ref|XP_004956033.1| PREDICTED: chalcone synthase 1-like [Setaria italica]
Length=409

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLT--Y  526
            A Q FLPGT   I+GR++EEGI F+LGR+LP  IE ++E+FC+KL+ +           Y
Sbjct  247  ALQCFLPGTDKTIEGRLTEEGIKFQLGRELPHIIEAHVEEFCRKLMAEREGGGGEEEMGY  306

Query  525  NELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMM  346
            +++FWAVHPGGPAIL ++E  LGL  +KL  SR AL DFGN SSNTI YVLE M +E   
Sbjct  307  DDMFWAVHPGGPAILTKMEGRLGLGGDKLRASRCALRDFGNASSNTIVYVLENMVEETRR  366

Query  345  KRKQGKeeeeegglew-glalAFGPGITFEGILLRNLQ  235
            ++      + +G     GL LAFGPGITFEGIL RNLQ
Sbjct  367  RKAAAAAGDSDGDDCEWGLILAFGPGITFEGILARNLQ  404



>ref|NP_001149508.1| chalcone synthase [Zea mays]
 gb|ACF88048.1| unknown [Zea mays]
 gb|ACG35664.1| chalcone synthase [Zea mays]
 gb|ACN27825.1| unknown [Zea mays]
 tpg|DAA60356.1| TPA: chalcone synthase [Zea mays]
Length=417

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-----  535
            A Q+FLP T+  I+GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +      
Sbjct  248  ALQRFLPDTERTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGP  307

Query  534  --LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMR  361
              ++Y ++FWAVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M 
Sbjct  308  EPMSYGDMFWAVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMV  367

Query  360  DELMMKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++   +R+    ++     EWGL LAFGPGITFEGIL RNLQ
Sbjct  368  ED-TRRRRLLAADDGGEDCEWGLILAFGPGITFEGILARNLQ  408



>tpg|DAA60357.1| TPA: hypothetical protein ZEAMMB73_750242 [Zea mays]
Length=412

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-----  535
            A Q+FLP T+  I+GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +      
Sbjct  243  ALQRFLPDTERTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGP  302

Query  534  --LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMR  361
              ++Y ++FWAVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M 
Sbjct  303  EPMSYGDMFWAVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMV  362

Query  360  DELMMKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++   +R+    ++     EWGL LAFGPGITFEGIL RNLQ
Sbjct  363  ED-TRRRRLLAADDGGEDCEWGLILAFGPGITFEGILARNLQ  403



>tpg|DAA60355.1| TPA: chalcone synthase [Zea mays]
Length=427

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-----  535
            A Q+FLP T+  I+GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +      
Sbjct  258  ALQRFLPDTERTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGP  317

Query  534  --LTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMR  361
              ++Y ++FWAVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M 
Sbjct  318  EPMSYGDMFWAVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMV  377

Query  360  DELMMKRKQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
            ++   +R+    ++     EWGL LAFGPGITFEGIL RNLQ
Sbjct  378  ED-TRRRRLLAADDGGEDCEWGLILAFGPGITFEGILARNLQ  418



>ref|XP_009401221.1| PREDICTED: chalcone synthase [Musa acuminata subsp. malaccensis]
Length=361

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnn-nnnNLTYN  523
            A QQ+LP T   I G ++EEGI+F LGR+LP  IE+++E FCKKL  +     ++++ YN
Sbjct  210  AIQQYLPDTDKTIQGELTEEGISFLLGRELPLVIEDHVEAFCKKLAMEGLRGESHDVNYN  269

Query  522  ELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMK  343
            ++FWA+HPGGPAILN++E  L L  +KL+ SR+AL DFGN SSNTI YVLE + +E   K
Sbjct  270  DMFWAMHPGGPAILNKVESRLRLCPDKLNASRQALRDFGNASSNTIIYVLENIIEESRKK  329

Query  342  RKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++ G+        EWGL LAFGPGITFEGIL RNL
Sbjct  330  KESGE-----SDCEWGLILAFGPGITFEGILARNL  359



>dbj|BAE80096.1| Chalcone synthase [Silene latifolia]
Length=379

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+ +IDGR++EEGI+F L R LP+ IE+NIE FC KL+      + +  YN+
Sbjct  243  AIQHFLPDTEKIIDGRLTEEGISFTLDRALPQIIEDNIEAFCDKLMSSVGLTSKD--YND  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWAVHPGGPAILNRLE+ L L  +KL  SRRAL D+GN SSNTI YV+EYM +E  +KR
Sbjct  301  MFWAVHPGGPAILNRLEKRLDLSPDKLSASRRALTDYGNASSNTIVYVMEYMIEE-GLKR  359

Query  339  KQG  331
            K G
Sbjct  360  KNG  362



>ref|XP_010497459.1| PREDICTED: chalcone synthase RJ5-like, partial [Camelina sativa]
Length=114

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 10/121 (8%)
 Frame = -2

Query  600  IENNIEDFCKKLIGKAnnnnnNLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRA  421
            IE NIE+FCKKL+GKA + +  + +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRA
Sbjct  1    IEENIEEFCKKLMGKAGDES--MEFNDMFWAVHPGGPAILNRLETKLKLEREKLESSRRA  58

Query  420  LMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalAFGPGITFEGILLRN  241
            L+++GNVSSNTI YV+EYMRDEL   +K+G+        EWGL LAFGPGITFEG+L+R+
Sbjct  59   LVNYGNVSSNTILYVMEYMRDEL---KKKGE-----AAQEWGLGLAFGPGITFEGLLIRS  110

Query  240  L  238
            L
Sbjct  111  L  111



>ref|XP_002985571.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
 ref|XP_002987004.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ11847.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ13445.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
Length=393

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 105/155 (68%), Gaps = 9/155 (6%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnN-LTYN  523
            A+Q F+PG++  IDGR++E+GI F LGR+LP+ IE+ +E F + L+ ++       + Y+
Sbjct  245  ASQCFVPGSEKTIDGRLTEDGIIFSLGRELPQMIESEVEGFIQGLLKRSGRVEAGGVDYD  304

Query  522  ELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMK  343
             LFWA+HPGGPAILN  E+ L L  +KL CSR+ L D+GN++ +TI YVL+YMR      
Sbjct  305  RLFWAIHPGGPAILNACEKKLQLAGDKLKCSRQVLSDYGNINGSTIIYVLDYMR------  358

Query  342  RKQGKeeeeegglewglalAFGPGITFEGILLRNL  238
              Q     ++   EWG+ LAFGPG+T EG++ RNL
Sbjct  359  --QVNAAADKPDPEWGVILAFGPGVTMEGMVARNL  391



>emb|CBI37938.3| unnamed protein product [Vitis vinifera]
Length=284

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 99/154 (64%), Gaps = 28/154 (18%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A Q FLP T+  IDGR++EEGI+FKL R+LP+ IE++IE F                   
Sbjct  157  AIQNFLPDTEKTIDGRLTEEGISFKLARELPQIIEDHIEAF-------------------  197

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
                 HPGGPAILNR+E+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E    +
Sbjct  198  ----FHPGGPAILNRMEKRLDLLPEKLNASRRALADYGNASSNTIVYVLEYMLEESSKTK  253

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +Q +     G  EWGL LAFGPGITFEGIL RNL
Sbjct  254  RQDQ-----GDGEWGLILAFGPGITFEGILARNL  282



>gb|ADG38688.1| AT4G00040-like protein, partial [Neslia paniculata]
Length=204

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGTQ VIDGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+
Sbjct  119  ALQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLND  178

Query  519  LFWAVHPGGPAILNRLERTLGLRSEK  442
            LFWAVHPGGPAIL+ LE  L L+ EK
Sbjct  179  LFWAVHPGGPAILSGLETKLKLKPEK  204



>gb|AEN82337.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82338.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82339.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82340.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82341.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82342.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82343.1| AT4G00040-like protein, partial [Capsella rubella]
Length=202

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+
Sbjct  117  AMQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELND  176

Query  519  LFWAVHPGGPAILNRLERTLGLRSEK  442
            LFWAVHPGGPAIL+ LE  L L+ EK
Sbjct  177  LFWAVHPGGPAILSGLETKLKLKPEK  202



>gb|ADG38683.1| AT4G00040-like protein, partial [Capsella grandiflora]
 gb|ADG38684.1| AT4G00040-like protein, partial [Capsella grandiflora]
 gb|ADG38686.1| AT4G00040-like protein, partial [Capsella grandiflora]
 gb|ADG38687.1| AT4G00040-like protein, partial [Capsella grandiflora]
Length=204

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+
Sbjct  119  AMQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELND  178

Query  519  LFWAVHPGGPAILNRLERTLGLRSEK  442
            LFWAVHPGGPAIL+ LE  L L+ EK
Sbjct  179  LFWAVHPGGPAILSGLETKLKLKPEK  204



>gb|ADG38685.1| AT4G00040-like protein, partial [Capsella grandiflora]
Length=204

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E FCKKL+ +A + + +L  N+
Sbjct  119  AMQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEXFCKKLVAEAGSGSGSLELND  178

Query  519  LFWAVHPGGPAILNRLERTLGLRSEK  442
            LFWAVHPGGPAIL+ LE  L L+ EK
Sbjct  179  LFWAVHPGGPAILSGLETKLKLKPEK  204



>dbj|BAG32254.1| chalcone synthase [Raphanus sativus]
Length=360

 Score = 94.0 bits (232),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A QQFLPGT  VIDGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA + +  L  N+
Sbjct  249  ALQQFLPGTHGVIDGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKAGSGSLEL--ND  306

Query  519  LFWA  508
            LFWA
Sbjct  307  LFWA  310


 Score = 47.8 bits (112),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  535  LDLQ*AFLGGSSRRAGDSEQAGEDSGAEKREAGLQQEGINGFRKR**QYHLL  380
            L+L   F   SSR  G  E+A +++GAE RE G+QQ G++G  +R  Q+HLL
Sbjct  302  LELNDLFWARSSRWTGHPERARDETGAETREVGMQQTGVDGLWERKQQHHLL  353



>gb|ACF94728.1| chalcone synthase 6 [Robinia pseudoacacia]
Length=158

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 91/154 (59%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN 
Sbjct  11   TAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFQPLGISDYNS  66

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+SEK+  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  67   IFWIAHPGGPAILDQVEAKLGLKSEKMQATRHVLSEYGNMSSACVLFILDEMR----RKS  122

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+        GL+WG+   FGPG+T E ++LR++
Sbjct  123  KEDGLRTTGEGLDWGVLFGFGPGLTVETVVLRSV  156



>ref|XP_004504355.1| PREDICTED: chalcone synthase 1-like [Cicer arietinum]
Length=389

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN 
Sbjct  242  TAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFKPLGISDYNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+ EKL+ +R  L ++GN+SS  + ++L+ MR+    K 
Sbjct  298  IFWIAHPGGPAILDQVEDKLGLKPEKLEATRHVLSEYGNMSSACVLFILDAMRN----KS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+        GLEWG+   FGPG+T E ++LR++
Sbjct  354  KENGLATTGEGLEWGVLFGFGPGLTVETVVLRSV  387



>ref|XP_003601648.1| Chalcone synthase [Medicago truncatula]
 gb|AES71899.1| chalcone and stilbene synthase family protein [Medicago truncatula]
 gb|AFK33463.1| unknown [Medicago truncatula]
Length=389

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             AQ  +P ++  IDG + E G+ F L +D+P  +  NIE    K + +A    N   YN 
Sbjct  242  TAQTIVPDSEGAIDGHLREAGLTFHLLKDVPGLVSKNIE----KALVEAFQPLNISDYNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+ EK+  +R  L ++GN+SS  + ++L    DE+ MK 
Sbjct  298  IFWIAHPGGPAILDQVELKLGLKPEKMQATRHVLSEYGNMSSACVLFIL----DEMRMKS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+        GLEWG+   FGPG+T E ++LR++
Sbjct  354  KEDGLATTGEGLEWGVLFGFGPGLTIETVVLRSV  387



>gb|AIS35912.1| chalcone synthase [Phalaenopsis equestris]
Length=394

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A+Q  LP ++  IDG + E G+ F L +D+P  I  NI+    K + +A      L +N 
Sbjct  243  ASQTILPESEGAIDGHLREIGLTFHLLKDVPGLISKNIQ----KCLLEAFKPLGVLDWNS  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+SEKL  SR  L D+GN+SS  + ++L    DE+  + 
Sbjct  299  IFWIAHPGGPAILDQVETKLGLKSEKLAASRNVLADYGNMSSACVLFIL----DEMRRRS  354

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +  +     GLEWG+   FGPG+T E ++LR++
Sbjct  355  AEAGQSTTGEGLEWGVLFGFGPGLTVETVVLRSV  388



>pdb|4WUM|A Chain A, X-ray Crystal Structure Of Chalcone Synthase From Freesia 
Hybrida
 pdb|4WUM|B Chain B, X-ray Crystal Structure Of Chalcone Synthase From Freesia 
Hybrida
 pdb|4WUM|C Chain C, X-ray Crystal Structure Of Chalcone Synthase From Freesia 
Hybrida
 pdb|4WUM|D Chain D, X-ray Crystal Structure Of Chalcone Synthase From Freesia 
Hybrida
 gb|AEO45114.1| chalcone synthase [Freesia hybrid cultivar]
 gb|AEO45115.1| chalcone synthase [Freesia hybrid cultivar]
Length=389

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 8/155 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN 
Sbjct  242  AAQTILPDSEGAIDGHLREVGLTFHLLKDVPGIISKNIE----KSLEEAFKPLGITDYNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  +GL+ EKL  +R  L ++GN+SS  + ++LE MR     K 
Sbjct  298  LFWIAHPGGPAILDQVEAKIGLKPEKLRATRHVLSEYGNMSSACVLFILEEMRK----KS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
             + K      GLEWG+   FGPG+T E ++L +++
Sbjct  354  AEEKNGTTGEGLEWGVLFGFGPGLTVETVVLHSVE  388



>ref|WP_039311134.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91141.1| hypothetical protein QW71_36375, partial [Paenibacillus sp. IHB 
B 3415]
Length=153

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (57%), Gaps = 8/155 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  7    AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLAEAFQPLGISDWNS  62

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL+ EKL  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  63   LFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRK----KS  118

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ  235
                 +    GLEWG+   FGPG+T E ++L +L 
Sbjct  119  AADGLKTTGEGLEWGVLFGFGPGLTVETVVLHSLS  153



>dbj|BAA87922.1| chalcone synthase [Psilotum nudum]
Length=408

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 4/153 (3%)
 Frame = -2

Query  693  QQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNELF  514
               LP +   IDG + E G+ F L +D+P  I  NI +  K+       +    + N++F
Sbjct  242  SNILPESDGAIDGHLREVGLTFHLLKDVPGLISKNIRNILKEAFENVFGDAEPPSVNDIF  301

Query  513  WAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQ  334
            W  HPGGPAIL+++E  L LR EKL  SR  L D+GN+SS  + ++L+Y+R + M    +
Sbjct  302  WIAHPGGPAILDQIEAKLQLRPEKLAASRAVLADYGNMSSACVHFILDYIRHKSM----E  357

Query  333  GKeeeeegglewglalAFGPGITFEGILLRNLQ  235
             K      G EWG+   FGPG+T E ++LR++Q
Sbjct  358  NKCTTTGEGYEWGVLFGFGPGLTVETVILRSVQ  390



>gb|AIB06737.1| chalcone synthases-1 [Mangifera indica]
Length=397

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K +G+A        +N 
Sbjct  244  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLIAKNIE----KSLGEAFTPIGINDWNS  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGGPAIL+++E  LGL+ EK+  +R+ L D+GN+SS  + ++L+ MR + +   
Sbjct  300  IFWVVHPGGPAILDQVEAKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSI---  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            ++GK      GL+WG+   FGPG+T E ++L ++
Sbjct  357  EEGK-PTTGEGLDWGVLFGFGPGLTVETVVLHSV  389



>gb|AHA61354.1| chalcone synthase [Phyllanthus emblica]
Length=390

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  N+E    K + +A    N   +N 
Sbjct  242  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVE----KSLVEAFQPLNIQDWNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAILN++E  LGL+ EKL  +R+ L D+GN+SS  + ++L+ MR     K 
Sbjct  298  LFWIAHPGGPAILNQVEAKLGLKPEKLKATRQILADYGNMSSACVLFILDEMRK----KS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+   +    GLEWG+   FGPG+T E ++L ++
Sbjct  354  KEEGFQTTGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|ADF43046.1| chalcone synthase 5 protein, partial [Brassica rapa subsp. rapa]
Length=235

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  88   AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLDEAFKPLGISDWNS  143

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+ +E+ LGL++EK+  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  144  LFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMR----RKS  199

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+        GLEWG+   FGPG+T E ++L ++
Sbjct  200  KEDGVATTGEGLEWGVLFGFGPGLTVETVVLHSV  233



>gb|AAY83389.1| chalcone synthase [Phalaenopsis hybrid cultivar]
Length=394

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 93/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A+Q  LP ++  IDG + E G+ F L +D+P  I  NI+    K + +A      L +N 
Sbjct  243  ASQTILPESEGAIDGHLREIGLTFHLLKDVPGLISKNIQ----KCLLEAFKPLGVLDWNS  298

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+SEKL  SR  L ++GN+SS  + ++L    DE+  + 
Sbjct  299  IFWIAHPGGPAILDQVETKLGLKSEKLAASRNVLAEYGNMSSACVLFIL----DEMRRRS  354

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +  +     GLEWG+   FGPG+T E ++LR++
Sbjct  355  AEAGQSTTGEGLEWGVLFGFGPGLTVEAVVLRSV  388



>sp|P48392.1|CHS3_GERHY RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Gerbera hybrid cultivar]
 emb|CAA86220.1| chalcone synthase [Gerbera hybrid cultivar]
Length=403

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP ++  IDG + E G+ F L +D+P  I  NIE   K LI +A +  N   +N 
Sbjct  248  AAQTILPDSEGAIDGHLKEVGLTFHLLKDVPALIAKNIE---KALI-QAFSPLNINDWNS  303

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGLR EKL  SR  L ++GN+SS  + ++L+ MR + +   
Sbjct  304  IFWIAHPGGPAILDQVEFKLGLREEKLRASRHVLSEYGNMSSACVLFILDEMRKKSI---  360

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K GK      GLEWG+   FGPG+T E ++L +L
Sbjct  361  KDGK-TTTGEGLEWGVLFGFGPGLTVETVVLHSL  393



>gb|AID16080.1| chalcone synthase, partial [Morus alba]
Length=259

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP ++  IDG + E G+ F L +D+P  I  NI     K + +A        +N 
Sbjct  111  AAQTILPDSEGAIDGHLREVGLTFHLLKDVPMLISKNI----GKSLEEAFTPLGISDWNS  166

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E T+GL+ EKL  +R  L ++GN+SS ++ ++L+ MR     K 
Sbjct  167  IFWVAHPGGPAILDQVEATVGLKKEKLRATREMLKEYGNMSSASVLFILDEMRK----KS  222

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +  +     GL+WG+   FGPG+T E ++LR+L
Sbjct  223  AEEAKSTTGEGLDWGVLFGFGPGLTVETVVLRSL  256



>gb|AEF14414.1| chalcone synthase [Onobrychis viciifolia]
Length=389

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN +
Sbjct  243  AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFQPLGISDYNSI  298

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+++E  LGL+ EK+  +R  L ++GN+SS  + ++L    DE+  K K
Sbjct  299  FWIAHPGGPAILDQVEVKLGLKPEKMQATRHVLSEYGNMSSACVLFIL----DEMRRKSK  354

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GLEWG+   FGPG+T E ++LR++
Sbjct  355  ENGLATTGEGLEWGVLFGFGPGLTVETVVLRSV  387



>gb|ABS82270.1| resveratrol-forming stilbene synthase [Polygonum cuspidatum]
Length=364

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  +P +   ++G + E G++F+L +++P  I NNIE      + +A    N   +N L
Sbjct  217  AQTIIPESDGAVEGHLLEVGLSFQLYQNVPALISNNIE----TCLSEAFTPLNISNWNSL  272

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+ +E T+GL  EKL  +R+ L D+GN+SS  +F++++ MR     K  
Sbjct  273  FWIAHPGGPAILDHVEATVGLNKEKLKATRQVLNDYGNMSSACVFFIMDEMRK----KSL  328

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GL+WG+   FGPGIT E ++LR++
Sbjct  329  ENGHATTGEGLQWGVLFGFGPGITVETVVLRSV  361



>gb|ADY02639.1| chalcone synthase [Parrya nudicaulis]
 gb|ADY02640.1| chalcone synthase [Parrya nudicaulis]
 gb|ADY02642.1| chalcone synthase [Parrya nudicaulis]
Length=394

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  247  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLEEAFKPLGISDWNS  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL++EK+  +R  L +FGN+SS  + ++L+ MR     K 
Sbjct  303  LFWVAHPGGPAILDQVELKLGLKAEKMRATRHVLSEFGNMSSACVLFILDEMRK----KS  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +        GLEWG+   FGPG+T E ++LR++
Sbjct  359  AEDGVATTGEGLEWGVLFGFGPGLTVETVVLRSV  392



>gb|AAM90651.1|AF400566_1 chalcone synthase 11 [Rubus idaeus]
Length=391

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 91/154 (59%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I NNIE    K + +A    +   +N 
Sbjct  242  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISNNIE----KSLNEAFKPLDITDWNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL+ EKL+ +R  L ++GN+SS  + ++L    DE+  K 
Sbjct  298  LFWIAHPGGPAILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFIL----DEVRRKS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
                 +    GLEWG+   FGPG+T E ++L ++
Sbjct  354  ATNGLKTTGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AFC37244.1| chalcone synthase 3 [Camellia chekiangoleosa]
Length=389

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LPG+   IDG + E G+ F L RD+P  I  N+E    K + +A        +N 
Sbjct  242  AAQTILPGSDGAIDGHLREVGLTFHLLRDVPRLISMNVE----KSLVEAFQPLGISDWNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL+ EKL  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  298  LFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRK----KS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +   +    GLEWG+   FGPG+T E ++L +L
Sbjct  354  AEEGLKTTGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|ACC76753.1| STS [Polygonum cuspidatum]
 gb|AEE25896.1| type III polyketide synthase [Polygonum cuspidatum]
Length=388

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  +P +   I+G + E G++F+L +++P  + NNIE      + +A    N   +N L
Sbjct  241  AQTIIPESDGAIEGHLLEVGLSFQLYQNVPALVSNNIE----TCLSEAFTPLNISNWNSL  296

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+ +E T+GL  EKL  +R+ L D+GN+SS  +F++++ MR     K  
Sbjct  297  FWIAHPGGPAILDHVEATVGLNKEKLKATRQVLNDYGNMSSACVFFIMDEMRK----KSL  352

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GL+WG+   FGPGIT E ++LR++
Sbjct  353  ENGHATTGEGLQWGVLFGFGPGITVETVVLRSV  385



>gb|ACF94727.1| chalcone synthase [Robinia pseudoacacia]
Length=224

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 89/153 (58%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN +
Sbjct  78   AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFQPLGISDYNSI  133

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+++E  LGL+ EK+  +R  L ++GN+SS  + ++L+ MR     K K
Sbjct  134  FWIAHPGGPAILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFILDEMR----RKSK  189

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GL+WG+   FGPG+T E +++ ++
Sbjct  190  ENGLATTGEGLDWGVLFGFGPGLTVETVVIHSV  222



>ref|XP_007161427.1| hypothetical protein PHAVU_001G067800g [Phaseolus vulgaris]
 gb|ESW33421.1| hypothetical protein PHAVU_001G067800g [Phaseolus vulgaris]
Length=389

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             +Q  +P T+ VI   + E G+ F + +DLP+ I NNIE+    ++ +A    +   YN 
Sbjct  242  TSQTIVPNTEEVIALHLLEAGLTFHVLKDLPDLISNNIEN----VLVEAFQPLSLSDYNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW VHPGG AIL+++E  LGL+ EKL  SR  L ++GN++S  + ++++ MR+    K 
Sbjct  298  IFWIVHPGGRAILDQVEEKLGLKPEKLRASRHVLAEYGNMASACVLFIMDEMRN----KS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+ +      G +WG+   FGPG+T E I+LR++
Sbjct  354  KEAELSTTGEGFDWGVLFGFGPGLTIETIVLRSV  387



>dbj|BAJ17656.1| chalcone synthase [Gynura bicolor]
Length=398

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 92/162 (57%), Gaps = 8/162 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  245  AAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALTQAFTPLGITDWNS  300

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL+ EK+  +R  L ++GN+SS  + ++++ MR     K 
Sbjct  301  LFWIAHPGGPAILDQVELKLGLKEEKMRATRHVLSEYGNMSSACVLFIIDEMRK----KS  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNLQ**MDPSP  214
             +        GL+WG+   FGPG+T E ++L +L   M  +P
Sbjct  357  AEDGAATTGEGLDWGVLFGFGPGLTVETVVLHSLPTTMHVAP  398



>sp|P30078.1|CHSY_MALDO RecName: Full=Chalcone synthase; AltName: Full=Naregenin-chalcone 
synthase, partial [Malus domestica]
 emb|CAA48773.1| naregenin-chalcone synthase [Malus sp.]
Length=232

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  85   AAQTVLPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLNEALKPIGISDWNS  140

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  L L+ EKL+ +R+ L D+GN+SS  + ++L    DE+  K 
Sbjct  141  LFWIAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFIL----DEVRRKS  196

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             +   E    GLEWG+   FGPG+T E ++L ++
Sbjct  197  AEKGLETTGEGLEWGVLFGFGPGLTVETVVLHSV  230



>ref|XP_010692195.1| PREDICTED: chalcone synthase-like [Beta vulgaris subsp. vulgaris]
Length=393

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  244  AAQTILPDSEGAIDGHLREVGLAFHLLKDVPGLISKNIE----KALVEAFKPIGIDDWNS  299

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FWA HPGGPAIL+++E  LGL+ +KL  +R  L +FGN+SS  + ++L+ MR   M   
Sbjct  300  IFWAAHPGGPAILDQVESKLGLKQDKLSTTRHVLSEFGNMSSACVLFILDEMRKRSM---  356

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G       GLEWG+   FGPG+T E ++L ++
Sbjct  357  KEG-MATTGEGLEWGVLFGFGPGLTVETVMLHSV  389



>emb|CAD20740.1| chalcone synthase [Matthiola incana]
Length=394

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  247  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLEEAFKPLGISDWNS  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL++EK+  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  303  LFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRK----KS  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             Q        GLEWG+   FGPG+T E ++LR++
Sbjct  359  AQDGVATTGEGLEWGVLFGFGPGLTVETVVLRSV  392



>sp|P17818.1|CHSY_MATIN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Matthiola incana]
 emb|CAA35600.1| unnamed protein product [Matthiola incana]
 emb|CAD20739.1| chalcone synthase [Matthiola incana]
Length=394

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ  LP +   IDG + E G+ F L +D+P  I  NIE    K + +A        +N 
Sbjct  247  AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIE----KSLEEAFKPLGISDWNS  302

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+++E  LGL++EK+  +R  L ++GN+SS  + ++L+ MR     K 
Sbjct  303  LFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRK----KS  358

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
             Q        GLEWG+   FGPG+T E ++LR++
Sbjct  359  AQDGVATTGEGLEWGVLFGFGPGLTVETVVLRSV  392



>gb|AAF78070.2| chalcone synthase [Allium cepa]
Length=253

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 93/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            A+Q  LP ++  IDG + E G+ F L +D+P  I  NIE   K+ +G          YNE
Sbjct  104  ASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEALGPLGIG----DYNE  159

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  +GL+ E++  +R  L ++GN+SS  + ++++ MR       
Sbjct  160  VFWIAHPGGPAILBQVEAKVGLKPERMRATREVLKEYGNMSSACVLFIMDEMRKN---SS  216

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+G  +    GLEWG+   FGPG+T E ++LR++
Sbjct  217  KEG-MKTTGEGLEWGVLFGFGPGLTVETVVLRSV  249



>gb|ADZ45298.1| chalcone synthase 1 [Glycyrrhiza uralensis]
Length=390

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A    N   YN +
Sbjct  244  AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFQPLNISDYNSI  299

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+++E  LGL+ EK++ +R  L ++GN+SS  + ++L    DE+  K K
Sbjct  300  FWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFIL----DEMRRKSK  355

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GLEWG+   FGPG+T E ++L ++
Sbjct  356  ENGLATTGEGLEWGVLFGFGPGLTVETVVLHSV  388



>gb|ADZ45294.1| chalcone synthase 3 [Glycyrrhiza uralensis]
Length=390

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 8/153 (5%)
 Frame = -2

Query  696  AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNEL  517
            AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A    N   YN +
Sbjct  244  AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFQPLNISDYNSI  299

Query  516  FWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK  337
            FW  HPGGPAIL+++E  LGL+ EK++ +R  L ++GN+SS  + ++L    DE+  K K
Sbjct  300  FWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFIL----DEMRRKSK  355

Query  336  QGKeeeeegglewglalAFGPGITFEGILLRNL  238
            +        GLEWG+   FGPG+T E ++L ++
Sbjct  356  ENGLATTGEGLEWGVLFGFGPGLTVETVVLHSV  388



>gb|AAT84969.1| stilbene synthase, partial [Vitis vinifera]
Length=151

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
            AAQ F+P +Q  I G + E G+ F+L   +P  I  NIE    K + +A +      +N 
Sbjct  1    AAQTFIPNSQGAIAGNLREVGLTFRLWPSVPTLISENIE----KCLTQAFDPLGISDWNS  56

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            LFW  HPGGPAIL+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + + + 
Sbjct  57   LFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKRE  116

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K         GL+WG+   FGPG+T E ++LR++
Sbjct  117  KA----TTGDGLDWGVLFGFGPGLTIETVVLRSI  146



>ref|XP_004502226.1| PREDICTED: chalcone synthase 1B-like [Cicer arietinum]
Length=389

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 90/154 (58%), Gaps = 8/154 (5%)
 Frame = -2

Query  699  AAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnNLTYNE  520
             AQ  LP ++  IDG + E G+ F L +D+P  I  NIE    K + +A        YN 
Sbjct  242  TAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIE----KALVEAFEPLGISDYNS  297

Query  519  LFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR  340
            +FW  HPGGPAIL+++E  LGL+ EK+  +R+ L D+GN+SS  + ++L    DE+  K 
Sbjct  298  IFWIAHPGGPAILDQVEVKLGLKPEKMQATRQVLSDYGNMSSACVLFIL----DEMRRKS  353

Query  339  KQGKeeeeegglewglalAFGPGITFEGILLRNL  238
            K+        GLEWG+   FGPG+T E ++L ++
Sbjct  354  KEDGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1225614785648