BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4153

Length=844
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095855.1|  PREDICTED: myb family transcription factor A...    123   4e-29   
ref|XP_009374806.1|  PREDICTED: myb family transcription factor A...    120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008351138.1|  PREDICTED: myb family transcription factor A...    117   6e-27   Malus domestica [apple tree]
ref|XP_009374807.1|  PREDICTED: myb family transcription factor A...    116   8e-27   Pyrus x bretschneideri [bai li]
ref|XP_007026438.1|  Myb-like HTH transcriptional regulator famil...    115   3e-26   
ref|XP_008224661.1|  PREDICTED: protein PHR1-LIKE 1 isoform X1          114   7e-26   Prunus mume [ume]
ref|XP_006373551.1|  myb family transcription factor family protein     114   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008351144.1|  PREDICTED: myb family transcription factor A...    112   2e-25   Malus domestica [apple tree]
gb|KDP29024.1|  hypothetical protein JCGZ_16413                         112   2e-25   Jatropha curcas
ref|XP_011086306.1|  PREDICTED: myb family transcription factor A...    112   3e-25   Sesamum indicum [beniseed]
ref|XP_012082209.1|  PREDICTED: myb family transcription factor A...    112   4e-25   
ref|XP_008384340.1|  PREDICTED: myb family transcription factor A...    111   7e-25   
ref|XP_002525238.1|  transcription factor, putative                     111   1e-24   
emb|CAN66505.1|  hypothetical protein VITISV_035498                     110   2e-24   Vitis vinifera
ref|XP_006449962.1|  hypothetical protein CICLE_v10015893mg             110   3e-24   Citrus clementina [clementine]
ref|XP_008224666.1|  PREDICTED: myb family transcription factor A...    109   3e-24   Prunus mume [ume]
ref|XP_002272588.2|  PREDICTED: protein PHR1-LIKE 1-like isoform X1     110   3e-24   
ref|XP_006467243.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1     109   3e-24   Citrus sinensis [apfelsine]
ref|XP_007211673.1|  hypothetical protein PRUPE_ppa009121mg             109   4e-24   Prunus persica
gb|KDO78616.1|  hypothetical protein CISIN_1g020124mg                   108   9e-24   Citrus sinensis [apfelsine]
ref|XP_012082210.1|  PREDICTED: myb family transcription factor A...    108   1e-23   Jatropha curcas
ref|XP_011040091.1|  PREDICTED: myb family transcription factor A...    106   2e-23   Populus euphratica
ref|XP_008384341.1|  PREDICTED: myb family transcription factor A...    107   3e-23   
ref|XP_009602574.1|  PREDICTED: myb family transcription factor A...    106   3e-23   Nicotiana tomentosiformis
ref|XP_009615786.1|  PREDICTED: myb family transcription factor A...    107   3e-23   Nicotiana tomentosiformis
ref|XP_011040090.1|  PREDICTED: myb family transcription factor A...    106   3e-23   Populus euphratica
ref|XP_011040088.1|  PREDICTED: myb family transcription factor A...    106   4e-23   Populus euphratica
emb|CCA29113.1|  putative MYB transcription factor                      106   5e-23   Rosa hybrid cultivar
ref|XP_009374808.1|  PREDICTED: myb family transcription factor A...    105   6e-23   
ref|XP_006449961.1|  hypothetical protein CICLE_v10015893mg             105   9e-23   
ref|XP_010647088.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     105   1e-22   Vitis vinifera
ref|XP_006467244.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     105   1e-22   Citrus sinensis [apfelsine]
ref|XP_006380857.1|  hypothetical protein POPTR_0006s00290g             104   2e-22   
ref|XP_009787053.1|  PREDICTED: myb family transcription factor A...    104   2e-22   Nicotiana sylvestris
ref|XP_006349121.1|  PREDICTED: myb family transcription factor A...    104   2e-22   Solanum tuberosum [potatoes]
ref|XP_004293430.1|  PREDICTED: uncharacterized protein LOC101309129    104   2e-22   Fragaria vesca subsp. vesca
gb|KDO78615.1|  hypothetical protein CISIN_1g020124mg                   104   2e-22   Citrus sinensis [apfelsine]
gb|KDO78614.1|  hypothetical protein CISIN_1g020124mg                   104   3e-22   Citrus sinensis [apfelsine]
ref|XP_011005787.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1     103   3e-22   Populus euphratica
ref|XP_010096513.1|  Myb family transcription factor APL                103   3e-22   Morus notabilis
ref|NP_973385.1|  myb-like HTH transcriptional regulator family p...    102   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776486.1|  PREDICTED: myb family transcription factor A...    103   5e-22   Nicotiana sylvestris
ref|XP_002876730.1|  myb family transcription factor                    102   5e-22   
ref|XP_010424838.1|  PREDICTED: uncharacterized protein LOC104710011    102   7e-22   Camelina sativa [gold-of-pleasure]
gb|EYU27618.1|  hypothetical protein MIMGU_mgv1a010952mg                102   7e-22   Erythranthe guttata [common monkey flower]
ref|NP_178216.1|  myb-like HTH transcriptional regulator family p...    102   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502053.1|  PREDICTED: protein PHR1-LIKE 1-like                102   9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011040089.1|  PREDICTED: myb family transcription factor A...    102   1e-21   Populus euphratica
ref|NP_001275151.1|  myb family transcription factor APL-like           102   1e-21   Solanum tuberosum [potatoes]
gb|AFK37251.1|  unknown                                                 101   2e-21   Lotus japonicus
gb|KJB68479.1|  hypothetical protein B456_010G247100                    100   3e-21   Gossypium raimondii
ref|XP_006291618.1|  hypothetical protein CARUB_v10017769mg             100   3e-21   Capsella rubella
ref|XP_008440942.1|  PREDICTED: protein PHR1-LIKE 1-like                100   3e-21   Cucumis melo [Oriental melon]
ref|XP_010252934.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     101   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010252929.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1     100   4e-21   Nelumbo nucifera [Indian lotus]
gb|KJB68480.1|  hypothetical protein B456_010G247100                    100   5e-21   Gossypium raimondii
gb|KJB68475.1|  hypothetical protein B456_010G247100                    100   5e-21   Gossypium raimondii
ref|XP_004250431.1|  PREDICTED: myb family transcription factor A...    100   6e-21   Solanum lycopersicum
ref|XP_006380858.1|  hypothetical protein POPTR_0006s00290g             100   7e-21   
ref|XP_011005791.1|  PREDICTED: myb family transcription factor A...  99.8    9e-21   Populus euphratica
emb|CBI25862.3|  unnamed protein product                              98.6    1e-20   Vitis vinifera
ref|XP_010524219.1|  PREDICTED: uncharacterized protein LOC104802358  99.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_003594372.1|  Two-component response regulator EHD1            98.6    2e-20   
ref|XP_009107092.1|  PREDICTED: protein PHR1-LIKE 1-like              98.6    2e-20   Brassica rapa
gb|KCW75471.1|  hypothetical protein EUGRSUZ_E04232                   97.8    2e-20   Eucalyptus grandis [rose gum]
gb|EYU27620.1|  hypothetical protein MIMGU_mgv1a010952mg              98.2    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_003594371.1|  Two-component response regulator EHD1            98.6    2e-20   Medicago truncatula
ref|XP_004486394.1|  PREDICTED: myb family transcription factor A...  98.6    3e-20   Cicer arietinum [garbanzo]
gb|KCW75470.1|  hypothetical protein EUGRSUZ_E04232                   98.2    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010686606.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   97.1    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004251050.1|  PREDICTED: protein PHR1-LIKE 1-like              97.8    4e-20   
gb|ACJ85036.1|  unknown                                               97.8    4e-20   Medicago truncatula
ref|XP_009101377.1|  PREDICTED: protein PHR1-LIKE 1-like              97.4    5e-20   Brassica rapa
ref|XP_006586676.1|  PREDICTED: uncharacterized protein LOC100784...  97.1    7e-20   Glycine max [soybeans]
ref|XP_010686602.1|  PREDICTED: myb family transcription factor A...  96.7    7e-20   
ref|XP_011658093.1|  PREDICTED: protein PHR1-LIKE 1                   96.3    8e-20   Cucumis sativus [cucumbers]
ref|XP_006586674.1|  PREDICTED: uncharacterized protein LOC100784...  96.7    9e-20   Glycine max [soybeans]
ref|XP_008384343.1|  PREDICTED: myb family transcription factor A...  95.9    1e-19   
ref|XP_008384342.1|  PREDICTED: uncharacterized protein LOC103446...  96.3    1e-19   
gb|KJB68478.1|  hypothetical protein B456_010G247100                  96.3    2e-19   Gossypium raimondii
ref|XP_006597632.1|  PREDICTED: protein PHR1-LIKE 1-like              95.5    2e-19   
gb|ACU19557.1|  unknown                                               95.1    3e-19   Glycine max [soybeans]
gb|KHN14395.1|  Myb family transcription factor APL                   95.1    3e-19   Glycine soja [wild soybean]
ref|XP_008782978.1|  PREDICTED: myb family transcription factor A...  95.1    3e-19   Phoenix dactylifera
ref|XP_010059710.1|  PREDICTED: uncharacterized protein LOC104447696  97.8    3e-19   
ref|XP_007211672.1|  hypothetical protein PRUPE_ppa009121mg           93.6    4e-19   
gb|KCW76588.1|  hypothetical protein EUGRSUZ_D00972                   92.8    8e-19   Eucalyptus grandis [rose gum]
gb|EYU33817.1|  hypothetical protein MIMGU_mgv1a010983mg              93.6    8e-19   Erythranthe guttata [common monkey flower]
gb|KCW76584.1|  hypothetical protein EUGRSUZ_D00972                   93.2    1e-18   Eucalyptus grandis [rose gum]
ref|NP_001240901.1|  uncharacterized protein LOC100784511             92.8    1e-18   Glycine max [soybeans]
gb|KCW76587.1|  hypothetical protein EUGRSUZ_D00972                   92.8    2e-18   Eucalyptus grandis [rose gum]
ref|XP_006586673.1|  PREDICTED: uncharacterized protein LOC100784...  92.8    2e-18   Glycine max [soybeans]
gb|AFK45910.1|  unknown                                               90.1    4e-18   Lotus japonicus
ref|XP_002308734.2|  myb family transcription factor family protein   92.0    4e-18   
ref|XP_006398489.1|  hypothetical protein EUTSA_v10000981mg           90.5    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_006659335.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   90.1    1e-17   
ref|XP_008794715.1|  PREDICTED: myb family transcription factor A...  89.0    2e-17   
emb|CDP10675.1|  unnamed protein product                              89.0    3e-17   Coffea canephora [robusta coffee]
gb|ACD13206.1|  phosphate high response                               89.4    3e-17   Phaseolus vulgaris [French bean]
ref|XP_008794712.1|  PREDICTED: myb family transcription factor A...  89.0    3e-17   Phoenix dactylifera
ref|XP_008794708.1|  PREDICTED: myb family transcription factor A...  89.0    5e-17   Phoenix dactylifera
gb|AFK43412.1|  unknown                                               87.0    6e-17   Medicago truncatula
ref|NP_001058045.1|  Os06g0609500                                     88.2    8e-17   
ref|XP_010928206.1|  PREDICTED: protein PHR1-LIKE 1-like              87.4    1e-16   
ref|XP_009394531.1|  PREDICTED: protein PHR1-LIKE 1-like              86.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660516.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   85.9    4e-16   
ref|NP_001062813.1|  Os09g0299200                                     85.5    5e-16   
ref|NP_001152613.1|  MYB-CC type transfactor                          85.5    5e-16   Zea mays [maize]
gb|EEC84302.1|  hypothetical protein OsI_30789                        85.1    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010244816.1|  PREDICTED: myb family transcription factor A...  85.5    6e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010942496.1|  PREDICTED: myb family transcription factor A...  85.5    8e-16   Elaeis guineensis
gb|ACN85167.1|  MYB-CC type transfactor                               85.1    8e-16   Oryza sativa f. spontanea
ref|XP_004973261.1|  PREDICTED: protein PHR1-LIKE 1-like              84.7    1e-15   Setaria italica
ref|XP_008794714.1|  PREDICTED: myb family transcription factor A...  83.2    2e-15   
gb|EAZ01633.1|  hypothetical protein OsI_23670                        83.6    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008794709.1|  PREDICTED: myb family transcription factor A...  83.6    3e-15   
gb|EEE68540.1|  hypothetical protein OsJ_26995                        82.4    4e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660518.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   82.0    5e-15   
dbj|BAC75447.1|  putative transfactor                                 82.8    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACN85331.1|  MYB-CC type transfactor                               82.8    6e-15   Oryza meyeriana var. granulata
gb|ACN85217.1|  MYB-CC type transfactor                               82.8    6e-15   Oryza punctata
ref|XP_008794707.1|  PREDICTED: myb family transcription factor A...  82.8    7e-15   
gb|KHN40756.1|  Myb family transcription factor APL                   80.9    7e-15   Glycine soja [wild soybean]
ref|XP_009396090.1|  PREDICTED: protein PHR1-LIKE 1-like              81.6    8e-15   
gb|ACN85271.1|  MYB-CC type transfactor                               82.4    8e-15   Oryza alta
ref|XP_006656238.1|  PREDICTED: protein PHR1-LIKE 1-like              81.3    2e-14   Oryza brachyantha
ref|XP_002460002.1|  hypothetical protein SORBIDRAFT_02g020700        80.9    2e-14   Sorghum bicolor [broomcorn]
ref|XP_010942495.1|  PREDICTED: myb family transcription factor A...  81.3    2e-14   Elaeis guineensis
ref|XP_010526987.1|  PREDICTED: uncharacterized protein LOC104804400  80.9    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_010244819.1|  PREDICTED: myb family transcription factor A...  80.9    3e-14   Nelumbo nucifera [Indian lotus]
gb|EAZ06657.1|  hypothetical protein OsI_28909                        81.3    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_007147557.1|  hypothetical protein PHAVU_006G1347001g          78.6    4e-14   Phaseolus vulgaris [French bean]
ref|XP_010929445.1|  PREDICTED: uncharacterized protein LOC105050915  81.6    5e-14   
ref|XP_006857596.1|  PREDICTED: uncharacterized protein LOC18447437   80.1    6e-14   Amborella trichopoda
ref|XP_003577958.1|  PREDICTED: protein PHR1-LIKE 1-like              79.0    7e-14   Brachypodium distachyon [annual false brome]
gb|AHB08877.1|  MYB transcription factor                              79.0    7e-14   Suaeda glauca
ref|XP_009409861.1|  PREDICTED: protein PHR1-LIKE 1-like              76.3    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563637.1|  PREDICTED: uncharacterized protein LOC100832...  77.8    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_004956515.1|  PREDICTED: protein PHR1-LIKE 1-like              77.4    4e-13   Setaria italica
ref|XP_010227515.1|  PREDICTED: uncharacterized protein LOC100832...  77.8    4e-13   
gb|KCW76590.1|  hypothetical protein EUGRSUZ_D00972                   75.9    5e-13   Eucalyptus grandis [rose gum]
ref|XP_008796527.1|  PREDICTED: protein PHR1-LIKE 1-like              76.6    5e-13   Phoenix dactylifera
ref|XP_010559048.1|  PREDICTED: probable transcription factor KAN2    76.3    1e-12   
gb|EMS49492.1|  Myb family transcription factor APL                   74.7    2e-12   Triticum urartu
dbj|BAJ96936.1|  predicted protein                                    73.9    5e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT16677.1|  Myb family transcription factor APL                   73.6    6e-12   
gb|ACN85245.1|  MYB-CC type transfactor                               73.9    7e-12   Oryza officinalis
dbj|BAK06435.1|  predicted protein                                    74.3    9e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS59788.1|  hypothetical protein M569_15016                       70.1    2e-11   Genlisea aurea
gb|EPS73182.1|  hypothetical protein M569_01574                       68.2    1e-10   Genlisea aurea
gb|EPS70357.1|  hypothetical protein M569_04405                       67.8    2e-10   Genlisea aurea
ref|XP_009407914.1|  PREDICTED: myb family transcription factor A...  65.1    4e-09   
gb|EMT01045.1|  Myb family transcription factor APL                   66.2    4e-09   
gb|ADE77224.1|  unknown                                               66.2    6e-09   Picea sitchensis
ref|XP_009407916.1|  PREDICTED: myb family transcription factor A...  65.5    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573787.1|  PREDICTED: protein PHR1-LIKE 1-like              63.9    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_010673243.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   63.2    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008788481.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   61.6    5e-08   
ref|XP_010904695.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   61.2    8e-08   Elaeis guineensis
ref|XP_008788480.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   61.2    1e-07   Phoenix dactylifera
ref|XP_010904694.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   61.6    1e-07   Elaeis guineensis
ref|XP_008788479.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   61.6    1e-07   Phoenix dactylifera
ref|XP_010653695.1|  PREDICTED: uncharacterized protein LOC100256...  60.5    1e-07   Vitis vinifera
ref|XP_010922093.1|  PREDICTED: protein PHR1-LIKE 1-like              61.2    2e-07   Elaeis guineensis
ref|XP_008786821.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   59.7    2e-07   Phoenix dactylifera
ref|XP_009350627.1|  PREDICTED: protein PHR1-LIKE 1-like              59.7    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_010653694.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   60.8    2e-07   Vitis vinifera
ref|XP_010673244.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   60.1    2e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CCA29108.1|  putative MYB transcription factor                    60.8    3e-07   Rosa hybrid cultivar
ref|XP_008786820.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   60.1    3e-07   Phoenix dactylifera
gb|AHJ09679.1|  MYB transcription factor                              60.5    3e-07   Tamarix hispida
gb|EEC79447.1|  hypothetical protein OsI_20434                        59.7    3e-07   Oryza sativa Indica Group [Indian rice]
gb|ACN85258.1|  MYB-CC type transfactor                               60.1    4e-07   Oryza alta
ref|XP_011461370.1|  PREDICTED: protein PHR1-LIKE 1-like              60.8    4e-07   Fragaria vesca subsp. vesca
gb|KCW76589.1|  hypothetical protein EUGRSUZ_D00972                   51.6    4e-07   Eucalyptus grandis [rose gum]
ref|XP_010673242.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   60.5    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008392505.1|  PREDICTED: protein PHR1-LIKE 1-like              60.5    4e-07   Malus domestica [apple tree]
gb|KJB68477.1|  hypothetical protein B456_010G247100                  60.8    4e-07   Gossypium raimondii
ref|NP_001055910.1|  Os05g0491500                                     59.7    5e-07   
ref|XP_006654580.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   59.3    6e-07   Oryza brachyantha
ref|XP_007202402.1|  hypothetical protein PRUPE_ppa009512mg           59.7    7e-07   Prunus persica
ref|XP_006654581.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   58.5    7e-07   
ref|XP_007161826.1|  hypothetical protein PHAVU_001G101100g           58.5    7e-07   Phaseolus vulgaris [French bean]
ref|XP_010251692.1|  PREDICTED: myb family transcription factor A...  59.7    7e-07   Nelumbo nucifera [Indian lotus]
gb|EEE64196.1|  hypothetical protein OsJ_19028                        59.3    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240601.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   58.9    8e-07   Prunus mume [ume]
ref|XP_008240600.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   59.3    8e-07   Prunus mume [ume]
ref|XP_011620394.1|  PREDICTED: protein PHR1-LIKE 1                   59.3    8e-07   Amborella trichopoda
ref|XP_008385743.1|  PREDICTED: protein PHR1-LIKE 1-like              59.3    9e-07   Malus domestica [apple tree]
ref|XP_009345372.1|  PREDICTED: protein PHR1-LIKE 1-like              59.3    9e-07   Pyrus x bretschneideri [bai li]
ref|XP_007161824.1|  hypothetical protein PHAVU_001G101100g           58.9    1e-06   Phaseolus vulgaris [French bean]
emb|CAN80850.1|  hypothetical protein VITISV_004304                   59.7    1e-06   Vitis vinifera
ref|XP_003568204.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X5   58.5    1e-06   Brachypodium distachyon [annual false brome]
gb|ACG47379.1|  MYB transcription factor                              58.2    2e-06   Zea mays [maize]
ref|XP_006604295.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   58.2    2e-06   Glycine max [soybeans]
ref|XP_003522212.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   58.2    2e-06   Glycine max [soybeans]
ref|XP_001780003.1|  predicted protein                                58.9    2e-06   
ref|XP_004493286.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   57.8    2e-06   Cicer arietinum [garbanzo]
ref|NP_001140465.1|  uncharacterized protein LOC100272524             57.8    2e-06   Zea mays [maize]
ref|XP_004493287.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   57.4    2e-06   Cicer arietinum [garbanzo]
gb|AAU06822.1|  MYB transcription factor                              57.8    2e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002441302.1|  hypothetical protein SORBIDRAFT_09g024090        57.8    2e-06   Sorghum bicolor [broomcorn]
ref|XP_004493285.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   57.8    3e-06   Cicer arietinum [garbanzo]
ref|XP_004961661.1|  PREDICTED: protein PHR1-LIKE 1-like              57.4    3e-06   Setaria italica
gb|ACU19386.1|  unknown                                               56.6    3e-06   Glycine max [soybeans]
ref|XP_011652143.1|  PREDICTED: protein PHR1-LIKE 1 isoform X2        55.5    4e-06   Cucumis sativus [cucumbers]
ref|XP_003624829.1|  Myb family transcription factor APL              57.4    4e-06   
ref|XP_010231226.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   57.4    4e-06   Brachypodium distachyon [annual false brome]
gb|AES81047.2|  myb-like transcription factor family protein          57.4    4e-06   Medicago truncatula
dbj|BAJ86396.1|  predicted protein                                    56.6    6e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008443160.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   55.1    7e-06   Cucumis melo [Oriental melon]
ref|XP_009387473.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X4   56.2    9e-06   
ref|XP_009387469.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   56.2    9e-06   
gb|ABR16946.1|  unknown                                               56.6    1e-05   Picea sitchensis
ref|XP_008443159.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   55.5    1e-05   Cucumis melo [Oriental melon]
ref|XP_004136602.1|  PREDICTED: protein PHR1-LIKE 1 isoform X1        55.5    1e-05   Cucumis sativus [cucumbers]
ref|XP_009387471.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   55.1    1e-05   
gb|AES81048.2|  myb-like transcription factor family protein          55.8    1e-05   Medicago truncatula
ref|XP_007161825.1|  hypothetical protein PHAVU_001G101100g           55.1    1e-05   Phaseolus vulgaris [French bean]
ref|XP_007161823.1|  hypothetical protein PHAVU_001G101100g           55.5    2e-05   Phaseolus vulgaris [French bean]
ref|XP_006576290.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X4   54.7    2e-05   
gb|KHN34587.1|  Myb family transcription factor APL                   55.1    2e-05   Glycine soja [wild soybean]
ref|XP_003554081.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   55.1    2e-05   
ref|XP_006576288.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   55.1    2e-05   Glycine max [soybeans]
ref|XP_006604296.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X4   54.3    2e-05   Glycine max [soybeans]
ref|NP_001276140.1|  protein PHR1-LIKE 1-like                         55.1    2e-05   
ref|NP_001175530.1|  Os08g0346500                                     52.8    4e-05   
ref|NP_001058503.1|  Os06g0703900                                     54.3    5e-05   
gb|EEC81275.1|  hypothetical protein OsI_24378                        54.3    5e-05   Oryza sativa Indica Group [Indian rice]
tpg|DAA60955.1|  TPA: putative MYB DNA-binding domain superfamily...  52.0    9e-05   
ref|XP_010231227.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3   53.1    1e-04   Brachypodium distachyon [annual false brome]
gb|EMT09301.1|  Myb family transcription factor APL                   53.1    1e-04   
gb|ABR16154.1|  unknown                                               52.8    2e-04   Picea sitchensis
ref|XP_009387470.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2   52.0    2e-04   
ref|XP_010231229.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X4   51.6    3e-04   
ref|XP_003568205.2|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   52.0    3e-04   



>ref|XP_011095855.1| PREDICTED: myb family transcription factor APL-like [Sesamum 
indicum]
 ref|XP_011095856.1| PREDICTED: myb family transcription factor APL-like [Sesamum 
indicum]
Length=337

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 148/208 (71%), Gaps = 20/208 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK +KK+S D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKAEKKESGDLLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  +   +    
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGVSAPGTEDIC  203

Query  498  APVSDNSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSCPAV---  340
             P +DN ++P TP P SE P      ++R P K +SL+ S SSH+E L+PDS C      
Sbjct  204  -PEADNKSDPATPAPTSESPFLDKPAKERAPAKSLSLDESFSSHHEPLTPDSGCHVTSPV  262

Query  339  ----ERPSKKQKVSAEAAAFTQPDAMLS  268
                ERP KK++ SA+ AAFT+P+ +LS
Sbjct  263  ESPSERPGKKRRGSAD-AAFTKPEMVLS  289



>ref|XP_009374806.1| PREDICTED: myb family transcription factor APL isoform X1 [Pyrus 
x bretschneideri]
Length=306

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 148/209 (71%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+  D++S LD SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKEPGDVLSNLDGSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLARLSSDN  171

Query  498  APVSDNSTNPVTPVPASEKPENEQRN----PVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SSH E L+PDS C      
Sbjct  172  CPESDNKTDPATPAPTSECPLQDKAAKECVPAKSISIDESFSSHREPLTPDSGCHVGSPA  231

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P VER +KK++V+    AFT P+A+L+
Sbjct  232  ESPKVERLTKKRRVNI-GEAFTDPEAVLT  259



>ref|XP_008351138.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Malus domestica]
Length=306

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 145/209 (69%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+  D++S LD S GMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKEPGDVLSNLDGSPGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLARLSSDN  171

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SSH E L+PDS C      
Sbjct  172  CPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSHREPLTPDSGCHVGSPA  231

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER +KK +V+    AFT P+A+L+
Sbjct  232  ESPKAERLTKKLRVNI-GEAFTDPEAVLT  259



>ref|XP_009374807.1| PREDICTED: myb family transcription factor APL isoform X2 [Pyrus 
x bretschneideri]
Length=303

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 138/209 (66%), Gaps = 24/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKEPGDVLSNLDGSS---GMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLARLSSDN  168

Query  498  APVSDNSTNPVTPVPASEKPENEQRN----PVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SSH E L+PDS C      
Sbjct  169  CPESDNKTDPATPAPTSECPLQDKAAKECVPAKSISIDESFSSHREPLTPDSGCHVGSPA  228

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P VER +KK++V+    AFT P+A+L+
Sbjct  229  ESPKVERLTKKRRVNI-GEAFTDPEAVLT  256



>ref|XP_007026438.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
 gb|EOY29060.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
Length=396

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 143/208 (69%), Gaps = 21/208 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  145  VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  202

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  +  A     
Sbjct  203  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLAEAPGSGASVPALGDNG  262

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC------  349
               SD  T+P TP P SE P  +    +R P K  S++ S SSH+E L+PDS C      
Sbjct  263  LE-SDKKTDPATPAPTSESPLQDKAAKERAPAKSHSIDESFSSHHEPLTPDSGCHVGSPA  321

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAML  271
              P  ER  KKQ+VS  AAAF +P+ +L
Sbjct  322  GSPKGERLMKKQRVSM-AAAFAKPEVVL  348



>ref|XP_008224661.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Prunus mume]
 ref|XP_008224662.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Prunus mume]
 ref|XP_008224663.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Prunus mume]
 ref|XP_008224664.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Prunus mume]
 ref|XP_008224665.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Prunus mume]
Length=306

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 145/209 (69%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+  D++S LD SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKEPGDVLSNLDGSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVRSEAP-GSGHLARLSDDN  171

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K +S++ S SSH+E L+PDS+C      
Sbjct  172  CPESDNKTDPATPAPTSECPLQDKAAKECTPAKSLSIDESFSSHHEPLTPDSACQVDSPA  231

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER  KK++V     AF  P+ +L+
Sbjct  232  ESPKAERSMKKRRVIM-GEAFADPEVVLT  259



>ref|XP_006373551.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ERP51348.1| myb family transcription factor family protein [Populus trichocarpa]
Length=314

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 153/219 (70%), Gaps = 20/219 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S  D SSGMQITEALKL
Sbjct  65   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDVLSNSDGSSGMQITEALKL  122

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG ++  +G+N 
Sbjct  123  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDNC  182

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            PVSDN T+P TP P SE P  +    +  P K +S++ S SS +E L+PDS C       
Sbjct  183  PVSDNKTDPATPAPTSESPLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAE  242

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSH  238
             P  ER  KKQ VS    AF +P+ +L+ ++L  SL S+
Sbjct  243  SPRGERSLKKQMVSM-GVAFGKPEMVLTHQILESSLNSY  280



>ref|XP_008351144.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Malus domestica]
Length=303

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 136/209 (65%), Gaps = 24/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKEPGDVLSNLDGSP---GMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLARLSSDN  168

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SSH E L+PDS C      
Sbjct  169  CPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSHREPLTPDSGCHVGSPA  228

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER +KK +V+    AFT P+A+L+
Sbjct  229  ESPKAERLTKKLRVNI-GEAFTDPEAVLT  256



>gb|KDP29024.1| hypothetical protein JCGZ_16413 [Jatropha curcas]
Length=305

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 153/226 (68%), Gaps = 35/226 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P +  +        
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLVEVPGAGASG-------  166

Query  498  APVSDNS------TNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC  349
             P+S +S      T+P TP P SE P  E    +R P K +S++ S SSH+E L+PDS C
Sbjct  167  -PISGDSCPESDKTDPATPAPTSESPIQEKAAKERAPDKSLSIDESFSSHHEPLTPDSRC  225

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSH  238
                    P  ER  KKQ+V   A A+ +P+ +L+ ++L  SL S+
Sbjct  226  NVGSPAESPKGERSMKKQRVCM-ATAYAKPEMVLTHQILESSLNSY  270



>ref|XP_011086306.1| PREDICTED: myb family transcription factor APL-like [Sesamum 
indicum]
 ref|XP_011086307.1| PREDICTED: myb family transcription factor APL-like [Sesamum 
indicum]
Length=336

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 142/208 (68%), Gaps = 20/208 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDG K +KK+S DIIS LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGNKVEKKESGDIISSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P   G  +    + 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEEP-GLGVPAPGTQDI  202

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSCPAV---  340
             P SDN T P TP P SE P  +    +  P K  S++ S SSH+E L+PDS C      
Sbjct  203  HPESDNKTEPATPGPTSEPPFPDKPAKEHIPAKSPSVDESFSSHHEPLTPDSGCHVTSSV  262

Query  339  ----ERPSKKQKVSAEAAAFTQPDAMLS  268
                ERP KKQ+  A+  AFT+P+ +L+
Sbjct  263  ESPSERPGKKQRGRAD-VAFTKPEMVLT  289



>ref|XP_012082209.1| PREDICTED: myb family transcription factor APL isoform X1 [Jatropha 
curcas]
Length=335

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 153/226 (68%), Gaps = 35/226 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P +  +        
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLVEVPGAGASG-------  196

Query  498  APVSDNS------TNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC  349
             P+S +S      T+P TP P SE P  E    +R P K +S++ S SSH+E L+PDS C
Sbjct  197  -PISGDSCPESDKTDPATPAPTSESPIQEKAAKERAPDKSLSIDESFSSHHEPLTPDSRC  255

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSH  238
                    P  ER  KKQ+V   A A+ +P+ +L+ ++L  SL S+
Sbjct  256  NVGSPAESPKGERSMKKQRVCM-ATAYAKPEMVLTHQILESSLNSY  300



>ref|XP_008384340.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Malus domestica]
Length=306

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 144/209 (69%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+  D++S LD SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKEPGDVLSNLDGSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG     + +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLVRLSSDN  171

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SS  E L+PDS C      
Sbjct  172  CPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSRREPLTPDSVCHVGSPA  231

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER +KK++V+    AF+ P+ +L+
Sbjct  232  ESPKAERLTKKRRVNI-GEAFSDPEVVLT  259



>ref|XP_002525238.1| transcription factor, putative [Ricinus communis]
 gb|EEF37204.1| transcription factor, putative [Ricinus communis]
Length=336

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 140/194 (72%), Gaps = 20/194 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P  + A +  +G+N
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLGEVP-GAVAAAPVSGDN  202

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  +    +R P K +S++ S SS +E L+PDS C      
Sbjct  203  CPESDNKTDPATPAPTSESPIQDKAAKERAPAKSLSIDESFSSRHEPLTPDSRCNVGSPA  262

Query  348  --PAVERPSKKQKV  313
              P  ER  KKQ+V
Sbjct  263  ESPKGERSMKKQRV  276



>emb|CAN66505.1| hypothetical protein VITISV_035498 [Vitis vinifera]
Length=306

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 149/224 (67%), Gaps = 33/224 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+S D++S LD SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKESGDMLSSLDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P         +G +
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVITEVP--------GSGVS  165

Query  498  APVS-DNS-----TNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC  349
             PVS DN      T+P TP P SE P      ++  P K +S++ S SSH+E L+PDS C
Sbjct  166  VPVSGDNCLESDKTDPATPAPTSEGPLLDKAAKETAPAKSLSIDESFSSHHEPLTPDSGC  225

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTS  241
                    P  ER  KKQ+VS  AA   Q   +  ++L  SL+S
Sbjct  226  HVNSPXESPKGERSVKKQRVSIGAAYAKQEMVLTHQILESSLSS  269



>ref|XP_006449962.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
 gb|ESR63202.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
Length=330

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 143/211 (68%), Gaps = 25/211 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDMLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  200

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  201  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  260

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER +KKQ+V  E  A+ +P+ +L+
Sbjct  261  PSQSPKGERSTKKQRVDME-TAYAKPEMVLT  290



>ref|XP_008224666.1| PREDICTED: myb family transcription factor APL isoform X2 [Prunus 
mume]
 ref|XP_008224667.1| PREDICTED: myb family transcription factor APL isoform X2 [Prunus 
mume]
 ref|XP_008224668.1| PREDICTED: myb family transcription factor APL isoform X2 [Prunus 
mume]
Length=303

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 135/209 (65%), Gaps = 24/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKEPGDVLSNLDGSS---GMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVRSEAP-GSGHLARLSDDN  168

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K +S++ S SSH+E L+PDS+C      
Sbjct  169  CPESDNKTDPATPAPTSECPLQDKAAKECTPAKSLSIDESFSSHHEPLTPDSACQVDSPA  228

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER  KK++V     AF  P+ +L+
Sbjct  229  ESPKAERSMKKRRVIM-GEAFADPEVVLT  256



>ref|XP_002272588.2| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Vitis vinifera]
 ref|XP_010647085.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Vitis vinifera]
 ref|XP_010647086.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Vitis vinifera]
 ref|XP_010647087.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Vitis vinifera]
Length=336

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 149/224 (67%), Gaps = 33/224 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+S D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKESGDMLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P         +G +
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVITEVP--------GSGVS  195

Query  498  APVS-DNS-----TNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC  349
             PVS DN      T+P TP P SE P      ++  P K +S++ S SSH+E L+PDS C
Sbjct  196  VPVSGDNCLESDKTDPATPAPTSEGPLLDKAAKETAPAKSLSIDESFSSHHEPLTPDSGC  255

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTS  241
                    P  ER  KKQ+VS  AA   Q   +  ++L  SL+S
Sbjct  256  HVNSPDESPKGERSVKKQRVSIGAAYAKQEMVLTHQILESSLSS  299



>ref|XP_006467243.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Citrus sinensis]
Length=330

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 143/211 (68%), Gaps = 25/211 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDMLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  200

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  201  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  260

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER +KKQ+V  E  A+ +P+ +L+
Sbjct  261  PSQSPKGERSTKKQRVDME-TAYAKPEMVLT  290



>ref|XP_007211673.1| hypothetical protein PRUPE_ppa009121mg [Prunus persica]
 gb|EMJ12872.1| hypothetical protein PRUPE_ppa009121mg [Prunus persica]
Length=306

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 144/209 (69%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+  D++S LD SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKEPGDVLSNLDGSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  +  + +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVHSEAP-GSGHLARLSDDN  171

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K +S++ S SS +E L+PDS+C      
Sbjct  172  CPESDNKTDPATPAPTSECPLEDKAAKECTPAKSLSIDESFSSRHEPLTPDSACHVDSPA  231

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  E   KK++V     AFT P+ +L+
Sbjct  232  ESPKAEVSMKKRRVIM-GEAFTDPEVVLT  259



>gb|KDO78616.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
 gb|KDO78617.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
 gb|KDO78618.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
 gb|KDO78619.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
 gb|KDO78620.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
Length=330

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 142/211 (67%), Gaps = 25/211 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDMLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  200

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  201  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  260

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER  KKQ+V  E  A+ +P+ +L+
Sbjct  261  PSQSPKGERSMKKQRVDME-TAYAKPEMVLT  290



>ref|XP_012082210.1| PREDICTED: myb family transcription factor APL isoform X2 [Jatropha 
curcas]
Length=332

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 142/226 (63%), Gaps = 38/226 (17%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKETGDMLSNLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P +  +        
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLVEVPGAGASG-------  193

Query  498  APVSDNS------TNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC  349
             P+S +S      T+P TP P SE P  E    +R P K +S++ S SSH+E L+PDS C
Sbjct  194  -PISGDSCPESDKTDPATPAPTSESPIQEKAAKERAPDKSLSIDESFSSHHEPLTPDSRC  252

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSH  238
                    P  ER  KKQ+V   A A+ +P+ +L+ ++L  SL S+
Sbjct  253  NVGSPAESPKGERSMKKQRVCM-ATAYAKPEMVLTHQILESSLNSY  297



>ref|XP_011040091.1| PREDICTED: myb family transcription factor APL-like isoform X4 
[Populus euphratica]
Length=265

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 18/218 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S  D SSGMQITEALKL
Sbjct  16   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDVLSNSDGSSGMQITEALKL  73

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG ++  +G+  
Sbjct  74   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDYC  133

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P +DN T+P TP P +E P  +    +  P K +S++ S SS +E L+PDS C       
Sbjct  134  PEADNKTDPATPAPTAESPLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAE  193

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ VS   A   Q   +  ++L  SL S+
Sbjct  194  SPRGERSLKKQMVSMGVAFGKQEMVLTHQILESSLNSY  231



>ref|XP_008384341.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Malus domestica]
Length=303

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 134/209 (64%), Gaps = 24/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKEPGDVLSNLDGSS---GMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG     + +N
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GSGHLVRLSSDN  168

Query  498  APVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P SE P  ++      P K IS++ S SS  E L+PDS C      
Sbjct  169  CPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSRREPLTPDSVCHVGSPA  228

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P  ER +KK++V+    AF+ P+ +L+
Sbjct  229  ESPKAERLTKKRRVNI-GEAFSDPEVVLT  256



>ref|XP_009602574.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602575.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602576.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602577.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602578.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602579.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
 ref|XP_009602580.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
Length=295

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 133/209 (64%), Gaps = 25/209 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S       K+    + S    S+G+QI EALK
Sbjct  48   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNSDKKESGDMLSSLDGSSAGVQINEALK  105

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P  SG T + AGE
Sbjct  106  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVP-VSGVTPSPAGE  164

Query  501  nAPVSDNSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC-----  349
            N P SDN T+P TP P SE P      ++  P K +S++ S SS +E L+PDS C     
Sbjct  165  NGPESDNRTDPGTPAPTSEYPLVDKPVQEHAPTKSLSIDQSFSSQHEPLTPDSGCRETSP  224

Query  348  ---PAVERPSKKQKVSAEAAAFTQPDAML  271
               P  ER SKKQ+V     AFT+ D +L
Sbjct  225  INSPKGERSSKKQRV----GAFTKADMLL  249



>ref|XP_009615786.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
tomentosiformis]
Length=333

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 154/219 (70%), Gaps = 22/219 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK+S D++S LD SSG++IT ALKL
Sbjct  85   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKESRDMLSSLDGSSGVEITTALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYLKKIIEEQQ+L     E+P  SG T+   G+N
Sbjct  143  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVP-GSGVTAPPTGDN  201

Query  498  APVSDNSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSCPAV---  340
             P SDN + P TP P SE P  E+      P K +S++ S S  +E L+PDS CP     
Sbjct  202  GPESDNRSEPGTPAPTSESPNVEKHVKAHAPTKSLSVDESFSLQHEPLTPDSDCPESSPM  261

Query  339  -----ERPSKKQKVSAEAAAFTQPD-AMLSKLLG*SLTS  241
                 ER SKKQ+V A +AAF + D A+  ++L  SL+S
Sbjct  262  ESPNGERSSKKQRV-ATSAAFAKDDVALTHQILESSLSS  299



>ref|XP_011040090.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Populus euphratica]
Length=314

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 18/218 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S  D SSGMQITEALKL
Sbjct  65   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDVLSNSDGSSGMQITEALKL  122

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG ++  +G+  
Sbjct  123  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDYC  182

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P +DN T+P TP P +E P  +    +  P K +S++ S SS +E L+PDS C       
Sbjct  183  PEADNKTDPATPAPTAESPLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAE  242

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ VS   A   Q   +  ++L  SL S+
Sbjct  243  SPRGERSLKKQMVSMGVAFGKQEMVLTHQILESSLNSY  280



>ref|XP_011040088.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Populus euphratica]
Length=335

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 18/218 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S  D SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDVLSNSDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG ++  +G+  
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDYC  203

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P +DN T+P TP P +E P  +    +  P K +S++ S SS +E L+PDS C       
Sbjct  204  PEADNKTDPATPAPTAESPLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAE  263

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ VS   A   Q   +  ++L  SL S+
Sbjct  264  SPRGERSLKKQMVSMGVAFGKQEMVLTHQILESSLNSY  301



>emb|CCA29113.1| putative MYB transcription factor [Rosa hybrid cultivar]
Length=304

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 152/222 (68%), Gaps = 24/222 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDG K DKK+  D++S +D SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGGKADKKEPGDMLSNVDGSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P   G ++ ++ +N
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GPGNSTRASDDN  171

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSS-HNEALSPDSSC-----  349
             P SD   +P TP P SE P  +    +R P K +S++ S SS H+E  +PDS C     
Sbjct  172  CPESDK-VDPATPAPTSECPIQDKAIKERAPAKSLSVDESCSSRHDEPSTPDSGCHVISP  230

Query  348  ---PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSHQ  235
               P  ER +KKQ+ S    AF+ P+ +L+ ++L  SL S+Q
Sbjct  231  AESPKAERLTKKQRFSM-GEAFSNPEVVLTHQILESSLNSYQ  271



>ref|XP_009374808.1| PREDICTED: myb family transcription factor APL isoform X3 [Pyrus 
x bretschneideri]
Length=299

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 109/159 (69%), Gaps = 19/159 (12%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  S
Sbjct  96   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GS  154

Query  528  gatsasagenAPVSDNSTNPVTPVPASEKPENEQRN----PVKGISLNASPSSHNEALSP  361
            G  +  + +N P SDN T+P TP P SE P  ++      P K IS++ S SSH E L+P
Sbjct  155  GHLARLSSDNCPESDNKTDPATPAPTSECPLQDKAAKECVPAKSISIDESFSSHREPLTP  214

Query  360  DSSC--------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
            DS C        P VER +KK++V+    AFT P+A+L+
Sbjct  215  DSGCHVGSPAESPKVERLTKKRRVNI-GEAFTDPEAVLT  252



>ref|XP_006449961.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
 ref|XP_006449963.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
 gb|ESR63201.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
 gb|ESR63203.1| hypothetical protein CICLE_v10015893mg [Citrus clementina]
Length=327

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 132/211 (63%), Gaps = 28/211 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDVDKKETGDMLSSLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  197

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  198  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  257

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER +KKQ+V  E  A+ +P+ +L+
Sbjct  258  PSQSPKGERSTKKQRVDME-TAYAKPEMVLT  287



>ref|XP_010647088.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Vitis vinifera]
Length=333

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 138/224 (62%), Gaps = 36/224 (16%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKESGDMLSSLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P         +G +
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVITEVP--------GSGVS  192

Query  498  APVS-DNS-----TNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC  349
             PVS DN      T+P TP P SE P      ++  P K +S++ S SSH+E L+PDS C
Sbjct  193  VPVSGDNCLESDKTDPATPAPTSEGPLLDKAAKETAPAKSLSIDESFSSHHEPLTPDSGC  252

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTS  241
                    P  ER  KKQ+VS  AA   Q   +  ++L  SL+S
Sbjct  253  HVNSPDESPKGERSVKKQRVSIGAAYAKQEMVLTHQILESSLSS  296



>ref|XP_006467244.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Citrus sinensis]
 ref|XP_006467245.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Citrus sinensis]
Length=327

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 132/211 (63%), Gaps = 28/211 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDVDKKETGDMLSSLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  197

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  198  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  257

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER +KKQ+V  E  A+ +P+ +L+
Sbjct  258  PSQSPKGERSTKKQRVDME-TAYAKPEMVLT  287



>ref|XP_006380857.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
 ref|XP_006380859.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
 gb|ERP58654.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
 gb|ERP58656.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
Length=335

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 143/220 (65%), Gaps = 23/220 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D+IS LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMISNLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L            +G  APVS 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLEDVPGSGVTAPVSG  200

Query  486  DNS-----TNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-----  349
            DN      T+P TP P SE P  +    +R P K +S++ S SS  E L+PDS C     
Sbjct  201  DNCPESDKTDPATPAPTSESPLQDKAAKERAPAKSLSIDESFSSQPEPLTPDSRCNAGSP  260

Query  348  ---PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
               P  ER  KKQ+VS       Q   +  ++L  SL S+
Sbjct  261  AESPRGERSMKKQRVSIGVTYGKQEMVLTHQILESSLNSY  300



>ref|XP_009787053.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
sylvestris]
Length=334

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 144/209 (69%), Gaps = 21/209 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK+S D++S LD SSG++IT ALKL
Sbjct  85   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKESRDMLSSLDGSSGVEITTALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYLKKIIEEQQ+L     E+P  SG  +   G+N
Sbjct  143  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVP-GSGVAAPPTGDN  201

Query  498  APVSDNSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSCPAV---  340
             P SDN ++P TP P SE P  E+      P K +S++ S S  +E L+PDS CP     
Sbjct  202  GPESDNRSDPGTPAPTSESPNVEKHVKAHAPTKSLSVDESFSLQHEPLTPDSDCPESSPL  261

Query  339  -----ERPSKKQKVSAEAAAFTQPDAMLS  268
                 ER SKK +V    AAF + D  L+
Sbjct  262  ESPNGERSSKKHRVGTN-AAFAKDDVALT  289



>ref|XP_006349121.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349122.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Solanum tuberosum]
Length=324

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 137/194 (71%), Gaps = 20/194 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGK  DKK+  D++S LD SSG++IT ALKL
Sbjct  83   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNSDKKEPRDMLSSLDGSSGVEITTALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYLKKIIEEQQ+L     E+P  SG T+   G+N
Sbjct  141  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVP-GSGVTALPTGDN  199

Query  498  APVSDNSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSC------  349
             P SDN T+P TP P+SE P  ++        K +S++ S SSH+  LSPDS C      
Sbjct  200  GPESDNRTDPGTPAPSSESPHVDKPVKAHTSTKSLSMDESFSSHHSPLSPDSDCQETSLM  259

Query  348  --PAVERPSKKQKV  313
              P  ER SKKQ+V
Sbjct  260  ESPNGERSSKKQRV  273



>ref|XP_004293430.1| PREDICTED: uncharacterized protein LOC101309129 [Fragaria vesca 
subsp. vesca]
Length=303

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 146/219 (67%), Gaps = 19/219 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S+DG K DKK+  D++S +D SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSADGGKADKKEPGDMLSNVDSSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L   + E  G  +  A  +   
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEGPGPGNTLASGDNCR  172

Query  489  SDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSS-HNEALSPDSSC--------  349
              +  +P TP P SE P  +    +R P K +S++ S SS H+E  +PDS C        
Sbjct  173  ESDKVDPATPAPTSECPIQDKAIKERAPAKSLSIDESCSSRHDEPSTPDSGCHVISPAES  232

Query  348  PAVERPSKKQKVSAEAAAFTQPDAMLS-KLLG*SLTSHQ  235
            P  ER  KKQK S    AF+ P+ +L+ ++L  SL S+Q
Sbjct  233  PDAERSLKKQKFSM-GEAFSNPEVVLTHQILESSLNSYQ  270



>gb|KDO78615.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
Length=328

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 136/211 (64%), Gaps = 27/211 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKVDKKETGDMLSSLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQK      +++RQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  144  QMEVQK--RLHEQLERQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  198

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  199  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  258

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER  KKQ+V  E  A+ +P+ +L+
Sbjct  259  PSQSPKGERSMKKQRVDME-TAYAKPEMVLT  288



>gb|KDO78614.1| hypothetical protein CISIN_1g020124mg [Citrus sinensis]
Length=327

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 131/211 (62%), Gaps = 28/211 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDVDKKETGDMLSSLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L         +  +G +AP S 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLTEAPGSGGSAPASG  197

Query  486  ------DNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC----  349
                  D  T+P TP P SE P  +    +  P K +SL+ S SS NE L+PDS C    
Sbjct  198  DNCQEPDKKTDPATPAPTSESPLQDKAAKEHVPAKSLSLDESFSSQNEPLTPDSGCNVSS  257

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                P  ER  KKQ+V  E  A+ +P+ +L+
Sbjct  258  PSQSPKGERSMKKQRVDME-TAYAKPEMVLT  287



>ref|XP_011005787.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Populus euphratica]
 ref|XP_011005788.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Populus euphratica]
 ref|XP_011005790.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Populus euphratica]
Length=333

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 147/218 (67%), Gaps = 19/218 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D+IS LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDVISNLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG  + ++G+N 
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVAAPASGDNC  203

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P SD  T+P TP P SE P  +    +R P K +S++ S SS  E L+PDS C       
Sbjct  204  PESDK-TDPATPAPTSESPLQDKAAKERAPAKSLSIDESFSSQPEPLTPDSRCNAGSPAE  262

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ+VS       Q   +  ++L  SL S+
Sbjct  263  SPRGERSIKKQRVSMGVTYGKQEMVLTHQILESSLNSY  300



>ref|XP_010096513.1| Myb family transcription factor APL [Morus notabilis]
 gb|EXB64633.1| Myb family transcription factor APL [Morus notabilis]
Length=334

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 142/209 (68%), Gaps = 22/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+ SDGKK DKK+  D +S LD SSGMQITEALKL
Sbjct  85   VQGLTIYHVKS--HLQKYRLAKYLPDSLSDGKKVDKKEPGDALSNLDGSSGMQITEALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  +  ++ + G+N
Sbjct  143  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETP-GTELSAPAVGDN  201

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC------  349
             P SD  T P TP P SE P  +    +R   K +S++ S SSH+E  +PDSSC      
Sbjct  202  HPESDK-TEPATPAPTSEAPLQDKTAKERTAAKSLSVDESLSSHHEPSTPDSSCHVGSPS  260

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAMLS  268
              P   R +KKQ+V+    A  +PD +L+
Sbjct  261  ESPNGGRSAKKQRVNT-GGASGKPDLVLT  288



>ref|NP_973385.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
 gb|AEC05392.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
Length=237

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 140/204 (69%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  3    VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV+ 
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVTG  112

Query  483  NSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC--------PAV  340
            +S +P TP P SE P  ++      P K +S++ S SS+ E L+PDS C           
Sbjct  113  DS-DPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESTGE  171

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD ++ 
Sbjct  172  ERLSKKPRLVRGAAGYT-PDIVVG  194



>ref|XP_009776486.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
sylvestris]
 ref|XP_009776487.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
sylvestris]
 ref|XP_009776488.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
sylvestris]
 ref|XP_009776490.1| PREDICTED: myb family transcription factor APL-like [Nicotiana 
sylvestris]
Length=296

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 129/210 (61%), Gaps = 27/210 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S       K+    + S    S+G+QI EALK
Sbjct  48   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNSDKKESGDMLSSLDGSSAGVQINEALK  105

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P      +  A E
Sbjct  106  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVP--VSGVTPPAAE  163

Query  501  nAPVSDNSTNPVTPVPASEKP----ENEQRNPVKGISLNAS-PSSHNEALSPDSSC----  349
            N P SDN T+P TP P SE P      ++  P K +S++ S  SS +E L+PDS C    
Sbjct  164  NGPESDNRTDPGTPAPTSESPLVDKPVQEHAPTKSLSIDQSFSSSQHEPLTPDSGCRETS  223

Query  348  ----PAVERPSKKQKVSAEAAAFTQPDAML  271
                P  ER SKKQ+V     AFT+ D +L
Sbjct  224  PINSPEGERSSKKQRV----CAFTKADTLL  249



>ref|XP_002876730.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52989.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=286

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 141/204 (69%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVTG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
            +S +P TP P SE P      ++  P K +S++ S SS+ E L+PDS C           
Sbjct  162  DS-DPATPAPTSESPLQDKSGKECGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESGGE  220

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD +++
Sbjct  221  ERLSKKPRLVRGAAGYT-PDIVVA  243



>ref|XP_010424838.1| PREDICTED: uncharacterized protein LOC104710011 [Camelina sativa]
 ref|XP_010424839.1| PREDICTED: uncharacterized protein LOC104710011 [Camelina sativa]
Length=286

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 140/204 (69%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVTG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
             S +P TP P SE P      ++  P K +S++ S SS+ E L+PDS C           
Sbjct  162  ES-DPATPAPTSESPLQDKSGKECGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESGGD  220

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD +++
Sbjct  221  ERTSKKPRLVRGAAGYT-PDIVVA  243



>gb|EYU27618.1| hypothetical protein MIMGU_mgv1a010952mg [Erythranthe guttata]
 gb|EYU27619.1| hypothetical protein MIMGU_mgv1a010952mg [Erythranthe guttata]
Length=296

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 126/175 (72%), Gaps = 18/175 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK + K+S DI+SGLD SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKAENKESGDILSGLDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P           + 
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLPEAP------GTEDNKI  167

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSS-HNEALSPDSSC  349
             P SDN T+P TP P SE P ++    +   VK +SL+ S SS H+E L+PDS C
Sbjct  168  CPESDNKTDPATPAPTSESPFSDKPPKEHTLVKSLSLDESFSSHHHEPLTPDSDC  222



>ref|NP_178216.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
 gb|AAK48977.1|AF370550_1 transfactor-like protein [Arabidopsis thaliana]
 gb|AAF18654.1| transfactor-like protein [Arabidopsis thaliana]
 gb|AAM61299.1| transfactor-like protein [Arabidopsis thaliana]
 gb|AAN15332.1| transfactor-like protein [Arabidopsis thaliana]
 gb|AEC05393.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
Length=286

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 140/204 (69%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVTG  161

Query  483  NSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSC--------PAV  340
            +S +P TP P SE P  ++      P K +S++ S SS+ E L+PDS C           
Sbjct  162  DS-DPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESTGE  220

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD ++ 
Sbjct  221  ERLSKKPRLVRGAAGYT-PDIVVG  243



>ref|XP_010502053.1| PREDICTED: protein PHR1-LIKE 1-like [Camelina sativa]
 ref|XP_010502054.1| PREDICTED: protein PHR1-LIKE 1-like [Camelina sativa]
Length=287

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 140/204 (69%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  53   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKL  110

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV+ 
Sbjct  111  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVTG  162

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
             S +P TP P SE P      ++  P K +S++ S SS+ E L+PDS C           
Sbjct  163  ES-DPATPAPTSESPLQDKSGKECGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESGGD  221

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD +++
Sbjct  222  ERSSKKPRLVRGAAGYT-PDIVVA  244



>ref|XP_011040089.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Populus euphratica]
Length=332

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 135/218 (62%), Gaps = 21/218 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D      G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDVDKKETGDVLSNSDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG ++  +G+  
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDYC  200

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P +DN T+P TP P +E P  +    +  P K +S++ S SS +E L+PDS C       
Sbjct  201  PEADNKTDPATPAPTAESPLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAE  260

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ VS   A   Q   +  ++L  SL S+
Sbjct  261  SPRGERSLKKQMVSMGVAFGKQEMVLTHQILESSLNSY  298



>ref|NP_001275151.1| myb family transcription factor APL-like [Solanum tuberosum]
 ref|XP_006350320.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Solanum tuberosum]
 dbj|BAE46413.1| MYB-CC type transfactor [Solanum tuberosum]
Length=306

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 128/209 (61%), Gaps = 22/209 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S   +   K+    + S    S+G+QI EALK
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKQSDKKESGDMLSSLDGSSTGVQINEALK  113

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P S    SA+   
Sbjct  114  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVPVSGVTPSAAGDN  173

Query  501  nAPVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSCPAV--  340
                SDN T+P TP P SE P  +    +    K +S++ S SS +E L+PDS C     
Sbjct  174  GVD-SDNRTDPGTPAPTSESPHIDTSVQEHARSKSLSIDQSFSSQHEPLTPDSGCRETSP  232

Query  339  ------ERPSKKQKVSAEAAAFTQPDAML  271
                  ER SKKQ+V   +A FT+ D +L
Sbjct  233  INSSEGERSSKKQRVGT-SATFTKADMLL  260



>gb|AFK37251.1| unknown [Lotus japonicus]
Length=321

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 137/205 (67%), Gaps = 31/205 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  88   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  145

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P            
Sbjct  146  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVFSEAPADVCREP-----  200

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T+P TP P  EK   +Q  P K +S+  S SSH+E ++PDS+C        P
Sbjct  201  -----DNKTDPATPDP--EKAA-KQHAPAKSLSIE-SFSSHHEPMTPDSACHVGSPADSP  251

Query  345  AVERPSKKQKVSAEAAAFTQPDAML  271
              ER +KKQ+VS +  A+++PD +L
Sbjct  252  KEERSAKKQRVSMD-GAYSKPDIVL  275



>gb|KJB68479.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
Length=252

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 138/207 (67%), Gaps = 20/207 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK++ D++S LD SSGMQITEALKL
Sbjct  3    VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKETGDMLSNLDGSSGMQITEALKL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQ----QLEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQ+      E P +  +  A      
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQRLGGVLAEAPGTGASVPALGDNGL  120

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
              SD  T+P TP P SE P  +    +    K  S++ S SSH+E L+PDS C       
Sbjct  121  E-SDKKTDPATPAPTSESPLQDKAAKEGTSAKSHSVDESFSSHHEPLTPDSGCHVGSPAG  179

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAML  271
             P  E   KKQ+VS  A AF +P+ +L
Sbjct  180  SPKGEMLKKKQRVSM-AGAFAKPEMVL  205



>ref|XP_006291618.1| hypothetical protein CARUB_v10017769mg [Capsella rubella]
 gb|EOA24516.1| hypothetical protein CARUB_v10017769mg [Capsella rubella]
Length=286

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 139/204 (68%), Gaps = 24/204 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S++GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSAEGKKIDKKESGDMLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      +APV  
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSAPVIG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
             S +P TP P SE P      ++  P K +S++ S SS+ E L+PDS C           
Sbjct  162  ES-DPATPAPTSESPLQDKSGKECGPDKSLSVDESLSSYREPLTPDSGCNIGSQDESGGE  220

Query  339  ERPSKKQKVSAEAAAFTQPDAMLS  268
            ER SKK ++   AA +T PD +++
Sbjct  221  ERSSKKPRLVRSAAGYT-PDIVVA  243



>ref|XP_008440942.1| PREDICTED: protein PHR1-LIKE 1-like [Cucumis melo]
 ref|XP_008440943.1| PREDICTED: protein PHR1-LIKE 1-like [Cucumis melo]
 ref|XP_008440944.1| PREDICTED: protein PHR1-LIKE 1-like [Cucumis melo]
Length=270

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 146/205 (71%), Gaps = 17/205 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKKDSSDI+S +D SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKTDKKDSSDILSNIDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE-----MPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       P +S  T+ ++G+N
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQKLSGVLSGAPAASAFTAPASGDN  173

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSCPA----  343
             P +D + +P TP   SE P  E    +R   K +S++ S SSH+E L+PDS C +    
Sbjct  174  CPEADKN-DPPTPASTSEFPRQEKVSKERAQGKSVSIDDSFSSHHEPLTPDSGCHSSPSE  232

Query  342  VERPSKKQKVSAEAAAFTQPDAMLS  268
              RP KKQ+   +  AF + + +L+
Sbjct  233  SARPVKKQRQDMD-GAFAKSEMILA  256



>ref|XP_010252934.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Nelumbo nucifera]
Length=338

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 147/228 (64%), Gaps = 19/228 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLP+++SD KK +KK+ S+++S +  SSGMQITEALKL
Sbjct  89   VQGLTIYHVKS--HLQKYRLAKYLPESTSDVKKSEKKEPSELLSTISSSSGMQITEALKL  146

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsa---sagenAP  493
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L               +G N P
Sbjct  147  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGFLGESNLMIPPPISGSNFP  206

Query  492  VSDNSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------  349
             SD  T+P TP P SE P      ++  P K +S N S SS++E L+PDS C        
Sbjct  207  ESDK-TDPSTPAPTSECPLQNKAAQECAPAKSLSCNESISSYHEPLTPDSVCHVTSPSES  265

Query  348  PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQIRARVSGWQV  205
            P  ERP K+++V  +A +  +P+ +L+  +  S  S   +   SG+ +
Sbjct  266  PKGERPLKQKRVGMDAVS-AKPEMILTHQILESSLSSSFQQPCSGFPI  312



>ref|XP_010252929.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010252930.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010252931.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010252932.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010252933.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera]
Length=364

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 147/228 (64%), Gaps = 19/228 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLP+++SD KK +KK+ S+++S +  SSGMQITEALKL
Sbjct  115  VQGLTIYHVKS--HLQKYRLAKYLPESTSDVKKSEKKEPSELLSTISSSSGMQITEALKL  172

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsa---sagenAP  493
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L               +G N P
Sbjct  173  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGFLGESNLMIPPPISGSNFP  232

Query  492  VSDNSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------  349
             SD  T+P TP P SE P      ++  P K +S N S SS++E L+PDS C        
Sbjct  233  ESDK-TDPSTPAPTSECPLQNKAAQECAPAKSLSCNESISSYHEPLTPDSVCHVTSPSES  291

Query  348  PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQIRARVSGWQV  205
            P  ERP K+++V  +A +  +P+ +L+  +  S  S   +   SG+ +
Sbjct  292  PKGERPLKQKRVGMDAVS-AKPEMILTHQILESSLSSSFQQPCSGFPI  338



>gb|KJB68480.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
Length=336

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 138/207 (67%), Gaps = 20/207 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK++ D++S LD SSGMQITEALKL
Sbjct  87   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKETGDMLSNLDGSSGMQITEALKL  144

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQ----QLEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQ+      E P +  +  A      
Sbjct  145  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQRLGGVLAEAPGTGASVPALGDNGL  204

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
              SD  T+P TP P SE P  +    +    K  S++ S SSH+E L+PDS C       
Sbjct  205  E-SDKKTDPATPAPTSESPLQDKAAKEGTSAKSHSVDESFSSHHEPLTPDSGCHVGSPAG  263

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAML  271
             P  E   KKQ+VS  A AF +P+ +L
Sbjct  264  SPKGEMLKKKQRVSM-AGAFAKPEMVL  289



>gb|KJB68475.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
 gb|KJB68476.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
 gb|KJB68481.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
Length=333

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 138/207 (67%), Gaps = 20/207 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK++ D++S LD SSGMQITEALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKETGDMLSNLDGSSGMQITEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQ----QLEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQ+      E P +  +  A      
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQRLGGVLAEAPGTGASVPALGDNGL  201

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
              SD  T+P TP P SE P  +    +    K  S++ S SSH+E L+PDS C       
Sbjct  202  E-SDKKTDPATPAPTSESPLQDKAAKEGTSAKSHSVDESFSSHHEPLTPDSGCHVGSPAG  260

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAML  271
             P  E   KKQ+VS  A AF +P+ +L
Sbjct  261  SPKGEMLKKKQRVSM-AGAFAKPEMVL  286



>ref|XP_004250431.1| PREDICTED: myb family transcription factor APL-like [Solanum 
lycopersicum]
 ref|XP_010312875.1| PREDICTED: myb family transcription factor APL-like [Solanum 
lycopersicum]
 ref|XP_010312876.1| PREDICTED: myb family transcription factor APL-like [Solanum 
lycopersicum]
Length=303

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 127/209 (61%), Gaps = 25/209 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S   +   K+    + S    S+G+QI EALK
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKQSDKKESGDMLSSLDGSSTGVQINEALK  113

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P+S    SA+   
Sbjct  114  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEVPDSGVTPSAAGDN  173

Query  501  nAPVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSCPAV--  340
                SDN T+P TP P SE P  +    +    K +S++ S SS +E L+PDS C     
Sbjct  174  GLD-SDNRTDPGTPAPTSESPHIDTSVQEHGRSKSLSIDQSFSSQHEPLTPDSGCRETSP  232

Query  339  ------ERPSKKQKVSAEAAAFTQPDAML  271
                  ER SKKQ+V      FT+ D +L
Sbjct  233  INSSEGERSSKKQRV----GTFTKADMLL  257



>ref|XP_006380858.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
 gb|ERP58655.1| hypothetical protein POPTR_0006s00290g [Populus trichocarpa]
Length=332

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 132/220 (60%), Gaps = 26/220 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKETGDMISNLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS-  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L            +G  APVS 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLEDVPGSGVTAPVSG  197

Query  486  DNS-----TNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-----  349
            DN      T+P TP P SE P  +    +R P K +S++ S SS  E L+PDS C     
Sbjct  198  DNCPESDKTDPATPAPTSESPLQDKAAKERAPAKSLSIDESFSSQPEPLTPDSRCNAGSP  257

Query  348  ---PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
               P  ER  KKQ+VS       Q   +  ++L  SL S+
Sbjct  258  AESPRGERSMKKQRVSIGVTYGKQEMVLTHQILESSLNSY  297



>ref|XP_011005791.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Populus euphratica]
Length=330

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 136/218 (62%), Gaps = 22/218 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD  K +  D    + G     GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDADKKETGDVISNLDGSS---GMQITEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQ----LEMPessgatsasagenA  496
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+    LE    SG  + ++G+N 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVAAPASGDNC  200

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
            P SD  T+P TP P SE P  +    +R P K +S++ S SS  E L+PDS C       
Sbjct  201  PESDK-TDPATPAPTSESPLQDKAAKERAPAKSLSIDESFSSQPEPLTPDSRCNAGSPAE  259

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSH  238
             P  ER  KKQ+VS       Q   +  ++L  SL S+
Sbjct  260  SPRGERSIKKQRVSMGVTYGKQEMVLTHQILESSLNSY  297



>emb|CBI25862.3| unnamed protein product [Vitis vinifera]
Length=257

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 131/195 (67%), Gaps = 25/195 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK+S D++S LD SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKESGDMLSSLDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L                     
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVI-----------------  156

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSCPAVERPSKKQK  316
              T+P TP P SE P      ++  P K +S++ S SSH+E L+PDS C  V   + +  
Sbjct  157  TETDPATPAPTSEGPLLDKAAKETAPAKSLSIDESFSSHHEPLTPDSGCHMV--LTHQIL  214

Query  315  VSAEAAAFTQPDAML  271
             S+ +++F QP ++ 
Sbjct  215  ESSLSSSFHQPHSVF  229



>ref|XP_010524219.1| PREDICTED: uncharacterized protein LOC104802358 [Tarenaya hassleriana]
 ref|XP_010524220.1| PREDICTED: uncharacterized protein LOC104802358 [Tarenaya hassleriana]
 ref|XP_010524221.1| PREDICTED: uncharacterized protein LOC104802358 [Tarenaya hassleriana]
 ref|XP_010524222.1| PREDICTED: uncharacterized protein LOC104802358 [Tarenaya hassleriana]
Length=337

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 136/204 (67%), Gaps = 18/204 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK +KK+S D++SGLD SSG QITEALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTEKKESGDMLSGLDGSSGTQITEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        ++   G+N P  D
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSG-VLGEPSAQGTGDNFPERD  200

Query  483  NSTNPVTPVPASEKPENEQRNPVKG----ISLNASPSSHNEALSPDSSC----------P  346
            N+ +PVTP P SE P  E      G    +S++ S SS+ E L+PDS C           
Sbjct  201  NNNDPVTPAPTSESPIQENSGKEGGQEKSLSVDESLSSYREPLTPDSGCNYDSTHESPRG  260

Query  345  AVERPSKKQKVSAEAAAFTQPDAM  274
              ER SKK ++ A  A    PD +
Sbjct  261  EEERSSKKPRL-ARGAVGDSPDVV  283



>ref|XP_003594372.1| Two-component response regulator EHD1 [Medicago truncatula]
Length=300

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 137/217 (63%), Gaps = 20/217 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDCSSDEGKKTDKKETGDMLSNLDGSSGMQITEALK  113

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  +       
Sbjct  114  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGVSAPTPGDM  173

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T P TP P  EK   E   P K +S   S SSH+E ++PDS C        P
Sbjct  174  FQQELDNKTEPATPDP--EKAAKEH-APAKSLSAE-SFSSHHEPMTPDSGCQVGSPADSP  229

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
              ER +KKQ+VS E A       +  ++L  S+ S+Q
Sbjct  230  NGERSTKKQRVSVEGAYLKSDMVLPHQILESSMPSYQ  266



>ref|XP_009107092.1| PREDICTED: protein PHR1-LIKE 1-like [Brassica rapa]
Length=284

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 135/198 (68%), Gaps = 24/198 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDVLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        + A    + PV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGALGEPSGPVTG  161

Query  483  NSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSPDSSCPAV--------  340
             S +P TP P SE P  ++      P K +S++ S S + E L+PDS C A         
Sbjct  162  ES-DPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSPYREPLTPDSGCNAGSQDESAGE  220

Query  339  ERPSKKQK-VSAEAAAFT  289
            ER SKK + V   AA +T
Sbjct  221  ERSSKKPRLVRGGAAGYT  238



>gb|KCW75471.1| hypothetical protein EUGRSUZ_E04232 [Eucalyptus grandis]
Length=246

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 130/194 (67%), Gaps = 17/194 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLPD+SSDGK  +KKDS+DI S  D SSGMQITEALKL
Sbjct  3    VPGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNAEKKDSADIASNTDGSSGMQITEALKL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+           SD
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLTDGSGLGDDCLE---SD  117

Query  483  NSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
              ++P TP P SE P  E+      P K  S++ S SSH+E  +PDS C        P  
Sbjct  118  KKSDPATPAPTSECPLQEKAFEDHAPGKSHSIDESLSSHHEPQTPDSGCHVRPIAESPEG  177

Query  339  ERPSKKQKVSAEAA  298
            E+ +KKQ+++ + A
Sbjct  178  EKQAKKQRLTEDTA  191



>gb|EYU27620.1| hypothetical protein MIMGU_mgv1a010952mg [Erythranthe guttata]
Length=293

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 115/175 (66%), Gaps = 21/175 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSD +  +  D    + G     GMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDAENKESGDILSGLDGSS---GMQITEALKL  110

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P           + 
Sbjct  111  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLPEAP------GTEDNKI  164

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSS-HNEALSPDSSC  349
             P SDN T+P TP P SE P ++    +   VK +SL+ S SS H+E L+PDS C
Sbjct  165  CPESDNKTDPATPAPTSESPFSDKPPKEHTLVKSLSLDESFSSHHHEPLTPDSDC  219



>ref|XP_003594371.1| Two-component response regulator EHD1 [Medicago truncatula]
 gb|AES64622.1| myb-like transcription factor family protein [Medicago truncatula]
Length=330

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 137/217 (63%), Gaps = 20/217 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDCSSDEGKKTDKKETGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  +       
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGVSAPTPGDM  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T P TP P  EK   E   P K +S   S SSH+E ++PDS C        P
Sbjct  204  FQQELDNKTEPATPDP--EKAAKEH-APAKSLSAE-SFSSHHEPMTPDSGCQVGSPADSP  259

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
              ER +KKQ+VS E A       +  ++L  S+ S+Q
Sbjct  260  NGERSTKKQRVSVEGAYLKSDMVLPHQILESSMPSYQ  296



>ref|XP_004486394.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Cicer arietinum]
 ref|XP_004486395.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Cicer arietinum]
Length=329

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 140/217 (65%), Gaps = 21/217 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKEAGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  A       
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGIAAPTPGDM  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
               + DN ++P TP P  EK   E   P K +S+  S SSH+E  +PDS C        P
Sbjct  204  CQEL-DNKSDPATPDP--EKAAKEHA-PAKSLSVE-SFSSHHEPTTPDSGCQLVSPADSP  258

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
              ER SKKQ+VS E     Q   +  ++L  S++S+Q
Sbjct  259  EGERSSKKQRVSVEGTYSKQDMVLPHQILESSMSSYQ  295



>gb|KCW75470.1| hypothetical protein EUGRSUZ_E04232 [Eucalyptus grandis]
Length=329

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 130/194 (67%), Gaps = 17/194 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLPD+SSDGK  +KKDS+DI S  D SSGMQITEALKL
Sbjct  86   VPGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNAEKKDSADIASNTDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+           SD
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLTDGSGLGDDCLE---SD  200

Query  483  NSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
              ++P TP P SE P  E+      P K  S++ S SSH+E  +PDS C        P  
Sbjct  201  KKSDPATPAPTSECPLQEKAFEDHAPGKSHSIDESLSSHHEPQTPDSGCHVRPIAESPEG  260

Query  339  ERPSKKQKVSAEAA  298
            E+ +KKQ+++ + A
Sbjct  261  EKQAKKQRLTEDTA  274



>ref|XP_010686606.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=241

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 129/175 (74%), Gaps = 12/175 (7%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S++GKK DKK+S+D++ GL+ SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSAEGKKADKKESADLLYGLESSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P S    S     +
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGTLAEVPGSGDFGSGQLMPD  172

Query  498  APVSDNST--NPVTPVPASEKP--ENEQRNPV-KGISLNASPSSHNEALSPDSSC  349
              +  +ST  +P TPVP SE P  +N +   V K +SL+ S SS  E L+PDS+C
Sbjct  173  KHLCSDSTKSDPATPVPTSESPLGKNSKDCAVAKSLSLDESFSSQQEPLTPDSTC  227



>ref|XP_004251050.1| PREDICTED: protein PHR1-LIKE 1-like [Solanum lycopersicum]
 ref|XP_010313350.1| PREDICTED: protein PHR1-LIKE 1-like [Solanum lycopersicum]
Length=324

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 136/194 (70%), Gaps = 20/194 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGK  DKK+  D++S LD SSG++IT ALKL
Sbjct  83   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNSDKKEPRDMLSSLDGSSGVEITTALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYLKKIIEEQQ+L     ++P  SG T+   G+N
Sbjct  141  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLKKIIEEQQRLSGVLSDVP-GSGVTALPTGDN  199

Query  498  APVSDNSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSC------  349
             P SD+ T+P TP P+SE P  ++        K +S++ S SSH+  LSPDS C      
Sbjct  200  GPESDSRTDPGTPAPSSEAPHVDKPVNAHTSTKSLSMDESFSSHHSPLSPDSDCQETSLM  259

Query  348  --PAVERPSKKQKV  313
              P  E  SKKQ+V
Sbjct  260  ESPNGESSSKKQRV  273



>gb|ACJ85036.1| unknown [Medicago truncatula]
Length=330

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 137/217 (63%), Gaps = 20/217 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KY+   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYVPDCSSDEGKKTDKKETGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  +       
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGVSAPTPGDM  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T P TP P  EK   E   P K +S  + P SH+E ++PDS C        P
Sbjct  204  FQQELDNKTEPATPDP--EKAAKEH-APAKSLSAESFP-SHHEPMTPDSGCQVGSPADSP  259

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
              ER +KKQ+VS E A       +  ++L  S+ S+Q
Sbjct  260  NGERSTKKQRVSVEGAYLKSDMVLPHQILESSMPSYQ  296



>ref|XP_009101377.1| PREDICTED: protein PHR1-LIKE 1-like [Brassica rapa]
Length=287

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 133/198 (67%), Gaps = 24/198 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD S G QITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDVLSGLDGSPGTQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        + A    + PV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGALGESSGPVTG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
             S +P TP P SE P      ++  P K +S+  S SS+ EAL+PDS C           
Sbjct  162  ES-DPATPAPTSEFPLQGKSGKECEPDKSLSVEESHSSYREALTPDSGCNIGSQDESAGE  220

Query  339  ERPSKKQKV-SAEAAAFT  289
            ER SKK ++    AA +T
Sbjct  221  ERSSKKPRLMRGGAAGYT  238



>ref|XP_006586676.1| PREDICTED: uncharacterized protein LOC100784511 isoform X4 [Glycine 
max]
Length=298

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 139/204 (68%), Gaps = 21/204 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  A  A     
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETPGSGVAAVAPGDAC  173

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------PA  343
                DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P 
Sbjct  174  QE-PDNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHLEPMTPDSGCHVGSPAESPK  228

Query  342  VERPSKKQKVSAEAAAFTQPDAML  271
             ER +KKQ+V  +   +++P+ +L
Sbjct  229  GERSAKKQRVIMD-GVYSKPEMVL  251



>ref|XP_010686602.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010686603.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010686604.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=299

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 129/175 (74%), Gaps = 12/175 (7%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S++GKK DKK+S+D++ GL+ SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYLPDSSAEGKKADKKESADLLYGLESSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E+P S    S     +
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGTLAEVPGSGDFGSGQLMPD  172

Query  498  APVSDNST--NPVTPVPASEKP--ENEQRNPV-KGISLNASPSSHNEALSPDSSC  349
              +  +ST  +P TPVP SE P  +N +   V K +SL+ S SS  E L+PDS+C
Sbjct  173  KHLCSDSTKSDPATPVPTSESPLGKNSKDCAVAKSLSLDESFSSQQEPLTPDSTC  227



>ref|XP_011658093.1| PREDICTED: protein PHR1-LIKE 1 [Cucumis sativus]
 gb|ACA24492.1| putative myb family transcription factor [Cucumis sativus]
 gb|KGN49010.1| hypothetical protein Csa_6G510280 [Cucumis sativus]
Length=262

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 136/188 (72%), Gaps = 16/188 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKKDSSDI+S +D SSGMQITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKTDKKDSSDILSNIDGSSGMQITEALKL  113

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE-----MPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       P +S  T+ ++G+N
Sbjct  114  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQKLSGVLSGAPAASAFTAPASGDN  173

Query  498  APVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSCPA----  343
             P  D + +P TP   SE P  E    +R   K +S++ S SSH+E L+PDS C +    
Sbjct  174  CPEVDKN-DPSTPASTSEFPRQEKVSKERAQGKSVSIDDSFSSHHEPLTPDSGCHSSPSE  232

Query  342  VERPSKKQ  319
              RP KKQ
Sbjct  233  SPRPVKKQ  240



>ref|XP_006586674.1| PREDICTED: uncharacterized protein LOC100784511 isoform X2 [Glycine 
max]
Length=328

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 140/205 (68%), Gaps = 23/205 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D++S LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMLSNLDGSSGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsa-sage  502
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  A  A     
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETPGSGVAAVAPGDAC  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
              P  DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P
Sbjct  204  QEP--DNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHLEPMTPDSGCHVGSPAESP  257

Query  345  AVERPSKKQKVSAEAAAFTQPDAML  271
              ER +KKQ+V  +   +++P+ +L
Sbjct  258  KGERSAKKQRVIMD-GVYSKPEMVL  281



>ref|XP_008384343.1| PREDICTED: myb family transcription factor APL-like isoform X4 
[Malus domestica]
Length=266

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 105/159 (66%), Gaps = 19/159 (12%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  S
Sbjct  63   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GS  121

Query  528  gatsasagenAPVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSP  361
            G     + +N P SDN T+P TP P SE P  ++      P K IS++ S SS  E L+P
Sbjct  122  GHLVRLSSDNCPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSRREPLTP  181

Query  360  DSSC--------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
            DS C        P  ER +KK++V+    AF+ P+ +L+
Sbjct  182  DSVCHVGSPAESPKAERLTKKRRVNI-GEAFSDPEVVLT  219



>ref|XP_008384342.1| PREDICTED: uncharacterized protein LOC103446951 isoform X3 [Malus 
domestica]
Length=284

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 105/159 (66%), Gaps = 19/159 (12%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  S
Sbjct  81   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAP-GS  139

Query  528  gatsasagenAPVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSP  361
            G     + +N P SDN T+P TP P SE P  ++      P K IS++ S SS  E L+P
Sbjct  140  GHLVRLSSDNCPESDNKTDPATPAPTSECPLQDKAAKECAPAKSISIDESFSSRREPLTP  199

Query  360  DSSC--------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
            DS C        P  ER +KK++V+    AF+ P+ +L+
Sbjct  200  DSVCHVGSPAESPKAERLTKKRRVNI-GEAFSDPEVVLT  237



>gb|KJB68478.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
Length=331

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 132/207 (64%), Gaps = 22/207 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKKPDKK++ D++S LD SSGMQITEALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKPDKKETGDMLSNLDGSSGMQITEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQ----QLEMPessgatsasagenA  496
            QMEVQK      +++RQLQLRIEAQGKYLKKIIEEQ+      E P +  +  A      
Sbjct  142  QMEVQK--RLHEQLERQLQLRIEAQGKYLKKIIEEQRLGGVLAEAPGTGASVPALGDNGL  199

Query  495  PVSDNSTNPVTPVPASEKPENE----QRNPVKGISLNASPSSHNEALSPDSSC-------  349
              SD  T+P TP P SE P  +    +    K  S++ S SSH+E L+PDS C       
Sbjct  200  E-SDKKTDPATPAPTSESPLQDKAAKEGTSAKSHSVDESFSSHHEPLTPDSGCHVGSPAG  258

Query  348  -PAVERPSKKQKVSAEAAAFTQPDAML  271
             P  E   KKQ+VS  A AF +P+ +L
Sbjct  259  SPKGEMLKKKQRVSM-AGAFAKPEMVL  284



>ref|XP_006597632.1| PREDICTED: protein PHR1-LIKE 1-like [Glycine max]
Length=299

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 144/218 (66%), Gaps = 23/218 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  113

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S          
Sbjct  114  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGAVAVVPGDA  173

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P
Sbjct  174  CQE-PDNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHPEPMTPDSGCHVGSPAESP  228

Query  345  AVERPSKKQKVSAEAAAFTQPDAML-SKLLG*SLTSHQ  235
              ER +KKQ+V+ +   +++P+ +L  ++L  S++S+Q
Sbjct  229  KGERSAKKQRVTMD-GVYSKPEMVLPHQILESSMSSYQ  265



>gb|ACU19557.1| unknown [Glycine max]
Length=329

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 144/218 (66%), Gaps = 23/218 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S          
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGAVAVVPGDA  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P
Sbjct  204  CQE-PDNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHPEPMTPDSGCHVGSPAESP  258

Query  345  AVERPSKKQKVSAEAAAFTQPDAML-SKLLG*SLTSHQ  235
              ER +KKQ+V+ +   +++P+ +L  ++L  S++S+Q
Sbjct  259  KGERSAKKQRVTMD-GVYSKPEMVLPHQILESSMSSYQ  295



>gb|KHN14395.1| Myb family transcription factor APL [Glycine soja]
Length=329

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 144/218 (66%), Gaps = 23/218 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S          
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSGAVAVVPGDA  203

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P
Sbjct  204  CQE-PDNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHPEPMTPDSGCHVGSPAESP  258

Query  345  AVERPSKKQKVSAEAAAFTQPDAML-SKLLG*SLTSHQ  235
              ER +KKQ+V+ +   +++P+ +L  ++L  S++S+Q
Sbjct  259  KGERSAKKQRVTMD-GVYSKPEMVLPHQILESSMSSYQ  295



>ref|XP_008782978.1| PREDICTED: myb family transcription factor APL-like [Phoenix 
dactylifera]
 ref|XP_008782979.1| PREDICTED: myb family transcription factor APL-like [Phoenix 
dactylifera]
Length=340

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 134/203 (66%), Gaps = 28/203 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+P++SSDG K  KKDS D++SGL++SSGMQITEALKL
Sbjct  85   VTGLTIYHVKS--HLQKYRLAKYIPESSSDGTKAAKKDSGDLLSGLENSSGMQITEALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A + SA   AP+S 
Sbjct  143  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---GGVMAETPSASIPAPISG  199

Query  483  N------STNPVTPVPASEKP---------ENEQRNPVKGISLNASPSSHNEALSPDSSC  349
            N       T+P TP P SE P                 K +S + S SSH+E L+PDSSC
Sbjct  200  NQCLDSDKTDPSTPAPTSESPLQVKAASGDHGGSGGLFKSLSHDDSFSSHHEPLTPDSSC  259

Query  348  --------PAVERPSKKQKVSAE  304
                    P  ERP K+Q+ +++
Sbjct  260  RAGSSFESPKHERPIKRQREASD  282



>ref|XP_010059710.1| PREDICTED: uncharacterized protein LOC104447696 [Eucalyptus grandis]
Length=642

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 130/194 (67%), Gaps = 17/194 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLPD+SSDGK  +KKDS+DI S  D SSGMQITEALKL
Sbjct  399  VPGLTIYHVKS--HLQKYRLAKYLPDSSSDGKNAEKKDSADIASNTDGSSGMQITEALKL  456

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+           SD
Sbjct  457  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLTDGSGLGDDCLE---SD  513

Query  483  NSTNPVTPVPASEKPENEQ----RNPVKGISLNASPSSHNEALSPDSSC--------PAV  340
              ++P TP P SE P  E+      P K  S++ S SSH+E  +PDS C        P  
Sbjct  514  KKSDPATPAPTSECPLQEKAFEDHAPGKSHSIDESLSSHHEPQTPDSGCHVRPIAESPEG  573

Query  339  ERPSKKQKVSAEAA  298
            E+ +KKQ+++ + A
Sbjct  574  EKQAKKQRLTEDTA  587



>ref|XP_007211672.1| hypothetical protein PRUPE_ppa009121mg [Prunus persica]
 gb|EMJ12871.1| hypothetical protein PRUPE_ppa009121mg [Prunus persica]
Length=228

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 105/159 (66%), Gaps = 19/159 (12%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  S
Sbjct  25   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVHSEAP-GS  83

Query  528  gatsasagenAPVSDNSTNPVTPVPASEKPENEQR----NPVKGISLNASPSSHNEALSP  361
            G  +  + +N P SDN T+P TP P SE P  ++      P K +S++ S SS +E L+P
Sbjct  84   GHLARLSDDNCPESDNKTDPATPAPTSECPLEDKAAKECTPAKSLSIDESFSSRHEPLTP  143

Query  360  DSSC--------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
            DS+C        P  E   KK++V     AFT P+ +L+
Sbjct  144  DSACHVDSPAESPKAEVSMKKRRVIM-GEAFTDPEVVLT  181



>gb|KCW76588.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
Length=225

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 132/211 (63%), Gaps = 17/211 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S   K   K+ +  +      S GMQITEALKL
Sbjct  3    VQGLTIYHVKS--HLQKYRLAKYLPDSSDGKKAEKKESADVLSDMDGSSGGMQITEALKL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+   S  +     D
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGALADGSADESGDKGQ--ED  118

Query  483  NSTNPVTPVPASEKPENEQRNPV---KGISLNASPSSHN-EALSPDSSC--------PAV  340
            + T+P TP P SE P  ++       K +SL+ S SSHN E L+PDS C        P  
Sbjct  119  SKTDPPTPAPISESPIQDKSKDCAVAKSLSLDGSLSSHNHEPLTPDSGCNVSSPAESPDG  178

Query  339  ERPSKKQKVSAEAAAFTQPDAMLSKLLG*SL  247
            ER +KK +V+A  A+  +P+ +L  +   SL
Sbjct  179  ERSAKKPRVTA-GASHAKPEIVLHPIFESSL  208



>gb|EYU33817.1| hypothetical protein MIMGU_mgv1a010983mg [Erythranthe guttata]
 gb|EYU33818.1| hypothetical protein MIMGU_mgv1a010983mg [Erythranthe guttata]
 gb|EYU33819.1| hypothetical protein MIMGU_mgv1a010983mg [Erythranthe guttata]
Length=295

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 138/199 (69%), Gaps = 19/199 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDG K +KK+S DI+S LD SS +QIT+ALKL
Sbjct  50   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGTKAEKKESGDILSSLDGSSSLQITDALKL  107

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  SG  + +  E 
Sbjct  108  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLAGGLSEAP-GSGVPAPATDEI  166

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVK-GISLNASPSSHNEALSPDSSCPAV------  340
             P SDN T+P TP   SE P  E   P+K   S++ S SSH+E L+PDS C         
Sbjct  167  CPESDNKTDPATPAATSEPPFLE--IPIKERASIDESFSSHHEPLTPDSDCQVGPPLEIE  224

Query  339  -ERPSKKQKVSAEAAAFTQ  286
             ERP+K+ + S +  AFT+
Sbjct  225  NERPTKRPRGSGD-VAFTK  242



>gb|KCW76584.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
 gb|KCW76585.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
 gb|KCW76586.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
Length=308

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 132/211 (63%), Gaps = 17/211 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S   K   K+ +  +      S GMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSDGKKAEKKESADVLSDMDGSSGGMQITEALKL  143

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+   S  +     D
Sbjct  144  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGALADGSADESGDKGQ--ED  201

Query  483  NSTNPVTPVPASEKPENEQRNPV---KGISLNASPSSHN-EALSPDSSC--------PAV  340
            + T+P TP P SE P  ++       K +SL+ S SSHN E L+PDS C        P  
Sbjct  202  SKTDPPTPAPISESPIQDKSKDCAVAKSLSLDGSLSSHNHEPLTPDSGCNVSSPAESPDG  261

Query  339  ERPSKKQKVSAEAAAFTQPDAMLSKLLG*SL  247
            ER +KK +V+A  A+  +P+ +L  +   SL
Sbjct  262  ERSAKKPRVTA-GASHAKPEIVLHPIFESSL  291



>ref|NP_001240901.1| uncharacterized protein LOC100784511 [Glycine max]
 ref|XP_006586675.1| PREDICTED: uncharacterized protein LOC100784511 isoform X3 [Glycine 
max]
 gb|ACU20046.1| unknown [Glycine max]
Length=299

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 136/205 (66%), Gaps = 22/205 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  113

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasage  502
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  A  A    
Sbjct  114  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETPGSGVAAVAPGDA  173

Query  501  nAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        P
Sbjct  174  CQE-PDNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHLEPMTPDSGCHVGSPAESP  228

Query  345  AVERPSKKQKVSAEAAAFTQPDAML  271
              ER +KKQ+V  +   +++P+ +L
Sbjct  229  KGERSAKKQRVIMD-GVYSKPEMVL  252



>gb|KCW76587.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
Length=267

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 132/211 (63%), Gaps = 17/211 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S   K   K+ +  +      S GMQITEALKL
Sbjct  45   VQGLTIYHVKS--HLQKYRLAKYLPDSSDGKKAEKKESADVLSDMDGSSGGMQITEALKL  102

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+   S  +     D
Sbjct  103  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGALADGSADESGDKGQ--ED  160

Query  483  NSTNPVTPVPASEKPENEQRNPV---KGISLNASPSSHN-EALSPDSSC--------PAV  340
            + T+P TP P SE P  ++       K +SL+ S SSHN E L+PDS C        P  
Sbjct  161  SKTDPPTPAPISESPIQDKSKDCAVAKSLSLDGSLSSHNHEPLTPDSGCNVSSPAESPDG  220

Query  339  ERPSKKQKVSAEAAAFTQPDAMLSKLLG*SL  247
            ER +KK +V+A  A+  +P+ +L  +   SL
Sbjct  221  ERSAKKPRVTA-GASHAKPEIVLHPIFESSL  250



>ref|XP_006586673.1| PREDICTED: uncharacterized protein LOC100784511 isoform X1 [Glycine 
max]
Length=329

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 137/206 (67%), Gaps = 24/206 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDMLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsa-sag  505
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S  A  A    
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETPGSGVAAVAPGDA  203

Query  504  enAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------  349
               P  DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS C        
Sbjct  204  CQEP--DNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHLEPMTPDSGCHVGSPAES  257

Query  348  PAVERPSKKQKVSAEAAAFTQPDAML  271
            P  ER +KKQ+V  +   +++P+ +L
Sbjct  258  PKGERSAKKQRVIMD-GVYSKPEMVL  282



>gb|AFK45910.1| unknown [Lotus japonicus]
Length=194

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 109/162 (67%), Gaps = 19/162 (12%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsa  514
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       + + 
Sbjct  10   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVFSEAP  66

Query  513  sagenAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC-----  349
            +     P  DN T+P TP P   +   +Q  P K +S+  S SSH+E ++PDS+C     
Sbjct  67   ADVCREP--DNKTDPATPDP---EKAAKQHAPAKSLSIE-SFSSHHEPMTPDSACHVGSP  120

Query  348  ---PAVERPSKKQKVSAEAAAFTQPDAML-SKLLG*SLTSHQ  235
               P  ER +KKQ+VS +  A+++PD +L  ++L  S+ S+Q
Sbjct  121  ADSPKEERSAKKQRVSMD-GAYSKPDIVLPHQILESSMPSYQ  161



>ref|XP_002308734.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE92257.2| myb family transcription factor family protein [Populus trichocarpa]
Length=360

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 137/245 (56%), Gaps = 48/245 (20%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SSDGKK DKK++ D+IS LD SSGMQITEALKL
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDGKKADKKETGDMISNLDGSSGMQITEALKL  143

Query  663  QMEVQKr-------------------------lheqlevqrqlqlriEAQGKYLKKIIEE  559
            QMEVQKR                               VQRQLQLRIEAQGKYLKKIIEE
Sbjct  144  QMEVQKRLHEQLEACFPCTRHPINCAIMCGDFYAHVSLVQRQLQLRIEAQGKYLKKIIEE  203

Query  558  QQQLEMPessgatsasagenAPVS-DNS-----TNPVTPVPASEKPENE----QRNPVKG  409
            QQ+L            +G  APVS DN      T+P TP P SE P  +    +R P K 
Sbjct  204  QQRL---SGVLEDVPGSGVTAPVSGDNCPESDKTDPATPAPTSESPLQDKAAKERAPAKS  260

Query  408  ISLNASPSSHNEALSPDSSC--------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*  253
            +S++ S SS  E L+PDS C        P  ER  KKQ+VS       Q   +  ++L  
Sbjct  261  LSIDESFSSQPEPLTPDSRCNAGSPAESPRGERSMKKQRVSIGVTYGKQEMVLTHQILES  320

Query  252  SLTSH  238
            SL S+
Sbjct  321  SLNSY  325



>ref|XP_006398489.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
 ref|XP_006398490.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
 ref|XP_006398491.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
 gb|ESQ39942.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
 gb|ESQ39943.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
 gb|ESQ39944.1| hypothetical protein EUTSA_v10000981mg [Eutrema salsugineum]
Length=288

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 135/199 (68%), Gaps = 25/199 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD SSGMQITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDVLSGLDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      + PV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGVLGEPSGPVTG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSCPAV--------  340
             S +P TP P SE P      ++  P K +S++ S SS+ E L+PDS C  V        
Sbjct  162  ES-DPATPAPTSESPLQDKSGKECGPDKSLSVDDSLSSYREPLTPDSGCNIVSQDESGGE  220

Query  339  ERPSKKQKV--SAEAAAFT  289
            ER SKK ++     AA +T
Sbjct  221  ERSSKKPRLVRGGGAAGYT  239



>ref|XP_006659335.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006659336.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Oryza brachyantha]
Length=308

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 134/211 (64%), Gaps = 27/211 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD S+D  K + KDS ++++ L+ SSGMQI+EALKL
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYIPDPSADDNKAEDKDSGNLLAALEGSSGMQISEALKL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++     +G+   ++ E  P S+
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRV---IGAGSPRDTSSEQLPESE  196

Query  483  NSTNPVTPVPASEKP---------ENEQRNPVKGISLNASPSSHNEALSPDSSC------  349
              TNP TPVP SE P            Q  P K  S +  P  H E L+PDSSC      
Sbjct  197  R-TNPPTPVPTSESPVQGAPRKKLNGSQVEPTKSPSHD-DPPPHGEPLTPDSSCRPGSPT  254

Query  348  --PAVERPSKKQKVSAEAA---AFTQPDAML  271
              P  ER SK+Q+ S +A    AF   + +L
Sbjct  255  LSPKHERASKRQRGSDDAGDGSAFADGEFVL  285



>ref|XP_008794715.1| PREDICTED: myb family transcription factor APL-like isoform X6 
[Phoenix dactylifera]
Length=257

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 27/202 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+P++SSDG K +KKD  D++SGL++SSGMQITEALKL
Sbjct  3    VQGLTIYHVKS--HLQKYRLAKYVPESSSDGSKGEKKDPGDLLSGLENSSGMQITEALKL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +      AP+S 
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPGVSIPAPISG  117

Query  483  NS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHNEALSPDSSC  349
            +       T+P TP P SE P  ++             K +S + S SS  E L+PDSSC
Sbjct  118  DHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRREPLTPDSSC  177

Query  348  -------PAVERPSKKQKVSAE  304
                   P  ER  K+Q+ + +
Sbjct  178  HAGSPESPKPERRIKRQRGAGD  199



>emb|CDP10675.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 139/214 (65%), Gaps = 32/214 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+S DGKK DKKD+ D+++GLD SSGM+ITEALKL
Sbjct  54   VQGLTIYHVKS--HLQKYRLAKYLPDSSVDGKKLDKKDAKDMLAGLDGSSGMEITEALKL  111

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYLKKIIEEQQ+L   +PE   A          V
Sbjct  112  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLKKIIEEQQRLNGVLPEGPSAG---------V  162

Query  489  SDNS------TNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPDSSCPA-  343
            +DN       T+P TP P SE P      +     K +S++ S S   E  +P+S C   
Sbjct  163  TDNCADVEMRTDPGTPPPTSEPPVIDKPTKDHPSTKSLSMDESFSP-QEPQTPESGCHMN  221

Query  342  ------VERPSKKQKVSAEAAAFTQPDAMLSKLL  259
                   +R SKKQ+V    AAF++PD M ++ L
Sbjct  222  LFENIDADRSSKKQRVGLN-AAFSKPDMMFTQQL  254



>gb|ACD13206.1| phosphate high response [Phaseolus vulgaris]
Length=327

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 140/214 (65%), Gaps = 17/214 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL-pdassdgkkpdkkdssdiisglddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KYL   +S +GKK DKK++ D++S LD SSGMQITEALK
Sbjct  86   VQGLTIYHVKS--HLQKYRLAKYLPDSSSDEGKKADKKETGDVLSNLDGSSGMQITEALK  143

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAP  493
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L   + E+      +      
Sbjct  144  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPDTGVVAVVPGDV  203

Query  492  VSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC--------PAVE  337
              +  T+P TP P  EK   + R P K +S   S SSH+E L+PDS C        P  E
Sbjct  204  CQEPDTDPSTPDP--EKAAKD-RVPAKSLS-GESFSSHHEPLTPDSGCHGGSPADSPKGE  259

Query  336  RPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
            R +KKQ+++ + +   Q   +  ++L  S++S+Q
Sbjct  260  RSTKKQRLNMDESYSKQDMVLPLQILESSMSSYQ  293



>ref|XP_008794712.1| PREDICTED: myb family transcription factor APL-like isoform X4 
[Phoenix dactylifera]
 ref|XP_008794713.1| PREDICTED: myb family transcription factor APL-like isoform X4 
[Phoenix dactylifera]
Length=309

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 27/202 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+P++SSDG K +KKD  D++SGL++SSGMQITEALKL
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYVPESSSDGSKGEKKDPGDLLSGLENSSGMQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +      AP+S 
Sbjct  113  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPGVSIPAPISG  169

Query  483  NS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHNEALSPDSSC  349
            +       T+P TP P SE P  ++             K +S + S SS  E L+PDSSC
Sbjct  170  DHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRREPLTPDSSC  229

Query  348  -------PAVERPSKKQKVSAE  304
                   P  ER  K+Q+ + +
Sbjct  230  HAGSPESPKPERRIKRQRGAGD  251



>ref|XP_008794708.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Phoenix dactylifera]
Length=339

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 27/202 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+P++SSDG K +KKD  D++SGL++SSGMQITEALKL
Sbjct  85   VQGLTIYHVKS--HLQKYRLAKYVPESSSDGSKGEKKDPGDLLSGLENSSGMQITEALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +      AP+S 
Sbjct  143  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPGVSIPAPISG  199

Query  483  NS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHNEALSPDSSC  349
            +       T+P TP P SE P  ++             K +S + S SS  E L+PDSSC
Sbjct  200  DHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRREPLTPDSSC  259

Query  348  -------PAVERPSKKQKVSAE  304
                   P  ER  K+Q+ + +
Sbjct  260  HAGSPESPKPERRIKRQRGAGD  281



>gb|AFK43412.1| unknown [Medicago truncatula]
Length=205

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 100/166 (60%), Gaps = 17/166 (10%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S 
Sbjct  10   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPGSG  69

Query  528  gatsasagenAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC  349
             +            DN T P TP P  EK   E   P K +S   S SSH+E ++PDS C
Sbjct  70   VSAPTPGDMFQQELDNKTEPATPDP--EKAAKEH-APAKSLSAE-SFSSHHEPMTPDSGC  125

Query  348  --------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
                    P  ER +KKQ+VS E A       +  ++L  S+ S+Q
Sbjct  126  QVGSPADSPNGERSTKKQRVSVEGAYLKSDMVLPHQILESSMPSYQ  171



>ref|NP_001058045.1| Os06g0609500 [Oryza sativa Japonica Group]
 dbj|BAD35632.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAD35475.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAF19959.1| Os06g0609500 [Oryza sativa Japonica Group]
 dbj|BAG92659.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACN85200.1| MYB-CC type transfactor [Oryza glaberrima]
Length=329

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 129/192 (67%), Gaps = 18/192 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L   + ES    +       P 
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRLSGVLGESGKLGALGPAPGEPY  201

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHN---EALSPDSSCPAVE-----  337
             D N T+P TPVP SE P  ++     G  L  + SSH+   E L+PDSSC A       
Sbjct  202  QDSNKTDPSTPVPTSESPIRDK----AGSGLFKTISSHDDCREPLTPDSSCRAGSPLESP  257

Query  336  -RPSKKQKVSAE  304
             R SK+ +VS++
Sbjct  258  PRASKRIRVSSD  269



>ref|XP_010928206.1| PREDICTED: protein PHR1-LIKE 1-like [Elaeis guineensis]
Length=280

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 134/202 (66%), Gaps = 13/202 (6%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+P++SSDG K DKK+  D++  +D+SSGMQITEALKL
Sbjct  69   VQGLTIYHVKS--HLQKYRLAKYIPESSSDGTKSDKKEPGDLLPTVDNSSGMQITEALKL  126

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKI+EEQQ+L   +  +SG  + +     P 
Sbjct  127  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIVEEQQRLSSVLTGASGLGNTTTIFGDPH  186

Query  489  SDNSTNPVTPVPASEKP------ENEQRNP--VKGISLNASPSSHNEALSPDSSCP-AVE  337
             D+ T+P TP   SE P       N + +   VK +  +   S H+E ++PDSSC  + +
Sbjct  187  LDDKTDPPTPASTSESPIEGKGTSNHRVDCGLVKSLPHDELFSFHHEPMTPDSSCARSPD  246

Query  336  RPSKKQKVSAEAAAFTQPDAML  271
             P ++Q+V  +    +  +A L
Sbjct  247  SPKREQRVKEQQGTGSLENAGL  268



>ref|XP_009394531.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
Length=306

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 138/217 (64%), Gaps = 27/217 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+P++S+DG   +KKD  ++ SGL+ SSGMQITEALKL
Sbjct  85   VAGLTIYHVKS--HLQKYRLAKYVPESSADGTMSEKKDDRNLNSGLESSSGMQITEALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKII+EQQ+L     ++P  +   + ++G++
Sbjct  143  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIIDEQQRLSGVLADLP-GADIPAPTSGDH  201

Query  498  APVSDNSTNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHNEALSPDSSC-  349
             P S+  T+P TP P SE P  ++             K IS + S SS  E L+PDS C 
Sbjct  202  CPDSEK-TDPSTPAPTSESPGQDKSIGRELGDANGAFKSISCDDSFSSRREPLTPDSGCH  260

Query  348  -------PAVERPSKKQKVSAEAAAFTQPDAMLSKLL  259
                   P  E  +KK  VS+  +   + D +L+ +L
Sbjct  261  VSSPSTSPRHESSAKKLPVSSN-SGHGKEDLLLAHIL  296



>ref|XP_006660516.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006660517.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Oryza brachyantha]
Length=287

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 135/217 (62%), Gaps = 38/217 (18%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD+S+DG K + KD  D+++GL+ SSG+QI+EALKL
Sbjct  60   VQGLTIYHVKS--HLQKYRLAKYIPDSSADGNKAENKDPGDLLAGLEGSSGLQISEALKL  117

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  + +    + + 
Sbjct  118  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLGGVKSETP--AASAITLSSDQ  175

Query  498  APVSDNSTNPVTPVPASEKP--------ENEQRN-----PVKGISLNASPSSHNEALSPD  358
             P S+  T P TP P SE P        +N  RN     P +  SL     SH E L+PD
Sbjct  176  FPDSER-TGPSTPAPISESPTQGVPSNRDNGGRNEETKSPHREDSL-----SHPEPLTPD  229

Query  357  SSC--------PAVERPSKKQKVSAEAAAFTQPDAML  271
            S+C        P  ER +K+Q+       F++ D  L
Sbjct  230  SNCQPGSPTVSPKHERAAKRQR--GNGTEFSETDFTL  264



>ref|NP_001062813.1| Os09g0299200 [Oryza sativa Japonica Group]
 dbj|BAD33181.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAD32994.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAF24727.1| Os09g0299200 [Oryza sativa Japonica Group]
 dbj|BAG95971.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 136/219 (62%), Gaps = 41/219 (19%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD+S+DG K + KD  D+++GL+ SSG+QI+EALKL
Sbjct  60   VQGLTIYHVKS--HLQKYRLAKYIPDSSADGNKAENKDPGDLLAGLEGSSGLQISEALKL  117

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P ++GA+     + 
Sbjct  118  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLGGVKSETP-AAGASVTLPSDQ  176

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEA---------------LS  364
             P S+  T+P TP P SE       +P +G+  N      NEA               L+
Sbjct  177  FPDSER-TDPSTPAPTSE-------SPTQGVPSNRDNGGQNEATKSPQRDDSLSRHEPLT  228

Query  363  PDSSC--------PAVERPSKKQKVSAEAAAFTQPDAML  271
            PDS+C        P  ER +K+Q+     A F++ D  L
Sbjct  229  PDSNCQPGSPTASPKHERAAKRQR--GNGAEFSETDFAL  265



>ref|NP_001152613.1| MYB-CC type transfactor [Zea mays]
 gb|ACF78210.1| unknown [Zea mays]
 gb|ACF84904.1| unknown [Zea mays]
 gb|ACF86159.1| unknown [Zea mays]
 gb|ACG48564.1| MYB-CC type transfactor [Zea mays]
 gb|ACR36244.1| unknown [Zea mays]
 gb|ACR36688.1| unknown [Zea mays]
 gb|AFU81563.1| G2-like transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA60954.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=312

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 130/200 (65%), Gaps = 25/200 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PDAS+DG K D KD  D+++GL+ SSG+QI+EALKL
Sbjct  82   VQGLTIYHVKS--HLQKYRLAKYIPDASTDGNKTDNKDPGDLLAGLEGSSGLQISEALKL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L     E P + GA+   + + 
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRLTGVKSETP-AGGASVTVSSDQ  198

Query  498  APVSDNSTNPVTPVPASEKP--------ENEQRNPVKGISLNASPSSHNEALSPDSSC--  349
             P S+  T P TP PASE P        +   R      + +    S NE L+PDS+C  
Sbjct  199  FPDSER-TEPSTPAPASESPTQVGASNRDTGDRTEATKSTCHGDSLSRNEPLTPDSNCQN  257

Query  348  ------PAVERPSKKQKVSA  307
                  P  ER +K+Q+ S 
Sbjct  258  GSPVASPNHERAAKRQRGSG  277



>gb|EEC84302.1| hypothetical protein OsI_30789 [Oryza sativa Indica Group]
 gb|EEE69404.1| hypothetical protein OsJ_28762 [Oryza sativa Japonica Group]
Length=281

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 136/219 (62%), Gaps = 41/219 (19%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD+S+DG K + KD  D+++GL+ SSG+QI+EALKL
Sbjct  53   VQGLTIYHVKS--HLQKYRLAKYIPDSSADGNKAENKDPGDLLAGLEGSSGLQISEALKL  110

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P ++GA+     + 
Sbjct  111  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLGGVKSETP-AAGASVTLPSDQ  169

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEA---------------LS  364
             P S+  T+P TP P SE       +P +G+  N      NEA               L+
Sbjct  170  FPDSER-TDPSTPAPTSE-------SPTQGVPSNRDNGGQNEATKSPQRDDSLSRHEPLT  221

Query  363  PDSSC--------PAVERPSKKQKVSAEAAAFTQPDAML  271
            PDS+C        P  ER +K+Q+     A F++ D  L
Sbjct  222  PDSNCQPGSPTASPKHERAAKRQR--GNGAEFSETDFAL  258



>ref|XP_010244816.1| PREDICTED: myb family transcription factor APL isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244817.1| PREDICTED: myb family transcription factor APL isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244818.1| PREDICTED: myb family transcription factor APL isoform X1 [Nelumbo 
nucifera]
Length=313

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 137/217 (63%), Gaps = 25/217 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLP++++DGKK DKK+ S++ S  D SSGMQIT+ALKL
Sbjct  70   VQGLTIYHVKS--HLQKYRLAKYLPESTADGKKSDKKEPSELFSSSDGSSGMQITDALKL  127

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L   + E+  +     G     
Sbjct  128  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGFLGEAPSSIIPVPGSGDNC  187

Query  489  SDNSTNPVTPVPASEKPENEQRN----PVKGISLNASPSSHNEALSPDSS-------CPA  343
             D+ ++P TP P SE P  ++      P K +S N S S H E L+PDS         P 
Sbjct  188  PDSKSDPSTPAPTSEGPIQDKSAKECPPDKSLSCNESSSRH-EPLTPDSGHVSSPVESPK  246

Query  342  VERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQI  232
             +R  K++++S         D + SK +   LT HQI
Sbjct  247  GDRSLKQKRMSI--------DTLCSKKIEVVLT-HQI  274



>ref|XP_010942496.1| PREDICTED: myb family transcription factor APL isoform X2 [Elaeis 
guineensis]
Length=339

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 128/200 (64%), Gaps = 25/200 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+P++SSDG K +KKD  D++SGL++SSG+QITEALKL
Sbjct  85   VPGLTIYHVKS--HLQKYRLAKYIPESSSDGSKAEKKDPEDLLSGLENSSGIQITEALKL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  S     S    
Sbjct  143  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLAETPGVSIPAPISGDHC  202

Query  498  APVSDNSTNPVTPVPASEKP---------ENEQRNPVKGISLNASPSSHNEALSPDSSC-  349
              +  + T+P TP P SE P                 K +S + S SS  E L+PDSSC 
Sbjct  203  --LDSDKTDPSTPAPTSESPLQDKAASGDHGGTGGLFKSLSRDDSFSSRREPLTPDSSCR  260

Query  348  ------PAVERPSKKQKVSA  307
                  P  ERP K+Q+ ++
Sbjct  261  AGSPESPRRERPIKRQRGAS  280



>gb|ACN85167.1| MYB-CC type transfactor [Oryza nivara]
 gb|ACN85184.1| MYB-CC type transfactor [Oryza rufipogon]
Length=329

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 18/192 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L   + ES    +       P 
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRLSGVLGESGKLGALGPAPGEPY  201

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHN---EALSPDSSCPAVE-----  337
             D N T+P TPVP SE P  ++        L  + SSH+   E L+PDSSC A       
Sbjct  202  QDSNKTDPSTPVPTSESPIRDKAES----GLFKTISSHDDCREPLTPDSSCRAGSPLESP  257

Query  336  -RPSKKQKVSAE  304
             R SK+ +VS++
Sbjct  258  PRASKRIRVSSD  269



>ref|XP_004973261.1| PREDICTED: protein PHR1-LIKE 1-like [Setaria italica]
Length=302

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 134/208 (64%), Gaps = 25/208 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD S+D  K +KKD  D+++ L+ SS MQI+EALKL
Sbjct  80   VPGLTIYHVKS--HLQKYRLAKYIPDPSTDDNKAEKKDPGDLLAALEGSSTMQISEALKL  137

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++     +GA+  ++ E  P S+
Sbjct  138  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRI---SGAGASRDTSSEQLPDSE  194

Query  483  NSTNPVTPVPASEKP--------ENEQR-NPVKGISLNASPSSHNEALSPDSSC------  349
              TNP TPVP SE P        +N  R  P++  S +  P  H E ++PDS+C      
Sbjct  195  R-TNPSTPVPTSESPLQAVPFSKDNGSRVEPMESASHDDLP--HGEPVTPDSNCRPGSPT  251

Query  348  --PAVERPSKKQKVSAEAAAFTQPDAML  271
              P  ER +K+Q+ S++       D  L
Sbjct  252  LSPKHERAAKRQRGSSDGTPIADGDFAL  279



>ref|XP_008794714.1| PREDICTED: myb family transcription factor APL-like isoform X5 
[Phoenix dactylifera]
Length=266

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 121/211 (57%), Gaps = 36/211 (17%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisgld---------dsSG  691
            VQGLTI   K+   +QKYRL+KY+P++SSDG   +           D         +SSG
Sbjct  3    VQGLTIYHVKS--HLQKYRLAKYVPESSSDGTFRNSLIEGSKGEKKDPGDLLSGLENSSG  60

Query  690  MQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsas  511
            MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +  
Sbjct  61   MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPG  117

Query  510  agenAPVSDNS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHN  376
                AP+S +       T+P TP P SE P  ++             K +S + S SS  
Sbjct  118  VSIPAPISGDHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRR  177

Query  375  EALSPDSSC-------PAVERPSKKQKVSAE  304
            E L+PDSSC       P  ER  K+Q+ + +
Sbjct  178  EPLTPDSSCHAGSPESPKPERRIKRQRGAGD  208



>gb|EAZ01633.1| hypothetical protein OsI_23670 [Oryza sativa Indica Group]
 gb|EAZ37605.1| hypothetical protein OsJ_21941 [Oryza sativa Japonica Group]
Length=319

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 117/192 (61%), Gaps = 28/192 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQ++L  ++E          AQG+YL+KIIEEQQ+L   + ES    +       P 
Sbjct  142  QMEVQRQLQLRIE----------AQGRYLQKIIEEQQRLSGVLGESGKLGALGPAPGEPY  191

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHN---EALSPDSSCPAVE-----  337
             D N T+P TPVP SE P  ++     G  L  + SSH+   E L+PDSSC A       
Sbjct  192  QDSNKTDPSTPVPTSESPIRDK----AGSGLFKTISSHDDCREPLTPDSSCRAGSPLESP  247

Query  336  -RPSKKQKVSAE  304
             R SK+ +VS++
Sbjct  248  PRASKRIRVSSD  259



>ref|XP_008794709.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Phoenix dactylifera]
 ref|XP_008794710.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Phoenix dactylifera]
Length=318

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 121/211 (57%), Gaps = 36/211 (17%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisgld---------dsSG  691
            VQGLTI   K+   +QKYRL+KY+P++SSDG   +           D         +SSG
Sbjct  55   VQGLTIYHVKS--HLQKYRLAKYVPESSSDGTFRNSLIEGSKGEKKDPGDLLSGLENSSG  112

Query  690  MQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsas  511
            MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +  
Sbjct  113  MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPG  169

Query  510  agenAPVSDNS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHN  376
                AP+S +       T+P TP P SE P  ++             K +S + S SS  
Sbjct  170  VSIPAPISGDHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRR  229

Query  375  EALSPDSSC-------PAVERPSKKQKVSAE  304
            E L+PDSSC       P  ER  K+Q+ + +
Sbjct  230  EPLTPDSSCHAGSPESPKPERRIKRQRGAGD  260



>gb|EEE68540.1| hypothetical protein OsJ_26995 [Oryza sativa Japonica Group]
Length=285

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 26/210 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD S+D  K + KD  +++S L+ SSGMQI+EALKL
Sbjct  60   VPGLTIYHVKS--HLQKYRLAKYIPDPSADDNKDEDKDPGNLLSALEGSSGMQISEALKL  117

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++     +GA+ A++ E  P S+
Sbjct  118  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRV---IGAGASRATSSEQLPDSE  174

Query  483  NSTNPVTPVPASEKPEN---EQRNPVKGISLNASPSSHNEA------LSPDSSC------  349
              TNP TPVP SE P       +N    +    SP SH++A      L+PDSSC      
Sbjct  175  K-TNPPTPVPISESPVQGAPHSKNSQSQVEPTKSP-SHDDALPCGEPLTPDSSCRPGSPT  232

Query  348  --PAVERPSKKQKVS--AEAAAFTQPDAML  271
              P  ER +K+Q+ S   +  AF   + +L
Sbjct  233  LSPKHERAAKRQRGSDAGDVTAFADGEFVL  262



>ref|XP_006660518.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Oryza brachyantha]
Length=253

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 126/197 (64%), Gaps = 26/197 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD+S+DG K + KD  D+++GL+ SSG+QI+EALKL
Sbjct  60   VQGLTIYHVKS--HLQKYRLAKYIPDSSADGNKAENKDPGDLLAGLEGSSGLQISEALKL  117

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P  + +    + + 
Sbjct  118  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLGGVKSETP--AASAITLSSDQ  175

Query  498  APVSDNSTNPVTPVPASEKP--------ENEQRNPVKGISLNASPSSHNEALSPDSSC--  349
             P S+  T P TP P SE P        +N  RN            SH E L+PDS+C  
Sbjct  176  FPDSER-TGPSTPAPISESPTQGVPSNRDNGGRNEETKSPHREDSLSHPEPLTPDSNCQP  234

Query  348  ------PAVERPSKKQK  316
                  P  ER +K+Q+
Sbjct  235  GSPTVSPKHERAAKRQR  251



>dbj|BAC75447.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAD03152.1| putative transfactor [Oryza sativa Japonica Group]
Length=307

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 26/210 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD S+D  K + KD  +++S L+ SSGMQI+EALKL
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYIPDPSADDNKDEDKDPGNLLSALEGSSGMQISEALKL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++     +GA+ A++ E  P S+
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRV---IGAGASRATSSEQLPDSE  196

Query  483  NSTNPVTPVPASEKPEN---EQRNPVKGISLNASPSSHNEA------LSPDSSC------  349
              TNP TPVP SE P       +N    +    SP SH++A      L+PDSSC      
Sbjct  197  K-TNPPTPVPISESPVQGAPHSKNSQSQVEPTKSP-SHDDALPCGEPLTPDSSCRPGSPT  254

Query  348  --PAVERPSKKQKVS--AEAAAFTQPDAML  271
              P  ER +K+Q+ S   +  AF   + +L
Sbjct  255  LSPKHERAAKRQRGSDAGDVTAFADGEFVL  284



>gb|ACN85331.1| MYB-CC type transfactor [Oryza granulata]
Length=327

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 124/194 (64%), Gaps = 25/194 (13%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D ++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKDLGDFLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPV--  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L         S       PV  
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRL---SGVLGESGKLSALGPVPG  198

Query  489  ----SDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALS-------PDSSCPA  343
                  N T+P TPVP SE P  ++        L  + SSHN+ LS       PDSS P 
Sbjct  199  EYYQDSNKTDPSTPVPTSESPVRDK----AASGLFKTLSSHNDCLSSGREPLTPDSSSP-  253

Query  342  VERP--SKKQKVSA  307
            +E P  SK+ +VS+
Sbjct  254  LESPKASKRIRVSS  267



>gb|ACN85217.1| MYB-CC type transfactor [Oryza punctata]
Length=332

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 127/194 (65%), Gaps = 21/194 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EAL+L
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKDLGDLLADIESSSGMEIGEALQL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L   + ES   T+         
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRLSGVLGESGKLTALGPAPGEQY  201

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALS-------PDSSCPAVE-  337
             D N T+P TPVP SE P  ++     G  L  + SSH++ LS       PDSSC A   
Sbjct  202  QDSNKTDPSTPVPTSESPIRDK----AGSGLFKTISSHDDCLSSGREPLTPDSSCRAGSP  257

Query  336  ----RPSKKQKVSA  307
                R SK+ +VS 
Sbjct  258  LESPRASKRIRVSG  271



>ref|XP_008794707.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Phoenix dactylifera]
Length=348

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 121/211 (57%), Gaps = 36/211 (17%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisgld---------dsSG  691
            VQGLTI   K+   +QKYRL+KY+P++SSDG   +           D         +SSG
Sbjct  85   VQGLTIYHVKS--HLQKYRLAKYVPESSSDGTFRNSLIEGSKGEKKDPGDLLSGLENSSG  142

Query  690  MQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsas  511
            MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +  
Sbjct  143  MQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLN---GVLAETPG  199

Query  510  agenAPVSDNS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHN  376
                AP+S +       T+P TP P SE P  ++             K +S + S SS  
Sbjct  200  VSIPAPISGDHCQDSDKTDPSTPAPTSESPRQDKAASGDHGGTGGLFKSLSRDDSFSSRR  259

Query  375  EALSPDSSC-------PAVERPSKKQKVSAE  304
            E L+PDSSC       P  ER  K+Q+ + +
Sbjct  260  EPLTPDSSCHAGSPESPKPERRIKRQRGAGD  290



>gb|KHN40756.1| Myb family transcription factor APL [Glycine soja]
Length=204

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 100/155 (65%), Gaps = 21/155 (14%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPess  529
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L     E P S 
Sbjct  10   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSETPGSG  69

Query  528  gatsa-sagenAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSS  352
             A  A       P  DN T+P TP P  EK   + R P K +S+  S SSH E ++PDS 
Sbjct  70   VAAVAPGDACQEP--DNKTDPSTPDP--EKAAKD-RAPAKSLSIE-SFSSHLEPMTPDSG  123

Query  351  C--------PAVERPSKKQKVSAEAAAFTQPDAML  271
            C        P  ER +KKQ+V  +   +++P+ +L
Sbjct  124  CHVGSPAESPKGERSAKKQRVIMD-GVYSKPEMVL  157



>ref|XP_009396090.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396092.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396093.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
Length=276

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 116/176 (66%), Gaps = 18/176 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+P++S+DG + +KKD  + ISG + SSG QITEALKL
Sbjct  55   VPGLTIYHVKS--HLQKYRLAKYVPESSADGTRSEKKDDDNQISGPESSSGTQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKII+EQQ+L     E+P +        G  
Sbjct  113  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIIDEQQRLSGVLAELPGAGTTAPTPVGHC  172

Query  498  APVSDNSTNPVTPVPASEKP--------ENEQRNPV-KGISLNASPSSHNEALSPD  358
              +    T+P TP PASE P        +N   + + K IS + S SSH E L+PD
Sbjct  173  --LDSEKTDPSTPAPASESPIQDKAIGRDNGDTDAIFKSISCDDSLSSHREPLTPD  226



>gb|ACN85271.1| MYB-CC type transfactor [Oryza alta]
Length=323

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 16/189 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKK+  D+++ ++ SSGM+I EALKL
Sbjct  82   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGAKSDKKELGDLLADIESSSGMEIGEALKL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L   + ES   ++         
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRLSGVLGESGKLSALGPAPGEHY  199

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSH--NEALSPDSSCPA---VERP-  331
             D + T+P TPVP SE P  ++     G  L  + SSH   E L+PDSSC A   +E P 
Sbjct  200  QDSDKTDPSTPVPTSESPIRDK----AGSGLFKTISSHAGREPLTPDSSCRAGSPLESPR  255

Query  330  -SKKQKVSA  307
             SK+ +VS+
Sbjct  256  YSKRIRVSS  264



>ref|XP_006656238.1| PREDICTED: protein PHR1-LIKE 1-like [Oryza brachyantha]
 gb|ACN85317.1| MYB-CC type transfactor [Oryza brachyantha]
Length=332

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 126/198 (64%), Gaps = 28/198 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGTKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L    S    S       PV+ 
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRL---SSVLGESGKLSAPGPVTG  198

Query  483  ------NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALS-------PDSSCPA  343
                  N T P TPVP SE P  ++        L  + SSH++ LS       PDSSC A
Sbjct  199  EHYQDSNRTEPSTPVPTSESPIRDK----AASGLFKTLSSHDDCLSSGREPLTPDSSCHA  254

Query  342  ---VERP---SKKQKVSA  307
               +E P   SK+ +VS 
Sbjct  255  SSPLESPRGASKRIRVSG  272



>ref|XP_002460002.1| hypothetical protein SORBIDRAFT_02g020700 [Sorghum bicolor]
 gb|EER96523.1| hypothetical protein SORBIDRAFT_02g020700 [Sorghum bicolor]
Length=305

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 130/195 (67%), Gaps = 22/195 (11%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PDAS+DG K D KD  D+++GL+ SSG+ I+EALKL
Sbjct  82   VQGLTIYHVKS--HLQKYRLAKYIPDASTDGNKADNKDPGDLLAGLEGSSGLPISEALKL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L     E P + GA+   + + 
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRLTGVKSETP-AGGASVTVSSDQ  198

Query  498  APVSDNSTNPVTPVPASEKPEN---EQRNPVKGISLNASPSSHNEALSPDSSC-------  349
             P S+  T P TP P SE P       R+P  G     + S+ +E L+PDS+C       
Sbjct  199  FPDSER-TEPSTPAPTSESPTQVGASNRDP--GDRTEGTKSTCHEPLTPDSNCQNGSPVA  255

Query  348  -PAVERPSKKQKVSA  307
             P  ER +K+Q+ S 
Sbjct  256  SPNHERAAKRQRGSG  270



>ref|XP_010942495.1| PREDICTED: myb family transcription factor APL isoform X1 [Elaeis 
guineensis]
Length=343

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 124/202 (61%), Gaps = 31/202 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdi----isglddsSGMQITE  676
            V GLTI   K+   +QKYRL+KY+P++SSDG+    K         +SGL++SSG+QITE
Sbjct  85   VPGLTIYHVKS--HLQKYRLAKYIPESSSDGRLQGSKAEKKDPEDLLSGLENSSGIQITE  142

Query  675  ALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenA  496
            ALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L       A +      A
Sbjct  143  ALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL---SGVLAETPGVSIPA  199

Query  495  PVSDNS------TNPVTPVPASEKPENEQ---------RNPVKGISLNASPSSHNEALSP  361
            P+S +       T+P TP P SE P  ++             K +S + S SS  E L+P
Sbjct  200  PISGDHCLDSDKTDPSTPAPTSESPLQDKAASGDHGGTGGLFKSLSRDDSFSSRREPLTP  259

Query  360  DSSC-------PAVERPSKKQK  316
            DSSC       P  ERP K+Q+
Sbjct  260  DSSCRAGSPESPRRERPIKRQR  281



>ref|XP_010526987.1| PREDICTED: uncharacterized protein LOC104804400 [Tarenaya hassleriana]
 ref|XP_010526995.1| PREDICTED: uncharacterized protein LOC104804400 [Tarenaya hassleriana]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GK+ DKK+S D+++ LD SSG QITEALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKQMDKKESGDMLAVLDGSSGTQITEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQ RIEAQGKYLKKIIEEQQ+L        +    G+N+P  D
Sbjct  142  QMEVQKRLHEQLEVQRQLQQRIEAQGKYLKKIIEEQQRLSG-VIGEPSDPREGDNSPEGD  200

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISL-NASPSSHNEALSPDSS  352
            N  +P TP   SE P      ++    K +S+ N S SS+ E L+PDS 
Sbjct  201  NGNDPGTPAAISESPIQDKSGKEGGKEKSLSVDNESLSSYPEPLTPDSG  249



>ref|XP_010244819.1| PREDICTED: myb family transcription factor APL isoform X2 [Nelumbo 
nucifera]
Length=312

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 135/217 (62%), Gaps = 26/217 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI     + S  +YRL+KYLP++++DGKK DKK+ S++ S  D SSGMQIT+ALKL
Sbjct  70   VQGLTIYH---VKSHLQYRLAKYLPESTADGKKSDKKEPSELFSSSDGSSGMQITDALKL  126

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L   + E+  +     G     
Sbjct  127  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGFLGEAPSSIIPVPGSGDNC  186

Query  489  SDNSTNPVTPVPASEKPENEQRN----PVKGISLNASPSSHNEALSPDSS-------CPA  343
             D+ ++P TP P SE P  ++      P K +S N S S H E L+PDS         P 
Sbjct  187  PDSKSDPSTPAPTSEGPIQDKSAKECPPDKSLSCNESSSRH-EPLTPDSGHVSSPVESPK  245

Query  342  VERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQI  232
             +R  K++++S         D + SK +   LT HQI
Sbjct  246  GDRSLKQKRMSI--------DTLCSKKIEVVLT-HQI  273



>gb|EAZ06657.1| hypothetical protein OsI_28909 [Oryza sativa Indica Group]
Length=358

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 26/210 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD S+D  K + KD  +++S L+ SSGMQI+EALKL
Sbjct  133  VPGLTIYHVKS--HLQKYRLAKYIPDPSADDNKDEDKDPGNLLSALEGSSGMQISEALKL  190

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++     +GA+ A++ E  P S 
Sbjct  191  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRV---IGAGASRATSSEQLPDS-  246

Query  483  NSTNPVTPVPASEKP---ENEQRNPVKGISLNASPSSHNEA------LSPDSSC------  349
              TNP TPVP SE P    +  +N    +    SP SH++A      L+PDSSC      
Sbjct  247  VKTNPPTPVPISESPVQGASRSKNSQSQVEPTKSP-SHDDALPCGEPLTPDSSCRPGSPT  305

Query  348  --PAVERPSKKQKVS--AEAAAFTQPDAML  271
              P  ER +K+Q+ S   +  AF   + +L
Sbjct  306  LSPKHERAAKRQRGSDAGDVTAFADGEFVL  335



>ref|XP_007147557.1| hypothetical protein PHAVU_006G1347001g, partial [Phaseolus vulgaris]
 ref|XP_007147558.1| hypothetical protein PHAVU_006G1347001g, partial [Phaseolus vulgaris]
 gb|ESW19551.1| hypothetical protein PHAVU_006G1347001g, partial [Phaseolus vulgaris]
 gb|ESW19552.1| hypothetical protein PHAVU_006G1347001g, partial [Phaseolus vulgaris]
Length=193

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 103/163 (63%), Gaps = 14/163 (9%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgat  520
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L   + E+    
Sbjct  1    GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLSEAPDTG  60

Query  519  sasagenAPVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC---  349
              +        +  T+P TP P  EK   + R P K +S   S SSH+E L+PDS C   
Sbjct  61   VVAVVPGDVCQEPDTDPSTPDP--EKAAKD-RVPAKSLS-GESFSSHHEPLTPDSGCHGG  116

Query  348  -----PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SLTSHQ  235
                 P  ER +KKQ+++ + +   Q   +  ++L  S++S+Q
Sbjct  117  SPADSPKGERSTKKQRLNMDGSYSKQDMVLPLQILESSMSSYQ  159



>ref|XP_010929445.1| PREDICTED: uncharacterized protein LOC105050915 [Elaeis guineensis]
Length=589

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 122/202 (60%), Gaps = 30/202 (15%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL----pdassdgkkpdkkdssdiisglddsSGMQITE  676
            V GLTI   K+   +QKYRL+KY+     D    G    KKDS D++SGL+ SSGMQITE
Sbjct  333  VTGLTIYHVKS--HLQKYRLAKYIPESSSDGRFSGTTAAKKDSGDLLSGLESSSGMQITE  390

Query  675  ALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsas  511
            ALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKI+EEQQ+L     E P +      S
Sbjct  391  ALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIVEEQQRLSGVLAETPGAGFPALIS  450

Query  510  agenAPVSDNSTNPVTPVPASEKPENEQR---------NPVKGISLNASPSSHNEALSPD  358
              +   +  + T+P TP P SE P  ++             K +S + S  S +E L+PD
Sbjct  451  GNQC--LDSDKTDPSTPAPTSESPLQDKAASGEHGGSGGLFKSLSHDDSFLSRHEPLTPD  508

Query  357  SSC--------PAVERPSKKQK  316
            SSC        P  ER +K+Q+
Sbjct  509  SSCRASSPSESPKHERSTKRQR  530



>ref|XP_006857596.1| PREDICTED: uncharacterized protein LOC18447437 [Amborella trichopoda]
 gb|ERN19063.1| hypothetical protein AMTR_s00061p00095620 [Amborella trichopoda]
Length=330

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 131/188 (70%), Gaps = 16/188 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLP++SSDG KPD+K+S+D++S LD +SGMQITEAL++
Sbjct  83   VQGLTIYHVKS--HLQKYRLAKYLPESSSDGTKPDRKESADMLSNLDAASGMQITEALRM  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE-MPessgatsasagenAPVS  487
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L  +   + A    +G++ P  
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRLSGVLAGTPAIVPESGDHMPEP  200

Query  486  DNSTNPVTPVPASEKPENEQRNPVKGISLNA-------SPSSHNEALSPDS----SCPAV  340
            D  T+P TP   SE P  ++  P K   L A       S SS +E  +PDS    S P  
Sbjct  201  DAKTDPATPAVTSEAPLKDE--PTKTKCLVAKSFSQEESFSSRHEPPTPDSGSPGSSPCA  258

Query  339  ERPSKKQK  316
            ERP KKQ+
Sbjct  259  ERPVKKQR  266



>ref|XP_003577958.1| PREDICTED: protein PHR1-LIKE 1-like [Brachypodium distachyon]
 ref|XP_010238039.1| PREDICTED: protein PHR1-LIKE 1-like [Brachypodium distachyon]
Length=281

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 129/203 (64%), Gaps = 20/203 (10%)
 Frame = -2

Query  837  GLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKLQM  658
            GLTI   K+   +QKYRL+KY+PD+S+DG K D KD  D ++GLD SSG+QI+EALKLQM
Sbjct  62   GLTIYHVKS--HLQKYRLAKYIPDSSTDGNKSDNKDPGDSLAGLDGSSGLQISEALKLQM  119

Query  657  EVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagenAP  493
            EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+      E P  +G T+  + +  P
Sbjct  120  EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRYGGIKSETP-GAGGTATVSSDQFP  178

Query  492  VSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPS-SHNEALSPDSSC--------PAV  340
             S+  T+P TP P SE  +        G    A+ S  H+E L+ DS+C        P  
Sbjct  179  DSER-TDPSTPAPTSESSQGVPFKRDNGGQTEATKSPCHDEQLTTDSNCHPGSPTVSPKH  237

Query  339  ERPSKKQKVSAEAAAFTQPDAML  271
            ER +K+Q+       F++ D  L
Sbjct  238  ERAAKRQR--GNGTEFSEADLSL  258



>gb|AHB08877.1| MYB transcription factor [Suaeda glauca]
Length=287

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 114/166 (69%), Gaps = 15/166 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GKK DKK+S D++SGLD S G QITEALKL
Sbjct  52   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKKTDKKESGDVLSGLDGSPGTQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L        +      + PV+ 
Sbjct  110  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL--------SGELGESSGPVTG  161

Query  483  NSTNPVTPVPASEKP----ENEQRNPVKGISLNASPSSHNEALSPD  358
             S +P TP P SE P      ++  P K +S+         AL+PD
Sbjct  162  ES-DPATPAPTSEFPLQGKSGKESGPDKTLSVEGFLFFFRGALTPD  206



>ref|XP_009409861.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409862.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409863.1| PREDICTED: protein PHR1-LIKE 1-like [Musa acuminata subsp. malaccensis]
Length=235

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 10/171 (6%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PD+S+DG K + KD  D+ISGL+ +SG+QITEALKL
Sbjct  55   VPGLTIYHIKS--HLQKYRLAKYIPDSSADGTKLEMKDVGDLISGLESTSGIQITEALKL  112

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEV+KRLHEQLE+Q+QLQ+RIEAQG+YLKK+IEEQQ L    +  + S  A    P SD
Sbjct  113  QMEVKKRLHEQLEIQQQLQVRIEAQGRYLKKMIEEQQLLSGVLAETSGSGVAAATVP-SD  171

Query  483  NSTNPVTPVPASEKPENE-------QRNPVKGISLNASPSSHNEALSPDSS  352
               +P TPVP SE PE +           +KG+  + S S+  E  +PDS 
Sbjct  172  LCPDPSTPVPTSESPEEDLAASSGTGGGSLKGLLQDGSLSATREPPTPDSG  222



>ref|XP_003563637.1| PREDICTED: uncharacterized protein LOC100832625 isoform X2 [Brachypodium 
distachyon]
Length=328

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 118/185 (64%), Gaps = 22/185 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRLSKY+PD ++DG K DKK+  ++++G++ S GM+++EALKL
Sbjct  84   VQGLTICHVKS--HLQKYRLSKYIPDPTADGAKSDKKELGNLLAGIESSPGMELSEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRL +QLEVQRQLQLRIEAQGKYL+KI+EEQQ+L         S +     PV +
Sbjct  142  QMEVQKRLRDQLEVQRQLQLRIEAQGKYLQKIMEEQQRL---TGVLCESGTLNALVPVQE  198

Query  483  -----NSTNPVTPVPASE-------KPENEQRNPVKGI-----SLNASPSSHNEALSPDS  355
                 N T+P+TPVP SE          ++      G+     S +   SS  E L+PDS
Sbjct  199  LRQDFNKTDPLTPVPTSEPLIRDKASTVSDDHEGTDGLLKDLSSHDECHSSGREPLTPDS  258

Query  354  SCPAV  340
            SC A 
Sbjct  259  SCGAA  263



>ref|XP_004956515.1| PREDICTED: protein PHR1-LIKE 1-like [Setaria italica]
Length=313

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 135/222 (61%), Gaps = 30/222 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KY+PDAS+DG K D KD  D+++GL+ SSG+ I+EALKL
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYIPDASTDGNKADNKDPGDLLAGLEGSSGLPISEALKL  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L     E P ++GA+   + + 
Sbjct  141  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRLTGVKSETP-AAGASVTVSSDQ  199

Query  498  APVSDNSTNPVTPVPASEKP--------ENEQRNPVKGISLNASPSSHNEALSPDSSC--  349
             P S+  T P TP P SE P        +  +R      + +    S +E L+PDS+C  
Sbjct  200  FPDSER-TEPSTPAPTSESPTQVGASNRDTGERAEATKSTCHGDSLSRHEPLTPDSNCQN  258

Query  348  ------PAVERPSKKQKVSAE-----AAAFTQPDAMLSKLLG  256
                  P  ER +K+Q+ S          F+ P  +    LG
Sbjct  259  GSPPASPNHERAAKRQRGSGNEFVDVETDFSHPRHIFESSLG  300



>ref|XP_010227515.1| PREDICTED: uncharacterized protein LOC100832625 isoform X1 [Brachypodium 
distachyon]
Length=333

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 118/185 (64%), Gaps = 22/185 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRLSKY+PD ++DG K DKK+  ++++G++ S GM+++EALKL
Sbjct  89   VQGLTICHVKS--HLQKYRLSKYIPDPTADGAKSDKKELGNLLAGIESSPGMELSEALKL  146

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRL +QLEVQRQLQLRIEAQGKYL+KI+EEQQ+L         S +     PV +
Sbjct  147  QMEVQKRLRDQLEVQRQLQLRIEAQGKYLQKIMEEQQRL---TGVLCESGTLNALVPVQE  203

Query  483  -----NSTNPVTPVPASE-------KPENEQRNPVKGI-----SLNASPSSHNEALSPDS  355
                 N T+P+TPVP SE          ++      G+     S +   SS  E L+PDS
Sbjct  204  LRQDFNKTDPLTPVPTSEPLIRDKASTVSDDHEGTDGLLKDLSSHDECHSSGREPLTPDS  263

Query  354  SCPAV  340
            SC A 
Sbjct  264  SCGAA  268



>gb|KCW76590.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
Length=215

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 104/161 (65%), Gaps = 15/161 (9%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsa  514
            GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L    + G+   
Sbjct  41   GMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGALADGSADE  100

Query  513  sagenAPVSDNSTNPVTPVPASEKPENEQRNPV---KGISLNASPSSHN-EALSPDSSC-  349
            S  +     D+ T+P TP P SE P  ++       K +SL+ S SSHN E L+PDS C 
Sbjct  101  SGDKGQ--EDSKTDPPTPAPISESPIQDKSKDCAVAKSLSLDGSLSSHNHEPLTPDSGCN  158

Query  348  -------PAVERPSKKQKVSAEAAAFTQPDAMLSKLLG*SL  247
                   P  ER +KK +V+A  A+  +P+ +L  +   SL
Sbjct  159  VSSPAESPDGERSAKKPRVTA-GASHAKPEIVLHPIFESSL  198



>ref|XP_008796527.1| PREDICTED: protein PHR1-LIKE 1-like [Phoenix dactylifera]
Length=278

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 133/207 (64%), Gaps = 18/207 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+P++SSDG K +KK+  D++S +D+SSGM+ITEALKL
Sbjct  69   VQGLTIYHVKS--HLQKYRLAKYIPESSSDGTKSEKKEPGDLLSTIDNSSGMEITEALKL  126

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRL EQLEVQRQLQLRI+AQGKYLKKI+EEQQ+L   +  +SG  + +     P 
Sbjct  127  QMEVQKRLQEQLEVQRQLQLRIQAQGKYLKKIVEEQQRLSCVLTGASGLGNTATTSGNPN  186

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPS-SHNEALS----PDSSC------P  346
             D + T+P TP   S+ P  ++      ++     S +H+E  S    P+S C      P
Sbjct  187  LDSDKTDPPTPASTSDIPIQDKGTSNHRVNCRLVESLTHDELFSSPMTPNSCCAGSPDSP  246

Query  345  AVERPSKKQKVSA--EAAAFTQPDAML  271
              E+P KKQ+ +   E A  T  + +L
Sbjct  247  KSEQPIKKQQGTGSLENAGSTHANHIL  273



>ref|XP_010559048.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559049.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559051.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559052.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559053.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559054.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
 ref|XP_010559055.1| PREDICTED: probable transcription factor KAN2 [Tarenaya hassleriana]
Length=297

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 130/193 (67%), Gaps = 18/193 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLPD+SS+GK+ DKK+S D +SGLD SS  QITEALKL
Sbjct  56   VQGLTIYHVKS--HLQKYRLAKYLPDSSSEGKRTDKKESVDTLSGLDGSS--QITEALKL  111

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ++        ++    +N P  D
Sbjct  112  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRVNG-VLGETSAPGTSDNFPERD  170

Query  483  NSTNPVTPVPASEKPENEQRNPVKG----ISLNASPSSHNEALSPDSSCP---------A  343
            N+ +P TP P SE P  ++     G    +SL+ S SS+ E L+PDS             
Sbjct  171  NNNDPSTPAPTSESPIQDKSGKECGQEKSLSLDESLSSYREPLTPDSGFDYGSTRESPRG  230

Query  342  VERPSKKQKVSAE  304
             ER SKK +VSA+
Sbjct  231  EERSSKKPRVSAD  243



>gb|EMS49492.1| Myb family transcription factor APL [Triticum urartu]
Length=279

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 122/206 (59%), Gaps = 22/206 (11%)
 Frame = -2

Query  837  GLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKLQM  658
            GLTI   K+   +QKYRL+KY+PD+S+DG K D KD  D ++GLD SSGMQI+EALKLQM
Sbjct  55   GLTIYHVKS--HLQKYRLAKYIPDSSADGNKADNKDPGDSLAGLDGSSGMQISEALKLQM  112

Query  657  EVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD--  484
            EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+         T  +       SD  
Sbjct  113  EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRFGGGGIKSETPGAGATVTASSDQF  172

Query  483  ---NSTNPVTPVPASEKPENE---QRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 T+P TP P SE        +R+         SP      L+ DS+C        P
Sbjct  173  PDSERTDPSTPAPTSESASQGAAFKRDSGSQTEAIKSPCHDEPLLTADSNCHPGSPTLSP  232

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLS  268
              ER +K+Q+ S   A F  P+A LS
Sbjct  233  KHERAAKRQRGS--EAEF--PEAELS  254



>dbj|BAJ96936.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=284

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 132/213 (62%), Gaps = 38/213 (18%)
 Frame = -2

Query  837  GLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKLQM  658
            GLTI   K+   +QKYRL+KY+PD+S+DG K D KD  D ++GLD SSGMQI+EALKLQM
Sbjct  62   GLTIYHVKS--HLQKYRLAKYIPDSSADGNKADNKDPGDSLAGLDGSSGMQISEALKLQM  119

Query  657  EVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagenAP  493
            EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+      E P  +GAT  ++ +  P
Sbjct  120  EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRFGGIKSETP-GAGATVTASSDQFP  178

Query  492  VSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEA----------LSPDSSC--  349
             S+  T+P TP P SE       +  +G +      S  EA          L+ DS+C  
Sbjct  179  DSER-TDPSTPAPTSE-------SASQGAAFKRDSGSQTEAIKSPCHDEPLLTADSNCHP  230

Query  348  ------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                  P  ER +K+Q+ S   A F  P+A LS
Sbjct  231  GSPTLSPKHERAAKRQRSS--DAEF--PEAELS  259



>gb|EMT16677.1| Myb family transcription factor APL [Aegilops tauschii]
Length=279

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 122/206 (59%), Gaps = 22/206 (11%)
 Frame = -2

Query  837  GLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKLQM  658
            GLTI   K+   +QKYRL+KY+PD+S+DG K D KD  D ++GLD SSGMQI+EALKLQM
Sbjct  55   GLTIYHVKS--HLQKYRLAKYIPDSSADGNKADNKDPGDSLAGLDGSSGMQISEALKLQM  112

Query  657  EVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD--  484
            EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+         T  +       SD  
Sbjct  113  EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRFGGGGIKSETPGAGATVTVSSDQF  172

Query  483  ---NSTNPVTPVPASEKPENE---QRNPVKGISLNASPSSHNEALSPDSSC--------P  346
                 T+P TP P SE        +R+         SP      L+ DS+C        P
Sbjct  173  PDSERTDPSTPAPTSESASQGGAFKRDSGSQTEAIKSPCHDEPLLTADSNCHPGSPTLSP  232

Query  345  AVERPSKKQKVSAEAAAFTQPDAMLS  268
              ER +K+Q+ S   A F  P+A LS
Sbjct  233  KHERAAKRQRGS--DAEF--PEAELS  254



>gb|ACN85245.1| MYB-CC type transfactor [Oryza officinalis]
Length=316

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 125/189 (66%), Gaps = 17/189 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGTKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L   + ES   ++         
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQRLSGVLGESGKLSALGPAPGEHY  201

Query  489  SD-NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALS-------PDSSCPAVER  334
             D N T+P TPV  SE P  ++     G  L  + SSH++ LS       PDS   +  R
Sbjct  202  QDSNKTDPSTPVLTSESPIRDK----AGSGLFKTISSHDDCLSTGREPLTPDSPLES-PR  256

Query  333  PSKKQKVSA  307
             SK+ +VS+
Sbjct  257  ASKRIRVSS  265



>dbj|BAK06435.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 132/213 (62%), Gaps = 38/213 (18%)
 Frame = -2

Query  837  GLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKLQM  658
            GLTI   K+   +QKYRL+KY+PD+S+DG K D KD  D ++GLD SSGMQI+EALKLQM
Sbjct  131  GLTIYHVKS--HLQKYRLAKYIPDSSADGNKADNKDPGDSLAGLDGSSGMQISEALKLQM  188

Query  657  EVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagenAP  493
            EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+      E P  +GAT  ++ +  P
Sbjct  189  EVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRFGGIKSETP-GAGATVTASSDQFP  247

Query  492  VSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEA----------LSPDSSC--  349
             S+  T+P TP P SE       +  +G +      S  EA          L+ DS+C  
Sbjct  248  DSER-TDPSTPAPTSE-------SASQGAAFKRDSGSQTEAIKSPCHDEPLLTADSNCHP  299

Query  348  ------PAVERPSKKQKVSAEAAAFTQPDAMLS  268
                  P  ER +K+Q+ S   A F  P+A LS
Sbjct  300  GSPTLSPKHERAAKRQRSS--DAEF--PEAELS  328



>gb|EPS59788.1| hypothetical protein M569_15016, partial [Genlisea aurea]
Length=147

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KYLP++SSDGKK  K +S D++S LDDSSGMQITEALKL
Sbjct  38   VQGLTIYHVKS--HLQKYRLAKYLPESSSDGKKAGKNESGDVLSSLDDSSGMQITEALKL  95

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L
Sbjct  96   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL  134



>gb|EPS73182.1| hypothetical protein M569_01574, partial [Genlisea aurea]
Length=170

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+ +  QKYRL+KYLPD+SSDGK   KK+S D +SGLD SSGMQITEALKL
Sbjct  61   VQGLTIYHVKS-HLQQKYRLAKYLPDSSSDGKNAGKKESGDALSGLDTSSGMQITEALKL  119

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRL EQLEVQRQLQLRIEAQGKYLKKIIEEQQ+L
Sbjct  120  QMEVQKRLQEQLEVQRQLQLRIEAQGKYLKKIIEEQQRL  158



>gb|EPS70357.1| hypothetical protein M569_04405, partial [Genlisea aurea]
Length=157

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            +QGLTI   K+   +QKYRL+KYLPD+S+D    +K +S D++S LD SSGMQITEALKL
Sbjct  52   LQGLTIYHVKS--HLQKYRLAKYLPDSSTDVIIEEKSESGDVLSALDGSSGMQITEALKL  109

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQL+LRIEAQGKYLKKIIEEQ++L
Sbjct  110  QMEVQKRLHEQLEVQRQLELRIEAQGKYLKKIIEEQRRL  148



>ref|XP_009407914.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=230

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 106/170 (62%), Gaps = 23/170 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+ Y+PD+S+DG K + KDS D     ++SSGMQ+TEAL+L
Sbjct  3    VSGLTIYHIKS--HLQKYRLANYIPDSSADGAKSENKDSGDHTMRPENSSGMQMTEALRL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQ KYLKKIIEE Q L     E+P       ++    
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQSKYLKKIIEEHQLLSGEPAELPGVGIYAYSNDNCL  120

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC  349
               SD+ T+P  P P S  P  ++              + ++ L+PDS+C
Sbjct  121  N--SDDKTDPPAPAPTSVSPVQDK--------------AASKPLTPDSTC  154



>gb|EMT01045.1| Myb family transcription factor APL [Aegilops tauschii]
Length=338

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 122/199 (61%), Gaps = 24/199 (12%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++ G K +KKD  ++++G++ S GM+ +E LKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTASGDKLEKKDLGNLLAGIESSPGMETSEVLKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE--MPessgatsasagenAPV  490
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KI+EEQQ+L   + ES    + +  E    
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIMEEQQRLSGVLCESGKMNALALAEEELH  201

Query  489  SDNS-TNPVTPVPASEKPENEQRNPVKGISLNASP------SSHNEALS-------PDSS  352
             D S T P TPV  SE P  +      G  L  +       SSH++ LS       PDSS
Sbjct  202  HDFSKTEPSTPVLTSEPPFRDNAVTASG-DLEGTDELLKVLSSHDDCLSLDREFSTPDSS  260

Query  351  CPA-----VERPSKKQKVS  310
            C A       R SK+ + S
Sbjct  261  CGAGCLLNSPRDSKRARFS  279



>gb|ADE77224.1| unknown [Picea sitchensis]
Length=421

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRLSKYLPD+  DG K +KK+S+DI+S LD +SG+QI+EAL++
Sbjct  84   VQGLTIYHVKS--HLQKYRLSKYLPDSMGDGLKSEKKESTDILSNLDAASGVQISEALQM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQ+EVQRQLQLRIEAQGKYL+KIIEEQQ+L
Sbjct  142  QMEVQKRLHEQIEVQRQLQLRIEAQGKYLQKIIEEQQRL  180



>ref|XP_009407916.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=312

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 106/170 (62%), Gaps = 23/170 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+ Y+PD+S+DG K + KDS D     ++SSGMQ+TEAL+L
Sbjct  85   VSGLTIYHIKS--HLQKYRLANYIPDSSADGAKSENKDSGDHTMRPENSSGMQMTEALRL  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagen  499
            QMEVQKRLHEQLEVQRQLQLRIEAQ KYLKKIIEE Q L     E+P       ++    
Sbjct  143  QMEVQKRLHEQLEVQRQLQLRIEAQSKYLKKIIEEHQLLSGEPAELPGVGIYAYSNDNCL  202

Query  498  APVSDNSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC  349
               SD+ T+P  P P S  P  ++              + ++ L+PDS+C
Sbjct  203  N--SDDKTDPPAPAPTSVSPVQDK--------------AASKPLTPDSTC  236



>ref|XP_003573787.1| PREDICTED: protein PHR1-LIKE 1-like [Brachypodium distachyon]
Length=307

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 121/192 (63%), Gaps = 20/192 (10%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkds-sdiisglddsSGMQITEALK  667
            V GLTI   K+   +QKYRL+KY+PD S+      ++    D+++ L+ SSGM I+EALK
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYIPDPSASDDNKAEERDPGDLLAALEGSSGMPISEALK  141

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVS  487
            LQMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++    ++G + A++ +  P S
Sbjct  142  LQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRI---TAAGPSRATSSDQMPDS  198

Query  486  DNSTNPVTPVPASE-KPENEQRNPVKGISL-----NASPSSHNEALSPDSSCPAV-----  340
            +  TNP TP   SE +     +N    I L     N  P +  + L+PD S P+      
Sbjct  199  ER-TNPSTPGLTSESRVHGSTKNNKNQIELTKSSPNDDPLACRQPLTPDCSRPSSPTLSP  257

Query  339  --ERPSKKQKVS  310
              ERP K+Q+ S
Sbjct  258  EHERPVKRQRGS  269



>ref|XP_010673243.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ SDG K +KK S D ++  D S G+QI EALK+
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYLPESPSDGSKDEKKASIDGLTNTDSSQGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  178



>ref|XP_008788481.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Phoenix dactylifera]
 ref|XP_008788482.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Phoenix dactylifera]
Length=200

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS D +S +D +SG+QI EALK+
Sbjct  3    VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSGDSLSSMDSASGIQINEALKI  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L
Sbjct  61   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQKL  99



>ref|XP_010904695.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Elaeis guineensis]
Length=227

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS+D +S +D +SGMQI EALK+
Sbjct  29   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSADTLSSMDSASGMQINEALKM  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KII+EQQ+L
Sbjct  87   QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIDEQQKL  125



>ref|XP_008788480.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Phoenix dactylifera]
Length=226

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS D +S +D +SG+QI EALK+
Sbjct  29   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSGDSLSSMDSASGIQINEALKI  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L
Sbjct  87   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQKL  125



>ref|XP_010904694.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Elaeis guineensis]
Length=280

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS+D +S +D +SGMQI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSADTLSSMDSASGMQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KII+EQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIDEQQKL  178



>ref|XP_008788479.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Phoenix dactylifera]
Length=279

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS D +S +D +SG+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSGDSLSSMDSASGIQINEALKI  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQKL  178



>ref|XP_010653695.1| PREDICTED: uncharacterized protein LOC100256914 isoform X2 [Vitis 
vinifera]
Length=223

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D  S +D + G+QI EAL+L
Sbjct  3    VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSGSSMDSAPGVQINEALRL  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  61   QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  99



>ref|XP_010922093.1| PREDICTED: protein PHR1-LIKE 1-like [Elaeis guineensis]
Length=279

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS D +S +D +SG+QI+EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPESPTDGSKDEKKDSGDSLSSMDSASGVQISEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL  178



>ref|XP_008786821.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Phoenix dactylifera]
Length=184

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS+D +S +D +SG+QI EALK+
Sbjct  29   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSADTLSSMDSASGIQINEALKM  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KII+EQQ+L
Sbjct  87   QMEVQKRLHEQLEVQRQLQLRIEAQGRYLEKIIDEQQKL  125



>ref|XP_009350627.1| PREDICTED: protein PHR1-LIKE 1-like [Pyrus x bretschneideri]
Length=209

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  3    VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  60

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  61   QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  99



>ref|XP_010653694.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Vitis vinifera]
 emb|CBI32884.3| unnamed protein product [Vitis vinifera]
Length=302

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D  S +D + G+QI EAL+L
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSGSSMDSAPGVQINEALRL  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  178



>ref|XP_010673244.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=236

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    +   G K +KK S D ++  D S G+QI EAL
Sbjct  24   VPGLTIYHVKS--HLQKYRLAKYLPESPSDGTGSKDEKKASIDGLTNTDSSQGLQINEAL  81

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            K+QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  82   KMQMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  122



>emb|CCA29108.1| putative MYB transcription factor [Rosa hybrid cultivar]
Length=294

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  87   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  144

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  145  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  183



>ref|XP_008786820.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Phoenix dactylifera]
Length=237

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLP++ +DG K +KKDS+D +S +D +SG+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSADTLSSMDSASGIQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KII+EQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLEKIIDEQQKL  178



>gb|AHJ09679.1| MYB transcription factor [Tamarix hispida]
Length=285

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLPD+ +DG K +KK S D   GLD S G QI EAL++
Sbjct  81   VPGLTIYHVKS--HLQKYRLAKYLPDSPTDGSKDEKKGSGDDPDGLDSSQGTQINEALRM  138

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  139  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  177



>gb|EEC79447.1| hypothetical protein OsI_20434 [Oryza sativa Indica Group]
Length=224

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + GMQI EALK+
Sbjct  49   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKM  106

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  107  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  145



>gb|ACN85258.1| MYB-CC type transfactor [Oryza alta]
Length=271

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 103/160 (64%), Gaps = 23/160 (14%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            VQGLTI   K+   +QKYRL+KY+PD ++DG K DKKD  D+++ ++ SSGM+I EALKL
Sbjct  84   VQGLTIYHVKS--HLQKYRLAKYIPDPTADGTKSDKKDLGDLLADIESSSGMEIGEALKL  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+ +K+          P +S               
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRQVKR----------PRTSSGEHYQDS-------  184

Query  483  NSTNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALS  364
            N TNP TPVP SE P +++     G  L  + SSH++ LS
Sbjct  185  NKTNPSTPVPTSESPIHDK----AGSGLFKTISSHDDCLS  220



>ref|XP_011461370.1| PREDICTED: protein PHR1-LIKE 1-like [Fragaria vesca subsp. vesca]
Length=344

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  137  VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  194

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  195  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  233



>gb|KCW76589.1| hypothetical protein EUGRSUZ_D00972 [Eucalyptus grandis]
Length=215

 Score = 51.6 bits (122),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 15/128 (12%)
 Frame = -2

Query  594  AQGKYLKKIIEEQQQLEMPessgatsasagenAPVSDNSTNPVTPVPASEKPENEQRNPV  415
            AQGKYLKKIIEEQQ+L    + G+   S  +     D+ T+P TP P SE P  ++    
Sbjct  74   AQGKYLKKIIEEQQRLSGALADGSADESGDKGQ--EDSKTDPPTPAPISESPIQDKSKDC  131

Query  414  ---KGISLNASPSSHN-EALSPDSSC--------PAVERPSKKQKVSAEAAAFTQPDAML  271
               K +SL+ S SSHN E L+PDS C        P  ER +KK +V+A  A+  +P+ +L
Sbjct  132  AVAKSLSLDGSLSSHNHEPLTPDSGCNVSSPAESPDGERSAKKPRVTA-GASHAKPEIVL  190

Query  270  SKLLG*SL  247
              +   SL
Sbjct  191  HPIFESSL  198


 Score = 30.4 bits (67),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 2/54 (4%)
 Frame = -3

Query  797  RNIDFPNTFPMHHLMEKNPTRKIQVI*SPA*MI-HLECK*LRH*NCRWRSKSAY  639
            RNID  N   +  L  K   +K + + SP  M+  + C+ L+  NC+WR KSAY
Sbjct  7    RNIDLQNIC-LTPLTVKKLRKKNRRMCSPTWMVPQVGCRSLKLSNCKWRCKSAY  59



>ref|XP_010673242.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=294

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    +   G K +KK S D ++  D S G+QI EAL
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYLPESPSDGTGSKDEKKASIDGLTNTDSSQGLQINEAL  139

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            K+QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  140  KMQMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  180



>ref|XP_008392505.1| PREDICTED: protein PHR1-LIKE 1-like [Malus domestica]
Length=290

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  142  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  180



>gb|KJB68477.1| hypothetical protein B456_010G247100 [Gossypium raimondii]
Length=413

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 64/124 (52%), Gaps = 18/124 (15%)
 Frame = -2

Query  594  AQGKYLKKIIEEQQ----QLEMPessgatsasagenAPVSDNSTNPVTPVPASEKPENE-  430
            AQGKYLKKIIEEQ+      E P +  +  A        SD  T+P TP P SE P  + 
Sbjct  245  AQGKYLKKIIEEQRLGGVLAEAPGTGASVPALGDNGLE-SDKKTDPATPAPTSESPLQDK  303

Query  429  ---QRNPVKGISLNASPSSHNEALSPDSSC--------PAVERPSKKQKVSAEAAAFTQP  283
               +    K  S++ S SSH+E L+PDS C        P  E   KKQ+VS  A AF +P
Sbjct  304  AAKEGTSAKSHSVDESFSSHHEPLTPDSGCHVGSPAGSPKGEMLKKKQRVSM-AGAFAKP  362

Query  282  DAML  271
            + +L
Sbjct  363  EMVL  366



>ref|NP_001055910.1| Os05g0491500 [Oryza sativa Japonica Group]
 gb|AAT69646.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17824.1| Os05g0491500 [Oryza sativa Japonica Group]
 dbj|BAG88190.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91367.1| unnamed protein product [Oryza sativa Japonica Group]
Length=257

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + GMQI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  178



>ref|XP_006654580.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Oryza brachyantha]
Length=258

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + GMQI EALK+
Sbjct  81   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKM  138

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  139  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  177



>ref|XP_007202402.1| hypothetical protein PRUPE_ppa009512mg [Prunus persica]
 gb|EMJ03601.1| hypothetical protein PRUPE_ppa009512mg [Prunus persica]
Length=289

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQ++L
Sbjct  141  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQEKL  179



>ref|XP_006654581.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Oryza brachyantha]
Length=218

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + GMQI EALK+
Sbjct  41   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKM  98

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  99   QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  137



>ref|XP_007161826.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
 gb|ESW33820.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
Length=217

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +D  K +K++S D  SG D S GM I +AL++
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADDSKDEKRNSGDSFSGADSSPGMPINDALRM  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  87   QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  125



>ref|XP_010251692.1| PREDICTED: myb family transcription factor APL-like [Nelumbo 
nucifera]
Length=296

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KKDS D +S +D + G+QI EAL++
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKDSGDSLSSMDSAPGVQINEALRM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL  180



>gb|EEE64196.1| hypothetical protein OsJ_19028 [Oryza sativa Japonica Group]
Length=266

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + GMQI EALK+
Sbjct  91   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKM  148

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  149  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  187



>ref|XP_008240601.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Prunus mume]
Length=235

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQ++L
Sbjct  87   QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQEKL  125



>ref|XP_008240600.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Prunus mume]
Length=289

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQ++L
Sbjct  141  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQEKL  179



>ref|XP_011620394.1| PREDICTED: protein PHR1-LIKE 1 [Amborella trichopoda]
Length=307

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLPD+ +DG K +KK+SSDI+  ++ + G QI+EAL++
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYLPDSPADGTKDEKKESSDILPNMESAPGAQISEALRM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L
Sbjct  142  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQKL  180



>ref|XP_008385743.1| PREDICTED: protein PHR1-LIKE 1-like [Malus domestica]
Length=290

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+ 
Sbjct  142  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKF  180



>ref|XP_009345372.1| PREDICTED: protein PHR1-LIKE 1-like [Pyrus x bretschneideri]
 ref|XP_009347649.1| PREDICTED: protein PHR1-LIKE 1-like [Pyrus x bretschneideri]
 ref|XP_009347650.1| PREDICTED: protein PHR1-LIKE 1-like [Pyrus x bretschneideri]
Length=290

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D +S  D S G+QI EAL++
Sbjct  84   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSLSCSDSSPGVQINEALRM  141

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+ 
Sbjct  142  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKF  180



>ref|XP_007161824.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
 gb|ESW33818.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
Length=271

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +D  K +K++S D  SG D S GM I +AL++
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADDSKDEKRNSGDSFSGADSSPGMPINDALRM  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  179



>emb|CAN80850.1| hypothetical protein VITISV_004304 [Vitis vinifera]
Length=537

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +KK S D  S +D + G+QI EAL+L
Sbjct  317  VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKKGSGDSGSSMDSAPGVQINEALRL  374

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  375  QMEVQKRLHEQLEVQRQLQMRIEAQGKYLQKIIEEQQKL  413



>ref|XP_003568204.1| PREDICTED: protein PHR1-LIKE 1-like isoform X5 [Brachypodium 
distachyon]
Length=263

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  178



>gb|ACG47379.1| MYB transcription factor [Zea mays]
Length=257

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+PD+ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPDSPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQMIIEEQQKL  178



>ref|XP_006604295.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Glycine max]
Length=270

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +D  K +K+ S D ISG D SSGM I +AL++
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADDPKDEKRMSGDSISGADSSSGMPINDALRM  140

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  179



>ref|XP_003522212.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Glycine max]
 ref|XP_006576289.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Glycine max]
Length=265

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +D  K +K++S D ISG D S GM I +AL++
Sbjct  73   VPGLTIYHVKS--HLQKYRLAKYLPESPADDSKVEKRNSGDSISGADSSPGMPINDALRM  130

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  131  QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  169



>ref|XP_001780003.1| predicted protein [Physcomitrella patens]
 gb|EDQ55212.1| predicted protein [Physcomitrella patens]
Length=795

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiis-glddsSGMQITEALK  667
            VQGLTI   K+   +QKYRL+KY+P++ SDG K DKK +   +   LD +SG+QITEAL+
Sbjct  415  VQGLTIYHVKS--HLQKYRLAKYIPESLSDGGKSDKKKNQADLLPALDATSGIQITEALR  472

Query  666  LQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            +QMEVQKRLHEQLEVQR LQLRIEAQGKYL+KIIEEQQ++
Sbjct  473  MQMEVQKRLHEQLEVQRHLQLRIEAQGKYLQKIIEEQQRV  512



>ref|XP_004493286.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Cicer arietinum]
Length=268

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D  SG + S G+QI +AL
Sbjct  72   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKDEKRNSGDSNSGAESSPGLQINDAL  129

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  130  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  170



>ref|NP_001140465.1| uncharacterized protein LOC100272524 [Zea mays]
 ref|XP_008647496.1| PREDICTED: uncharacterized protein LOC100272524 isoform X1 [Zea 
mays]
 ref|XP_008647497.1| PREDICTED: uncharacterized protein LOC100272524 isoform X1 [Zea 
mays]
 gb|ACF78173.1| unknown [Zea mays]
 gb|ACF83895.1| unknown [Zea mays]
 gb|AFU81646.1| G2-like transcription factor, partial [Zea mays subsp. mays]
 gb|AFW78489.1| putative MYB DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW78490.1| putative MYB DNA-binding domain superfamily protein isoform 2 
[Zea mays]
 gb|AFW78491.1| putative MYB DNA-binding domain superfamily protein isoform 3 
[Zea mays]
Length=257

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+PD+ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPDSPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQMIIEEQQKL  178



>ref|XP_004493287.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Cicer arietinum]
Length=225

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D  SG + S G+QI +AL
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKDEKRNSGDSNSGAESSPGLQINDAL  86

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  87   RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  127



>gb|AAU06822.1| MYB transcription factor [Triticum aestivum]
Length=266

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD  S  D + G QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSFSNADSAPGSQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYL+ IIEEQQ+L      G+       + P  D
Sbjct  140  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLQMIIEEQQKLGG-SLEGSEERKLSHSPPTLD  198

Query  483  NSTNPVTPVPASEKPENEQRNPVKGIS  403
            +  + + P P   + ++   + V+G++
Sbjct  199  DYPDSIQPSPKKPRLDDLSTDAVRGVT  225



>ref|XP_002441302.1| hypothetical protein SORBIDRAFT_09g024090 [Sorghum bicolor]
 gb|EES19732.1| hypothetical protein SORBIDRAFT_09g024090 [Sorghum bicolor]
Length=265

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQMIIEEQQKL  178



>ref|XP_004493285.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Cicer arietinum]
Length=279

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D  SG + S G+QI +AL
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKDEKRNSGDSNSGAESSPGLQINDAL  140

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  181



>ref|XP_004961661.1| PREDICTED: protein PHR1-LIKE 1-like [Setaria italica]
Length=265

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQMIIEEQQKL  178



>gb|ACU19386.1| unknown [Glycine max]
Length=202

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   ++KYRL+KYLP++ +D  K +K+ S D ISG D SSGM I +AL++
Sbjct  15   VPGLTIYHVKS--HLRKYRLAKYLPESPADDPKDEKRMSGDSISGADSSSGMPINDALRM  72

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  73   QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  111



>ref|XP_011652143.1| PREDICTED: protein PHR1-LIKE 1 isoform X2 [Cucumis sativus]
Length=157

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +K+ S  +      S G+QI EAL++
Sbjct  3    VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKRSSESLSGTDSSS-GLQINEALRM  59

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRL EQLEVQRQLQ+RIEAQ KYL+KIIEEQQ+L
Sbjct  60   QMEVQKRLQEQLEVQRQLQMRIEAQAKYLQKIIEEQQKL  98



>ref|XP_003624829.1| Myb family transcription factor APL [Medicago truncatula]
 gb|ABD28665.2| Peptidase M22, glycoprotease; Homeodomain-related [Medicago truncatula]
Length=268

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL          K +K++S D ISG D S G+QI +AL
Sbjct  76   VPGLTIYHVKS--HLQKYRLAKYLPESPGDGKDSKDEKRNSGDSISGADSSPGLQINDAL  133

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  134  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  174



>ref|XP_010231226.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Brachypodium 
distachyon]
Length=311

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + G+QI EALK+
Sbjct  130  VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGLQINEALKM  187

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  188  QMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  226



>gb|AES81047.2| myb-like transcription factor family protein [Medicago truncatula]
Length=279

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL          K +K++S D ISG D S G+QI +AL
Sbjct  87   VPGLTIYHVKS--HLQKYRLAKYLPESPGDGKDSKDEKRNSGDSISGADSSPGLQINDAL  144

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  145  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  185



>dbj|BAJ86396.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KY+P++ ++G K +KKDSSD +S  D + G QI EALK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKEEKKDSSDSLSNTDSAPGSQINEALKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  140  QMEVQKRLHEQLEVQKQLQLRIEAQGKYLQMIIEEQQKL  178



>ref|XP_008443160.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Cucumis melo]
Length=178

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +K+ S  +      S G+QI EAL++
Sbjct  24   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKRSSESLSGTDSSS-GLQINEALRM  80

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRL EQLEVQRQLQ+RIEAQ KYL+KIIEEQQ+L
Sbjct  81   QMEVQKRLQEQLEVQRQLQMRIEAQAKYLQKIIEEQQKL  119



>ref|XP_009387473.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=268

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLPD+ +DG K DKKDS    S  D +   Q  E+LK+
Sbjct  71   VPGITIYHVKS--HLQKYRLAKYLPDSPADGSKDDKKDSGHTHSDTDSAPSAQFNESLKM  128

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L    S       +  + P+SD
Sbjct  129  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL----SGVVQKHKSSLSLPISD  184

Query  483  NSTNP  469
            ++ NP
Sbjct  185  SNRNP  189



>ref|XP_009387469.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=279

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLPD+ +DG K DKKDS    S  D +   Q  E+LK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPDSPADGSKDDKKDSGHTHSDTDSAPSAQFNESLKM  139

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L    S       +  + P+SD
Sbjct  140  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL----SGVVQKHKSSLSLPISD  195

Query  483  NSTNP  469
            ++ NP
Sbjct  196  SNRNP  200



>gb|ABR16946.1| unknown [Picea sitchensis]
Length=400

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            +Q LTI   K+   +QK+RL++Y+P +  DG+   +K+++ I+S LD  SG+QIT+ALK+
Sbjct  77   IQWLTIYQVKS--HLQKFRLARYIPGSMDDGQNTGRKETTGILSNLDARSGIQITDALKM  134

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQ RLHEQLEVQRQLQ RIEAQGKY +KI+EEQQ+L
Sbjct  135  QMEVQTRLHEQLEVQRQLQQRIEAQGKYFQKILEEQQRL  173



>ref|XP_008443159.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Cucumis melo]
Length=236

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +K+ S  +      S G+QI EAL++
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKRSSESLSGTDSSS-GLQINEALRM  138

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRL EQLEVQRQLQ+RIEAQ KYL+KIIEEQQ+L
Sbjct  139  QMEVQKRLQEQLEVQRQLQMRIEAQAKYLQKIIEEQQKL  177



>ref|XP_004136602.1| PREDICTED: protein PHR1-LIKE 1 isoform X1 [Cucumis sativus]
 gb|KGN59367.1| hypothetical protein Csa_3G814340 [Cucumis sativus]
Length=236

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++ +DG K +K+ S  +      S G+QI EAL++
Sbjct  82   VPGLTIYHVKS--HLQKYRLAKYLPESPADGSKDEKRSSESLSGTDSSS-GLQINEALRM  138

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRL EQLEVQRQLQ+RIEAQ KYL+KIIEEQQ+L
Sbjct  139  QMEVQKRLQEQLEVQRQLQMRIEAQAKYLQKIIEEQQKL  177



>ref|XP_009387471.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLPD+ +DG K DKKDS    S  D +   Q  E+LK+
Sbjct  29   VPGITIYHVKS--HLQKYRLAKYLPDSPADGSKDDKKDSGHTHSDTDSAPSAQFNESLKM  86

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L    S       +  + P+SD
Sbjct  87   QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL----SGVVQKHKSSLSLPISD  142

Query  483  NSTNP  469
            ++ NP
Sbjct  143  SNRNP  147



>gb|AES81048.2| myb-like transcription factor family protein [Medicago truncatula]
Length=275

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 4/99 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V GLTI   K+   +QKYRL+KYLP++     +      S   +      G+QI +AL++
Sbjct  87   VPGLTIYHVKS--HLQKYRLAKYLPESPDSKDEKRNSGDSISGADSSP--GLQINDALRM  142

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  143  QMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  181



>ref|XP_007161825.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
 gb|ESW33819.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
Length=219

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D  SG D S GM I +AL
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKDEKRNSGDSFSGADSSPGMPINDAL  86

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  87   RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  127



>ref|XP_007161823.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
 gb|ESW33817.1| hypothetical protein PHAVU_001G101100g [Phaseolus vulgaris]
Length=273

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D  SG D S GM I +AL
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKDEKRNSGDSFSGADSSPGMPINDAL  140

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  181



>ref|XP_006576290.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Glycine max]
Length=223

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D ISG D S GM I +AL
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKVEKRNSGDSISGADSSPGMPINDAL  86

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  87   RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  127



>gb|KHN34587.1| Myb family transcription factor APL [Glycine soja]
Length=261

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K+ S D ISG D SSGM I +AL
Sbjct  72   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDPKDEKRMSGDSISGADSSSGMPINDAL  129

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  130  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  170



>ref|XP_003554081.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Glycine max]
 ref|XP_006604294.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Glycine max]
Length=272

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K+ S D ISG D SSGM I +AL
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDPKDEKRMSGDSISGADSSSGMPINDAL  140

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  181



>ref|XP_006576288.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Glycine max]
 ref|XP_006576291.1| PREDICTED: protein PHR1-LIKE 1-like isoform X5 [Glycine max]
 gb|KHN42147.1| Myb family transcription factor APL [Glycine soja]
Length=267

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K++S D ISG D S GM I +AL
Sbjct  73   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDSKVEKRNSGDSISGADSSPGMPINDAL  130

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  131  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  171



>ref|XP_006604296.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Glycine max]
Length=218

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K+ S D ISG D SSGM I +AL
Sbjct  29   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDPKDEKRMSGDSISGADSSSGMPINDAL  86

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  87   RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  127



>ref|NP_001276140.1| protein PHR1-LIKE 1-like [Glycine max]
 gb|ADN05765.1| MYB transcription factor [Glycine max]
Length=272

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--pdassdgkkpdkkdssdiisglddsSGMQITEAL  670
            V GLTI   K+   +QKYRL+KYL    A     K +K+ S D ISG D SSGM I +AL
Sbjct  83   VPGLTIYHVKS--HLQKYRLAKYLPESPADGKDPKDEKRMSGDSISGADSSSGMPINDAL  140

Query  669  KLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            ++QMEVQKRLHEQLEVQ+QLQ+RIEAQGKYL+KIIEEQQ+L
Sbjct  141  RMQMEVQKRLHEQLEVQKQLQMRIEAQGKYLQKIIEEQQKL  181



>ref|NP_001175530.1| Os08g0346500 [Oryza sativa Japonica Group]
 dbj|BAH94258.1| Os08g0346500 [Oryza sativa Japonica Group]
Length=175

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -2

Query  693  GMQITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            GMQI+EALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ++
Sbjct  84   GMQISEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRV  132



>ref|NP_001058503.1| Os06g0703900 [Oryza sativa Japonica Group]
 dbj|BAD54045.1| putative transfactor [Oryza sativa Japonica Group]
 dbj|BAF20417.1| Os06g0703900 [Oryza sativa Japonica Group]
 dbj|BAG90678.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87524.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66318.1| hypothetical protein OsJ_22555 [Oryza sativa Japonica Group]
Length=479

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 94/176 (53%), Gaps = 35/176 (20%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL---pdassdgkkpdkkdssdiisglddsSGMQITEA  673
            V+GLTI   K+   +QKYRL+KYL    +      +  K  S    +       +Q+ EA
Sbjct  306  VEGLTIYHVKS--HLQKYRLAKYLPETKEDKKASSEDKKSQSGSSGNDSVKKKNLQVAEA  363

Query  672  LKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAP  493
            L++QMEVQK+LHEQLEVQRQLQLRIE   +YL++I+EEQ ++                  
Sbjct  364  LRMQMEVQKQLHEQLEVQRQLQLRIEEHARYLQRILEEQHKVS-----------------  406

Query  492  VSDNS--------TNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC  349
            +S NS        + P +P P SEK E E      G + +A PSS ++  SPD+ C
Sbjct  407  ISSNSLSLKPPAESQPESPKPTSEKKEAESE---AGAATSAQPSSEDK--SPDAEC  457



>gb|EEC81275.1| hypothetical protein OsI_24378 [Oryza sativa Indica Group]
Length=479

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 94/176 (53%), Gaps = 35/176 (20%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL---pdassdgkkpdkkdssdiisglddsSGMQITEA  673
            V+GLTI   K+   +QKYRL+KYL    +      +  K  S    +       +Q+ EA
Sbjct  306  VEGLTIYHVKS--HLQKYRLAKYLPETKEDKKASSEDKKSQSGSSGNDSVKKKNLQVAEA  363

Query  672  LKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAP  493
            L++QMEVQK+LHEQLEVQRQLQLRIE   +YL++I+EEQ ++                  
Sbjct  364  LRMQMEVQKQLHEQLEVQRQLQLRIEEHARYLQRILEEQHKVS-----------------  406

Query  492  VSDNS--------TNPVTPVPASEKPENEQRNPVKGISLNASPSSHNEALSPDSSC  349
            +S NS        + P +P P SEK E E      G + +A PSS ++  SPD+ C
Sbjct  407  ISSNSLSLKPPAESQPESPKPTSEKKEAESE---AGAATSAQPSSEDK--SPDAEC  457



>tpg|DAA60955.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=172

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 81/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  660  MEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL-----EMPessgatsasagenA  496
            MEVQKRLHEQLEVQRQLQLRIEAQGKYL+KIIEEQQ+L     E P + GA+   + +  
Sbjct  1    MEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQRLTGVKSETP-AGGASVTVSSDQF  59

Query  495  PVSDNSTNPVTPVPASEKP--------ENEQRNPVKGISLNASPSSHNEALSPDSSC---  349
            P S+  T P TP PASE P        +   R      + +    S NE L+PDS+C   
Sbjct  60   PDSER-TEPSTPAPASESPTQVGASNRDTGDRTEATKSTCHGDSLSRNEPLTPDSNCQNG  118

Query  348  -----PAVERPSKKQKVSA  307
                 P  ER +K+Q+ S 
Sbjct  119  SPVASPNHERAAKRQRGSG  137



>ref|XP_010231227.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Brachypodium 
distachyon]
 ref|XP_010231228.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Brachypodium 
distachyon]
Length=271

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--------pdassdgkkpdkkdssdiisglddsSGM  688
            V G+TI   K+   +QKYRL+KY+         D   D         S          G+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPKILHLSFRGL  139

Query  687  QITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QI EALK+QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  140  QINEALKMQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  186



>gb|EMT09301.1| Myb family transcription factor APL [Aegilops tauschii]
Length=303

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 96/150 (64%), Gaps = 6/150 (4%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLp---dassdgkkpdkkdssdiisglddsSGMQITEA  673
            V G+TI   K+   +QKYRL+KY+P     +  G K +KKDSSD  S  D + G QI EA
Sbjct  116  VPGITIYHVKS--HLQKYRLAKYIPESPAEACVGSKDEKKDSSDSFSNADSAPGSQINEA  173

Query  672  LKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAP  493
            LK+QMEVQKRLHEQLEVQ+QLQLRIEAQGKYL+ IIEEQQ+L      G+       + P
Sbjct  174  LKMQMEVQKRLHEQLEVQKQLQLRIEAQGKYLQMIIEEQQKLG-GSLEGSEERKLSHSPP  232

Query  492  VSDNSTNPVTPVPASEKPENEQRNPVKGIS  403
              D+  + + P P   + ++   + V+G++
Sbjct  233  TLDDYPDSIQPSPKKPRLDDLSTDAVRGVA  262



>gb|ABR16154.1| unknown [Picea sitchensis]
Length=565

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 68/107 (64%), Gaps = 9/107 (8%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisgldds-------SGMQ  685
            V+GLTI   K+   +QKYR++KY+PD              D      D        +GMQ
Sbjct  333  VEGLTIYHVKS--HLQKYRIAKYMPDQGEGKTSCYAAGKEDKKRNSSDDLPTLDLKAGMQ  390

Query  684  ITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLE  544
            ITEAL+LQME+QK+LHEQLEVQR LQL+IE  GKYL+K+ EEQQ+ +
Sbjct  391  ITEALRLQMEMQKKLHEQLEVQRALQLKIEEHGKYLQKMFEEQQKTD  437



>ref|XP_009387470.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYLpdassdgkkpdkkdssdiisglddsSGMQITEALKL  664
            V G+TI   K+   +QKYRL+KYLPD+ +DG K DKKDS    S  D +   Q  E+LK+
Sbjct  82   VPGITIYHVKS--HLQKYRLAKYLPDSPADGSKDDKKDSGHTHSDTDSAPA-QFNESLKM  138

Query  663  QMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQLEMPessgatsasagenAPVSD  484
            QMEVQKRLHEQLEVQRQLQLRIEAQG+YL+KIIEEQQ+L    S       +  + P+SD
Sbjct  139  QMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQKL----SGVVQKHKSSLSLPISD  194

Query  483  NSTNP  469
            ++ NP
Sbjct  195  SNRNP  199



>ref|XP_010231229.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Brachypodium 
distachyon]
Length=268

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--------pdassdgkkpdkkdssdiisglddsSGM  688
            V G+TI   K+   +QKYRL+KY+         D   D         S          G+
Sbjct  79   VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPKILHLSFRGL  136

Query  687  QITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QI EALK+QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  137  QINEALKMQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  183



>ref|XP_003568205.2| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Brachypodium 
distachyon]
Length=319

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -2

Query  843  VQGLTIIM*KAIYSIQKYRLSKYL--------pdassdgkkpdkkdssdiisglddsSGM  688
            V G+TI   K+   +QKYRL+KY+         D   D         S          G+
Sbjct  130  VPGITIYHVKS--HLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPKILHLSFRGL  187

Query  687  QITEALKLQMEVQKrlheqlevqrqlqlriEAQGKYLKKIIEEQQQL  547
            QI EALK+QMEVQKRLHEQLEVQRQLQLRIEAQGKYL+ IIEEQQ+L
Sbjct  188  QINEALKMQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKL  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826294691389