BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4149

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    294   6e-93   Ricinus communis
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      292   5e-92   Sesamum indicum [beniseed]
ref|XP_007017515.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    287   9e-92   
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    288   9e-91   
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    288   1e-90   
ref|XP_012071830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    286   6e-90   Jatropha curcas
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                286   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      286   3e-89   Nelumbo nucifera [Indian lotus]
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 284   8e-89   Morus notabilis
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    283   9e-89   Ricinus communis
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    282   4e-88   Vitis vinifera
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 281   1e-87   
ref|XP_008377338.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    281   1e-87   Malus domestica [apple tree]
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    280   2e-87   
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             280   3e-87   
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      279   5e-87   Cucumis melo [Oriental melon]
gb|KJB32498.1|  hypothetical protein B456_005G243100                    274   6e-87   Gossypium raimondii
emb|CDP07525.1|  unnamed protein product                                279   7e-87   Coffea canephora [robusta coffee]
gb|KHG11479.1|  hypothetical protein F383_06303                         278   9e-87   Gossypium arboreum [tree cotton]
emb|CAN61862.1|  hypothetical protein VITISV_043447                     278   1e-86   Vitis vinifera
gb|KDO49091.1|  hypothetical protein CISIN_1g0122621mg                  269   3e-86   Citrus sinensis [apfelsine]
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             276   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_012069916.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      276   4e-86   Jatropha curcas
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    276   5e-86   Populus euphratica
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    276   5e-86   Populus euphratica
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    276   6e-86   Pyrus x bretschneideri [bai li]
ref|XP_006423251.1|  hypothetical protein CICLE_v10028372mg             276   7e-86   Citrus clementina [clementine]
gb|KJB32496.1|  hypothetical protein B456_005G243100                    275   9e-86   Gossypium raimondii
ref|XP_008457927.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    276   1e-85   Cucumis melo [Oriental melon]
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    276   1e-85   Populus euphratica
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    273   6e-85   Nelumbo nucifera [Indian lotus]
ref|XP_008220789.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      274   8e-85   Prunus mume [ume]
gb|KJB34916.1|  hypothetical protein B456_006G090600                    273   1e-84   Gossypium raimondii
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      273   1e-84   Cucumis sativus [cucumbers]
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             273   1e-84   
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      273   2e-84   Vitis vinifera
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             271   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_004148850.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    272   3e-84   Cucumis sativus [cucumbers]
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             272   3e-84   Prunus persica
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      271   5e-84   Prunus mume [ume]
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    270   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_004230886.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      270   2e-83   Solanum lycopersicum
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      270   2e-83   Pyrus x bretschneideri [bai li]
gb|KCW67838.1|  hypothetical protein EUGRSUZ_F01563                     266   2e-83   Eucalyptus grandis [rose gum]
ref|NP_001275210.1|  glucan endo-1,3-beta-D-glucosidase-like prec...    268   8e-83   Solanum tuberosum [potatoes]
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    268   9e-83   Malus domestica [apple tree]
gb|KHN33758.1|  Glucan endo-1,3-beta-glucosidase 7                      265   2e-82   Glycine soja [wild soybean]
ref|XP_010060942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    267   3e-82   Eucalyptus grandis [rose gum]
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      267   3e-82   Fragaria vesca subsp. vesca
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      267   3e-82   Tarenaya hassleriana [spider flower]
gb|KHN20071.1|  Glucan endo-1,3-beta-glucosidase 7                      266   3e-82   Glycine soja [wild soybean]
ref|XP_009605959.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    267   4e-82   Nicotiana tomentosiformis
ref|XP_006581121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    266   4e-82   
ref|XP_006581120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    267   4e-82   
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    266   5e-82   Glycine max [soybeans]
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    266   7e-82   Vitis vinifera
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      265   1e-81   Elaeis guineensis
ref|XP_009804916.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    265   2e-81   Nicotiana sylvestris
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        265   2e-81   Elaeis guineensis
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    265   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      264   2e-81   Phoenix dactylifera
ref|XP_004500813.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    263   4e-81   Cicer arietinum [garbanzo]
gb|AES74164.2|  glucan endo-1,3-beta-glucosidase-like protein           258   8e-81   Medicago truncatula
gb|KHN20986.1|  Glucan endo-1,3-beta-glucosidase 7                      258   2e-80   Glycine soja [wild soybean]
ref|XP_008377425.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    262   2e-80   
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             262   2e-80   Phaseolus vulgaris [French bean]
gb|KJB32499.1|  hypothetical protein B456_005G243100                    262   3e-80   Gossypium raimondii
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      262   6e-80   Fragaria vesca subsp. vesca
ref|XP_003603912.1|  Glucan endo-1,3-beta-glucosidase                   259   1e-79   Medicago truncatula
ref|XP_007160762.1|  hypothetical protein PHAVU_001G014900g             259   2e-79   Phaseolus vulgaris [French bean]
ref|XP_003603913.1|  Glucan endo-1,3-beta-glucosidase                   259   3e-79   
ref|XP_004507424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   3e-79   Cicer arietinum [garbanzo]
ref|XP_003544417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   3e-79   Glycine max [soybeans]
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   258   4e-79   Medicago truncatula
gb|KJB58293.1|  hypothetical protein B456_009G202900                    259   4e-79   Gossypium raimondii
gb|EPS59066.1|  hypothetical protein M569_15744                         258   5e-79   Genlisea aurea
gb|KHG04672.1|  hypothetical protein F383_30229                         256   3e-78   Gossypium arboreum [tree cotton]
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    257   4e-78   
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      257   5e-78   Tarenaya hassleriana [spider flower]
gb|AIR93908.1|  glucanase                                               255   8e-78   Cicer arietinum [garbanzo]
ref|XP_008375942.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    256   9e-78   
ref|XP_006856026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      253   4e-77   Amborella trichopoda
gb|KHN25369.1|  Glucan endo-1,3-beta-glucosidase 7                      248   1e-76   Glycine soja [wild soybean]
sp|Q94G86.1|ALL9_OLEEU  RecName: Full=Glucan endo-1,3-beta-D-gluc...    252   1e-76   Olea europaea
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             252   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010060941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    251   7e-76   Eucalyptus grandis [rose gum]
ref|XP_004499144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   9e-76   Cicer arietinum [garbanzo]
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             246   2e-74   Phaseolus vulgaris [French bean]
gb|ACN26761.1|  unknown                                                 241   4e-74   Zea mays [maize]
gb|KEH40123.1|  glucan endo-1,3-beta-glucosidase-like protein           246   5e-74   Medicago truncatula
emb|CDX75437.1|  BnaA01g02650D                                          246   5e-74   
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      246   1e-73   Brassica rapa
emb|CDX69064.1|  BnaC01g03890D                                          245   2e-73   
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             244   4e-73   
ref|XP_010690894.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    244   7e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             243   9e-73   Capsella rubella
gb|AIR93913.1|  glucanase                                               242   9e-73   Cicer arietinum [garbanzo]
ref|XP_004499143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   1e-72   
ref|NP_001148381.1|  glucan endo-1,3-beta-glucosidase 7 precursor       241   1e-72   Zea mays [maize]
ref|XP_006283912.1|  hypothetical protein CARUB_v10005030mg             239   2e-72   
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    242   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KJB58294.1|  hypothetical protein B456_009G202900                    240   9e-72   Gossypium raimondii
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    240   1e-71   Arabis alpina [alpine rockcress]
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    240   1e-71   Camelina sativa [gold-of-pleasure]
ref|NP_179219.4|  O-glycosyl hydrolases family 17 protein               240   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KDO84535.1|  hypothetical protein CISIN_1g040787mg                   238   2e-71   Citrus sinensis [apfelsine]
ref|XP_006434974.1|  hypothetical protein CICLE_v10003630mg             238   2e-71   
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      239   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    238   6e-71   Brassica rapa
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   7e-71   Brassica rapa
gb|KEH40124.1|  glucan endo-1,3-beta-glucosidase-like protein           237   1e-70   Medicago truncatula
ref|XP_002466692.1|  hypothetical protein SORBIDRAFT_01g012380          236   3e-70   
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   5e-70   
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    236   6e-70   
gb|KEH40125.1|  glucan endo-1,3-beta-glucosidase-like protein           234   1e-69   Medicago truncatula
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    233   4e-69   
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   8e-69   Setaria italica
gb|AAD22313.1|  putative beta-1,3-glucanase                             230   3e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72483.1|  BnaC07g45050D                                          237   5e-68   
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               228   2e-67   
emb|CDY26761.1|  BnaC09g08880D                                          229   2e-67   Brassica napus [oilseed rape]
dbj|BAJ87172.1|  predicted protein                                      228   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS60868.1|  Glucan endo-1,3-beta-glucosidase 7                      224   3e-67   Triticum urartu
gb|AAP44659.1|  putative beta 1,3-glucanase                             227   7e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009123249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      228   7e-67   Brassica rapa
ref|NP_001141090.1|  uncharacterized protein LOC100273173               223   8e-67   
ref|XP_010690895.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    227   8e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY91326.1|  hypothetical protein OsI_12942                          226   2e-66   Oryza sativa Indica Group [Indian rice]
emb|CDY45313.1|  BnaA03g52860D                                          233   3e-66   Brassica napus [oilseed rape]
ref|XP_008681422.1|  PREDICTED: uncharacterized protein LOC100273...    224   9e-66   
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    224   1e-65   
gb|EMT27870.1|  Glucan endo-1,3-beta-glucosidase 7                      219   3e-65   
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    219   7e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681421.1|  PREDICTED: uncharacterized protein LOC100273...    214   4e-62   
gb|ABK25242.1|  unknown                                                 210   3e-60   Picea sitchensis
gb|ABK24319.1|  unknown                                                 207   2e-59   Picea sitchensis
gb|ADE76367.1|  unknown                                                 204   3e-58   Picea sitchensis
ref|XP_012071831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   1e-57   Jatropha curcas
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    201   3e-57   Nelumbo nucifera [Indian lotus]
emb|CDP21469.1|  unnamed protein product                                199   1e-56   Coffea canephora [robusta coffee]
emb|CAN83700.1|  hypothetical protein VITISV_027546                     195   4e-56   Vitis vinifera
emb|CBI31680.3|  unnamed protein product                                196   1e-55   Vitis vinifera
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        195   4e-55   Vitis vinifera
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    195   1e-54   Ricinus communis
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        192   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    193   1e-53   Prunus mume [ume]
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             192   2e-53   Prunus persica
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    191   2e-53   
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    191   2e-53   Populus euphratica
ref|XP_011658156.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        190   8e-53   Cucumis sativus [cucumbers]
ref|XP_010091148.1|  Glucan endo-1,3-beta-glucosidase                   184   9e-53   
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    190   1e-52   Cicer arietinum [garbanzo]
ref|XP_006827757.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        189   1e-52   
ref|XP_002312098.1|  glucan endo-1 family protein                       189   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    189   2e-52   
ref|XP_012075958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   3e-52   Jatropha curcas
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    187   4e-52   Phoenix dactylifera
ref|XP_006846179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        187   8e-52   Amborella trichopoda
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    187   2e-51   Populus euphratica
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    187   2e-51   Populus euphratica
ref|XP_012089256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    185   2e-51   Jatropha curcas
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        186   3e-51   Nelumbo nucifera [Indian lotus]
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    185   3e-51   Arabis alpina [alpine rockcress]
ref|XP_012089248.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    185   4e-51   
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        186   4e-51   Fragaria vesca subsp. vesca
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    185   9e-51   Fragaria vesca subsp. vesca
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                184   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    184   1e-50   Sesamum indicum [beniseed]
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        186   1e-50   
emb|CDP00093.1|  unnamed protein product                                183   2e-50   Coffea canephora [robusta coffee]
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    183   2e-50   Populus euphratica
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   184   2e-50   
gb|ERM95173.1|  hypothetical protein AMTR_s00009p00263650               182   7e-50   Amborella trichopoda
ref|XP_012075168.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    182   8e-50   Jatropha curcas
gb|ACJ84511.1|  unknown                                                 180   8e-50   Medicago truncatula
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        181   2e-49   Gossypium arboreum [tree cotton]
ref|XP_006653891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    179   2e-49   
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             180   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    180   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    179   1e-48   Eucalyptus grandis [rose gum]
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    179   1e-48   Pyrus x bretschneideri [bai li]
gb|KJB37375.1|  hypothetical protein B456_006G202300                    179   1e-48   Gossypium raimondii
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    178   1e-48   
gb|ABK95730.1|  unknown                                                 178   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    179   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        179   1e-48   Eucalyptus grandis [rose gum]
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        178   1e-48   
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    178   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    178   2e-48   Solanum tuberosum [potatoes]
ref|XP_012075957.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   2e-48   Jatropha curcas
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    177   2e-48   Elaeis guineensis
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    178   2e-48   
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                    177   3e-48   Arabis alpina [alpine rockcress]
ref|NP_001151529.1|  LOC100285163 precursor                             177   3e-48   Zea mays [maize]
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    178   3e-48   Citrus sinensis [apfelsine]
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    177   3e-48   Solanum lycopersicum
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    177   3e-48   Elaeis guineensis
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   177   4e-48   Medicago truncatula
emb|CDX87130.1|  BnaC09g04450D                                          177   5e-48   
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            177   5e-48   
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   6e-48   Citrus sinensis [apfelsine]
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             177   6e-48   Citrus clementina [clementine]
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             176   6e-48   Citrus clementina [clementine]
emb|CDP05033.1|  unnamed protein product                                176   8e-48   Coffea canephora [robusta coffee]
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   8e-48   Citrus sinensis [apfelsine]
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        176   8e-48   Eucalyptus grandis [rose gum]
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   8e-48   Elaeis guineensis
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250          176   1e-47   Sorghum bicolor [broomcorn]
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   1e-47   Setaria italica
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        177   1e-47   Gossypium arboreum [tree cotton]
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009392256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        175   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19838.1|  BnaA09g04910D                                          176   2e-47   Brassica napus [oilseed rape]
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        175   2e-47   Phoenix dactylifera
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        176   2e-47   Brassica rapa
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    175   2e-47   Solanum tuberosum [potatoes]
gb|KDO69312.1|  hypothetical protein CISIN_1g0384522mg                  173   3e-47   Citrus sinensis [apfelsine]
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    174   4e-47   Nicotiana tomentosiformis
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             174   4e-47   Citrus clementina [clementine]
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        174   4e-47   Vitis vinifera
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    174   4e-47   Nicotiana sylvestris
ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   4e-47   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF02203.1|  hypothetical protein                                   169   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    174   6e-47   Populus euphratica
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        174   8e-47   Malus domestica [apple tree]
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        173   9e-47   Camelina sativa [gold-of-pleasure]
gb|KJB53907.1|  hypothetical protein B456_009G010800                    172   2e-46   Gossypium raimondii
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             172   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011654592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   3e-46   Cucumis sativus [cucumbers]
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      172   3e-46   Solanum lycopersicum
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        172   4e-46   Prunus mume [ume]
ref|XP_002993419.1|  hypothetical protein SELMODRAFT_137087             171   5e-46   
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    171   7e-46   
gb|KJB83778.1|  hypothetical protein B456_013G263800                    172   8e-46   Gossypium raimondii
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    171   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             171   1e-45   Prunus persica
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    170   1e-45   
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        170   1e-45   
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    170   2e-45   Cicer arietinum [garbanzo]
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        170   2e-45   Gossypium arboreum [tree cotton]
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        169   3e-45   Glycine max [soybeans]
gb|EMT12982.1|  Glucan endo-1,3-beta-glucosidase                        164   4e-45   
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            169   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   5e-45   
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    169   5e-45   
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   170   5e-45   
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    168   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    168   7e-45   Ricinus communis
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        168   7e-45   Cucumis melo [Oriental melon]
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  169   7e-45   Medicago truncatula
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             168   9e-45   
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             168   9e-45   Phaseolus vulgaris [French bean]
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        169   1e-44   Cucumis melo [Oriental melon]
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  168   1e-44   Citrus sinensis [apfelsine]
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    167   2e-44   
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    167   2e-44   Nicotiana sylvestris
emb|CDO97058.1|  unnamed protein product                                167   3e-44   Coffea canephora [robusta coffee]
gb|KHN13912.1|  Glucan endo-1,3-beta-glucosidase                        164   4e-44   Glycine soja [wild soybean]
emb|CAB85903.1|  beta-1,3 glucanase                                     166   4e-44   Pisum sativum [garden pea]
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                166   7e-44   Erythranthe guttata [common monkey flower]
gb|EEC78268.1|  hypothetical protein OsI_17962                          169   1e-43   Oryza sativa Indica Group [Indian rice]
gb|EPS63364.1|  glycoside hydrolase                                     164   1e-43   Genlisea aurea
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    165   1e-43   
ref|XP_004147695.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        164   2e-43   Cucumis sativus [cucumbers]
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     164   2e-43   Eucalyptus grandis [rose gum]
emb|CAJ86292.1|  H0124B04.9                                             169   3e-43   Oryza sativa [red rice]
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            162   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002975458.1|  hypothetical protein SELMODRAFT_415534             162   1e-42   Selaginella moellendorffii
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g             163   2e-42   Phaseolus vulgaris [French bean]
gb|AHL24654.1|  Fra e 9.01 allergen                                     162   2e-42   Fraxinus excelsior
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    161   3e-42   Malus domestica [apple tree]
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    161   4e-42   
gb|EEE61922.1|  hypothetical protein OsJ_16662                          164   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088385.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    161   8e-42   Sesamum indicum [beniseed]
ref|XP_002281025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    160   8e-42   Vitis vinifera
gb|KGN50541.1|  hypothetical protein Csa_5G181480                       158   3e-41   Cucumis sativus [cucumbers]
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 158   4e-41   
gb|AAX95269.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    157   6e-41   
ref|XP_001761806.1|  predicted protein                                  157   1e-40   
gb|AHL24655.1|  Fra e 9.02 allergen                                     157   1e-40   
ref|NP_001068545.2|  Os11g0704600                                       157   1e-40   
gb|EEC68648.1|  hypothetical protein OsI_37085                          157   1e-40   
gb|ACN39797.1|  unknown                                                 156   4e-40   
gb|EMS51808.1|  Glucan endo-1,3-beta-glucosidase                        152   4e-40   
ref|XP_009419749.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    155   4e-40   
gb|ERN17157.1|  hypothetical protein AMTR_s00044p00136030               149   1e-39   
gb|EEE52578.1|  hypothetical protein OsJ_34867                          157   2e-39   
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39   
pdb|2JON|A  Chain A, Solution Structure Of The C-Terminal Domain ...    144   3e-39   
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg             152   9e-39   
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    152   9e-39   
ref|XP_009804917.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    151   1e-38   
ref|NP_001174147.1|  Os04g0681950                                       144   2e-38   
gb|EPS73917.1|  hypothetical protein M569_00835                         150   2e-38   
gb|AFK47562.1|  unknown                                                 143   2e-38   
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    152   3e-38   
ref|XP_009605960.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    150   3e-38   
ref|XP_011470609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    152   4e-38   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   4e-38   
ref|XP_006411190.1|  hypothetical protein EUTSA_v10017897mg             151   4e-38   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                150   4e-38   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      150   4e-38   
ref|XP_007013798.1|  O-Glycosyl hydrolases family 17 protein, put...    150   5e-38   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             150   6e-38   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   7e-38   
ref|XP_002451320.1|  hypothetical protein SORBIDRAFT_05g027690          149   7e-38   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             149   7e-38   
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                        149   9e-38   
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    149   9e-38   
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    149   1e-37   
emb|CDY02936.1|  BnaC04g25500D                                          148   1e-37   
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        148   1e-37   
emb|CDX76097.1|  BnaA04g03610D                                          148   2e-37   
ref|XP_001784088.1|  predicted protein                                  148   2e-37   
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     148   4e-37   
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          147   5e-37   
gb|KFK34786.1|  hypothetical protein AALP_AA5G193500                    147   5e-37   
ref|XP_006855690.2|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      147   6e-37   
ref|XP_008667523.1|  PREDICTED: uncharacterized protein LOC100273...    147   6e-37   
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     145   7e-37   
gb|EEC71452.1|  hypothetical protein OsI_03677                          147   8e-37   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   8e-37   
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   8e-37   
ref|NP_001044198.1|  Os01g0739700                                       147   9e-37   
ref|NP_001141385.1|  uncharacterized protein LOC100273476 precursor     146   9e-37   
gb|ACF79258.1|  unknown                                                 146   9e-37   
ref|XP_011626761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     147   9e-37   
ref|NP_001241760.1|  glucan endo-1,3-beta-glucosidase precursor         146   9e-37   
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          147   1e-36   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     146   1e-36   
ref|XP_006846181.2|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    147   1e-36   
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   1e-36   
gb|ERN15184.1|  hypothetical protein AMTR_s00056p00158530               147   1e-36   
emb|CDY20461.1|  BnaC04g05830D                                          146   1e-36   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   1e-36   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             146   1e-36   
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   2e-36   
emb|CDY41234.1|  BnaC08g26240D                                          145   2e-36   
ref|XP_006837267.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   2e-36   
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   3e-36   
gb|ERN00121.1|  hypothetical protein AMTR_s00112p00108890               145   3e-36   
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   3e-36   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    145   4e-36   
emb|CDY40218.1|  BnaA09g35000D                                          144   4e-36   
emb|CDP07273.1|  unnamed protein product                                144   4e-36   
ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   4e-36   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   4e-36   
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   5e-36   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   5e-36   
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     144   6e-36   
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   6e-36   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   7e-36   
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   8e-36   
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    144   9e-36   
ref|XP_006341928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   9e-36   
ref|NP_181494.1|  glycosyl hydrolase-17                                 144   9e-36   
ref|XP_009139167.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    143   1e-35   
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    144   1e-35   
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   1e-35   
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   1e-35   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   1e-35   
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   1e-35   
emb|CDY53600.1|  BnaA05g34730D                                          143   1e-35   
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     143   1e-35   
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970             143   1e-35   
emb|CDP03239.1|  unnamed protein product                                143   2e-35   
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                143   2e-35   
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg             142   2e-35   
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     142   2e-35   
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             142   2e-35   
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   
gb|AAK85402.2|  beta-1,3-glucanase                                      142   3e-35   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  142   3e-35   
ref|XP_004238250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      142   3e-35   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    142   3e-35   
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   4e-35   
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   4e-35   
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   4e-35   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             142   4e-35   
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    142   4e-35   
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    142   5e-35   
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg             141   5e-35   
ref|XP_010504397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    141   5e-35   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   5e-35   
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   6e-35   
ref|XP_010516112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    141   6e-35   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    142   6e-35   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            141   7e-35   
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     141   7e-35   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     141   7e-35   
ref|XP_012080639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     141   7e-35   
gb|AAK76666.1|  putative beta-1,3-glucanase                             140   1e-34   
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     141   1e-34   
ref|XP_002312452.2|  glucan endo-1 family protein                       140   1e-34   
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   1e-34   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     140   1e-34   
dbj|BAJ85556.1|  predicted protein                                      140   1e-34   
gb|AAM66982.1|  beta-1,3-glucanase-like protein                         140   1e-34   
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein               140   1e-34   
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      140   1e-34   
ref|XP_010427314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   1e-34   
gb|ADU15553.1|  GLU                                                     140   1e-34   
ref|XP_009801195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   1e-34   
gb|EPS73640.1|  hypothetical protein M569_01113                         140   1e-34   
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                140   1e-34   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   2e-34   
ref|XP_004980076.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   2e-34   
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             140   2e-34   
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        140   2e-34   
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             140   2e-34   
ref|XP_009143300.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        139   2e-34   
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        140   2e-34   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              139   2e-34   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              139   2e-34   
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      140   2e-34   
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      140   3e-34   
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-34   
ref|XP_009626249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   3e-34   
gb|KJB54309.1|  hypothetical protein B456_009G028300                    139   3e-34   
gb|KHG04965.1|  hypothetical protein F383_30444                         139   3e-34   
ref|XP_012072282.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      139   3e-34   
dbj|BAD94999.1|  beta-1,3-glucanase - like protein                      132   3e-34   
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   3e-34   
ref|XP_006372050.1|  hypothetical protein POPTR_0018s08730g             135   4e-34   
gb|EPS59841.1|  hypothetical protein M569_14964                         139   4e-34   
gb|KJB10704.1|  hypothetical protein B456_001G216900                    137   4e-34   
gb|KJB15376.1|  hypothetical protein B456_002G174100                    139   4e-34   
gb|KJB15378.1|  hypothetical protein B456_002G174100                    139   4e-34   
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     139   4e-34   
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             139   5e-34   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    139   5e-34   
emb|CDM84006.1|  unnamed protein product                                139   5e-34   
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      139   5e-34   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   5e-34   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     139   5e-34   
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     139   5e-34   
gb|KHG26459.1|  hypothetical protein F383_04538                         139   5e-34   
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             139   5e-34   
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   6e-34   
emb|CDP14397.1|  unnamed protein product                                139   6e-34   
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   7e-34   
ref|XP_001752749.1|  predicted protein                                  138   7e-34   
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             139   8e-34   
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein               139   8e-34   
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   8e-34   
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   8e-34   
emb|CDY18049.1|  BnaC07g04210D                                          138   8e-34   
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   9e-34   
gb|EPS68573.1|  hypothetical protein M569_06194                         137   1e-33   
ref|XP_004301627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   1e-33   
gb|KJB14206.1|  hypothetical protein B456_002G114200                    137   1e-33   
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      138   1e-33   
ref|XP_002313051.1|  glycosyl hydrolase family 17 family protein        136   1e-33   
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            137   1e-33   
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   
gb|KHG06295.1|  hypothetical protein F383_32557                         137   1e-33   
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      137   1e-33   
ref|XP_012076842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   1e-33   
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   2e-33   
gb|KHG05496.1|  hypothetical protein F383_30989                         137   2e-33   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             137   2e-33   
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   2e-33   
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      137   2e-33   
emb|CDY62387.1|  BnaCnng40170D                                          137   2e-33   
emb|CDP05678.1|  unnamed protein product                                137   2e-33   
gb|KJB30776.1|  hypothetical protein B456_005G159100                    137   2e-33   
gb|KJB30775.1|  hypothetical protein B456_005G159100                    137   2e-33   
ref|XP_002971086.1|  hypothetical protein SELMODRAFT_94863              137   2e-33   
ref|XP_011088386.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    137   2e-33   
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      137   2e-33   
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     137   2e-33   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    137   3e-33   
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    136   3e-33   
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      137   3e-33   
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    136   3e-33   
ref|XP_012086410.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      137   3e-33   
emb|CDY56498.1|  BnaAnng14330D                                          136   3e-33   
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                136   3e-33   
gb|KJB27172.1|  hypothetical protein B456_004G282300                    137   3e-33   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         137   3e-33   
emb|CDY53692.1|  BnaA07g37860D                                          136   3e-33   
ref|XP_011655956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   3e-33   
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   4e-33   
gb|EMT31321.1|  Glucan endo-1,3-beta-glucosidase                        136   4e-33   
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   4e-33   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     136   4e-33   
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   4e-33   
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   5e-33   
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   5e-33   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    136   5e-33   
ref|XP_007209985.1|  hypothetical protein PRUPE_ppa005142mg             136   5e-33   
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   5e-33   



>ref|XP_002510373.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF52560.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=461

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 156/189 (83%), Gaps = 7/189 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY+GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  272  YKGDSNEVGPSLENAKAYIGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtp-------tpvtpspkSGAWCVPKEGVSDAQLQANLDY  501
            +FGLF+PDLTMTFDAGLSKT             +P P   AWCVPKEGVSDAQ QANLDY
Sbjct  332  AFGLFKPDLTMTFDAGLSKTSQTPSTPKTPVNSSPKPNKAAWCVPKEGVSDAQFQANLDY  391

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDCS IQPGG CFEPNTVASHAAYAMNLLYQT+ KNP  CDFSQTA LSS NPSY
Sbjct  392  ACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLLYQTSEKNPSTCDFSQTAILSSENPSY  451

Query  320  DGCTYPSGS  294
            + CTYP GS
Sbjct  452  NSCTYPGGS  460



>ref|XP_011083694.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Sesamum indicum]
Length=462

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 156/192 (81%), Gaps = 9/192 (5%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ EVGPSIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE  KPGPTSER
Sbjct  271  YKGDNDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDQKPGPTSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp---------spkSGAWCVPKEGVSDAQLQANL  507
            SFGLF+PDLTM +D GLSKT      +            K  AWCVPK GVSDAQLQ NL
Sbjct  331  SFGLFKPDLTMVYDVGLSKTGNQNTSSTPKASVKPAPKSKKDAWCVPKAGVSDAQLQENL  390

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DY CGQGIDCSAIQPGG CFEP TVASHA YAMNLLYQT+GKNPW+CDFSQTATL+STNP
Sbjct  391  DYACGQGIDCSAIQPGGACFEPMTVASHATYAMNLLYQTSGKNPWDCDFSQTATLTSTNP  450

Query  326  SYDGCTYPSGST  291
            SYD C+YP GS+
Sbjct  451  SYDKCSYPGGSS  462



>ref|XP_007017515.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
 gb|EOY14740.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
Length=341

 Score =   287 bits (735),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 11/194 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRS+VGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  148  YKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPTSER  207

Query  659  SFGLFRPDLTMTFDAGLsktvtp-----------tpvtpspkSGAWCVPKEGVSDAQLQA  513
            SFG+F+ DLTM +D GLS++                 +  PK  AWCVP+ GVSDA+LQA
Sbjct  208  SFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAELQA  267

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            +LDY CG GIDCS IQPGG CFEPNT+ASHAAYAMNL YQTAG+NPWNCDFSQTA LSS 
Sbjct  268  SLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRNPWNCDFSQTAMLSSN  327

Query  332  NPSYDGCTYPSGST  291
            NPSY+GCTYP GST
Sbjct  328  NPSYNGCTYPGGST  341



>ref|XP_007017516.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
 gb|EOY14741.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
Length=465

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 11/194 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRS+VGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  272  YKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPTSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtp-----------tpvtpspkSGAWCVPKEGVSDAQLQA  513
            SFG+F+ DLTM +D GLS++                 +  PK  AWCVP+ GVSDA+LQA
Sbjct  332  SFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAELQA  391

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            +LDY CG GIDCS IQPGG CFEPNT+ASHAAYAMNL YQTAG+NPWNCDFSQTA LSS 
Sbjct  392  SLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRNPWNCDFSQTAMLSSN  451

Query  332  NPSYDGCTYPSGST  291
            NPSY+GCTYP GST
Sbjct  452  NPSYNGCTYPGGST  465



>ref|XP_007017514.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
 gb|EOY14739.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
Length=464

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 11/194 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRS+VGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  271  YKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPTSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtp-----------tpvtpspkSGAWCVPKEGVSDAQLQA  513
            SFG+F+ DLTM +D GLS++                 +  PK  AWCVP+ GVSDA+LQA
Sbjct  331  SFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAELQA  390

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            +LDY CG GIDCS IQPGG CFEPNT+ASHAAYAMNL YQTAG+NPWNCDFSQTA LSS 
Sbjct  391  SLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRNPWNCDFSQTAMLSSN  450

Query  332  NPSYDGCTYPSGST  291
            NPSY+GCTYP GST
Sbjct  451  NPSYNGCTYPGGST  464



>ref|XP_012071830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Jatropha 
curcas]
 gb|KDP38494.1| hypothetical protein JCGZ_04419 [Jatropha curcas]
Length=461

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 153/190 (81%), Gaps = 8/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ EVGPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDNNEVGPSMENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk--------SGAWCVPKEGVSDAQLQANLD  504
            +FGLF+PDLTMT+D GLSK+        +P            WCVPK GVSDAQLQANLD
Sbjct  331  AFGLFKPDLTMTYDVGLSKSSQSPSTPKTPSLSPSPKPKQATWCVPKAGVSDAQLQANLD  390

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            Y CG G+DCS IQPGG CFEPNTVASHAA+AMNLLYQT+ +NP NCDFSQTATLSS NPS
Sbjct  391  YACGHGVDCSPIQPGGACFEPNTVASHAAFAMNLLYQTSDRNPVNCDFSQTATLSSKNPS  450

Query  323  YDGCTYPSGS  294
            YD CTYP GS
Sbjct  451  YDACTYPGGS  460



>gb|EYU45144.1| hypothetical protein MIMGU_mgv1a006001mg [Erythranthe guttata]
Length=461

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 159/193 (82%), Gaps = 10/193 (5%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFA+YDE  KPGPTSER
Sbjct  269  YKGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFAVYDEDQKPGPTSER  328

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps----------pkSGAWCVPKEGVSDAQLQAN  510
            SFGLF+PDLTMT+D GLSKT   TP TP            K   WCVPK GVSDAQLQAN
Sbjct  329  SFGLFKPDLTMTYDVGLSKTSQTTPSTPKTPTINPAPKPEKEAYWCVPKGGVSDAQLQAN  388

Query  509  LDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTN  330
            LDYVCGQG+DCS IQPGG CFEP+TVASHA+YAMN+LYQ++ K PWNCDFSQTATL+STN
Sbjct  389  LDYVCGQGLDCSPIQPGGACFEPSTVASHASYAMNVLYQSSEKKPWNCDFSQTATLTSTN  448

Query  329  PSYDGCTYPSGST  291
            PSYD C YP GS+
Sbjct  449  PSYDKCIYPGGSS  461



>ref|XP_010254870.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Nelumbo nucifera]
Length=512

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 157/190 (83%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP K++DTYLFALYDE LKPGP SER
Sbjct  323  YKGDSNEVGPSVENAKAYNGNLIKHLRSMVGTPLMPGKAIDTYLFALYDEDLKPGPGSER  382

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGLF+PDLTMT+DAGLSK+   TP   +P       K   WCVPK+G+SDAQLQ+NLDY
Sbjct  383  AFGLFKPDLTMTYDAGLSKSSQTTPTPTTPVNPSPQPKQTVWCVPKDGISDAQLQSNLDY  442

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CG GIDC  +QPGG CFEPNTVA+HAAYAMNL YQ AG+NPWNCDFSQTATL+S NPSY
Sbjct  443  ACGHGIDCGPLQPGGACFEPNTVAAHAAYAMNLFYQNAGRNPWNCDFSQTATLTSNNPSY  502

Query  320  DGCTYPSGST  291
            + C YP GST
Sbjct  503  NSCIYPGGST  512



>ref|XP_010096392.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXB63955.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=467

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 157/196 (80%), Gaps = 13/196 (7%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  EVGPS+ENAKAY GNLI HLRS+ GTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  272  YQGDGDEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------------tpspkSGAWCVPKEGVSDAQL  519
            +FGLF+PDL+M++D GLSKT + +               +P  K   WCVPK GVSDAQL
Sbjct  332  AFGLFKPDLSMSYDVGLSKTSSGSQSPTPSSTPKTPVNPSPKSKKTVWCVPKAGVSDAQL  391

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            QAN+DY CG G+DCSAIQ GG CFEPNTVASHA YAMNLLYQTAG+NPWNCDFSQTATLS
Sbjct  392  QANIDYACGHGVDCSAIQHGGACFEPNTVASHATYAMNLLYQTAGRNPWNCDFSQTATLS  451

Query  338  STNPSYDGCTYPSGST  291
            + NPSY+GC+YP GST
Sbjct  452  TNNPSYNGCSYPGGST  467



>ref|XP_002509479.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF50866.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=460

 Score =   283 bits (725),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVGPS+ENA+AY GNLI HLRSLVGTPLMP KSVDTYLFALYDE LKPGP+SER
Sbjct  271  YRGDSNEVGPSVENARAYNGNLIAHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPSSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            +FGLF+ DL+M +DAGLSK              +  P    WC+PK GV DAQLQA+LDY
Sbjct  331  AFGLFKTDLSMAYDAGLSKASVTPSSPKTPATPSTKPTGAGWCMPKSGVPDAQLQASLDY  390

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDCS IQPGG CFEPNT+ASHAAYAMNL YQT+ KNPWNCDFSQTATL+S NPSY
Sbjct  391  ACGQGIDCSPIQPGGACFEPNTLASHAAYAMNLYYQTSSKNPWNCDFSQTATLTSKNPSY  450

Query  320  DGCTYPSGST  291
            +GC YP GST
Sbjct  451  NGCVYPGGST  460



>ref|XP_002282736.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Vitis 
vinifera]
 emb|CBI19687.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 152/195 (78%), Gaps = 12/195 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI+HLRSLVGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDSNEVGPSIENAKAYNGNLISHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps------------pkSGAWCVPKEGVSDAQLQ  516
            +FGLF+ DLTMT+D GLSK    T   P+              +G WCVPK  VS+AQLQ
Sbjct  331  AFGLFKTDLTMTYDVGLSKGAQNTTPAPATPKTPATPSPSPSTNGTWCVPKSVVSNAQLQ  390

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            ANLDY CGQGIDC  +QPGG CFEPNTVASHAAYAMNL YQ + +NPWNCDFSQTATL+S
Sbjct  391  ANLDYACGQGIDCRPVQPGGACFEPNTVASHAAYAMNLFYQNSARNPWNCDFSQTATLTS  450

Query  335  TNPSYDGCTYPSGST  291
             NPSY GC YP G T
Sbjct  451  KNPSYKGCIYPGGRT  465



>ref|XP_010107844.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXC17244.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=479

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 147/188 (78%), Gaps = 5/188 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LKPGP SER
Sbjct  292  YRGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPGSER  351

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-----kSGAWCVPKEGVSDAQLQANLDYVC  495
            +FGLF+PDLTMT+D GLS        +         +  WCVPK GVSDAQLQ NLDY C
Sbjct  352  AFGLFKPDLTMTYDVGLSNARQGPSSSTVNPSPNPTASQWCVPKAGVSDAQLQTNLDYAC  411

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
               IDC  IQPGG CFEPNTVASHAAYAMNL YQT GKNPWNCDFSQTAT++S NPSY+ 
Sbjct  412  SHSIDCGLIQPGGACFEPNTVASHAAYAMNLYYQTYGKNPWNCDFSQTATVTSANPSYNA  471

Query  314  CTYPSGST  291
            C YP GST
Sbjct  472  CNYPGGST  479



>ref|XP_008377338.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=473

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 154/203 (76%), Gaps = 20/203 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPVSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp--------------------kSGAWCVPKE  540
            +FGLF+PDLTM +D GLSK+        +P                    K G++CVPK 
Sbjct  328  AFGLFKPDLTMNYDVGLSKSSQTPTTPATPSTPTTPSTPPTPANPSGPKPKKGSYCVPKA  387

Query  539  GVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDF  360
            GVSD+QLQAN+DYVCG G DC+ IQPGG CFEPNTV SHA YAMNLLYQTAG+NPWNCDF
Sbjct  388  GVSDSQLQANIDYVCGHGFDCTPIQPGGSCFEPNTVKSHATYAMNLLYQTAGRNPWNCDF  447

Query  359  SQTATLSSTNPSYDGCTYPSGST  291
            SQTATL+S NPSYD C YP GST
Sbjct  448  SQTATLTSNNPSYDSCNYPGGST  470



>ref|XP_007042210.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX98041.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=459

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 151/193 (78%), Gaps = 10/193 (5%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LK GP SER
Sbjct  267  YAGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPASER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp----------spkSGAWCVPKEGVSDAQLQAN  510
            +FGLFRPDL+MT+DAGLSK+                   P +  WCVPK G+SDAQLQA+
Sbjct  327  AFGLFRPDLSMTYDAGLSKSSQTPSTPQNPVTPVTPQPKPTASGWCVPKAGISDAQLQAS  386

Query  509  LDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTN  330
            LDY C QGIDC  IQPGG CFEPNTVASHAAYAMNL YQT+GKN WNCDFSQTAT++S N
Sbjct  387  LDYACSQGIDCGPIQPGGACFEPNTVASHAAYAMNLYYQTSGKNLWNCDFSQTATVTSQN  446

Query  329  PSYDGCTYPSGST  291
            PSY+ C YP GST
Sbjct  447  PSYNNCIYPGGST  459



>ref|XP_006386924.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
 gb|ERP64721.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
Length=463

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 152/189 (80%), Gaps = 7/189 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  E+GPSIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  272  YKGDDNEIGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            SFGLF+PDLTM ++ GLSK+             +P+ K   WCVPK GVSDAQLQ NLDY
Sbjct  332  SFGLFKPDLTMAYNVGLSKSSQTPATPKTPTNPSPTSKKATWCVPKSGVSDAQLQDNLDY  391

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CG+GIDCS I+PGG CFEPNT+ASHAAYAMNL YQ + KNP NCDFSQ+ATLSS NPSY
Sbjct  392  ACGRGIDCSPIEPGGACFEPNTLASHAAYAMNLFYQASDKNPLNCDFSQSATLSSNNPSY  451

Query  320  DGCTYPSGS  294
            + CTYPSGS
Sbjct  452  NACTYPSGS  460



>ref|XP_008466580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis melo]
Length=478

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 157/208 (75%), Gaps = 25/208 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ EVGPS+ENAKA+ GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDNDEVGPSLENAKAFNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-------------------------SGAW  555
            +FGLF+PDLTMT+D GLSK    TP +P                             G+W
Sbjct  331  AFGLFKPDLTMTYDVGLSKNGQSTPSSPKTTPVTTPSSPANNPSTKAPTSPKPKAGGGSW  390

Query  554  CVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNP  375
            C+PK GVSDAQLQANLDY CG+G+DCSAIQPGG CFEPNT+ASHAAYAMNL +Q  G++P
Sbjct  391  CLPKGGVSDAQLQANLDYACGRGLDCSAIQPGGACFEPNTIASHAAYAMNLFFQNGGRDP  450

Query  374  WNCDFSQTATLSSTNPSYDGCTYPSGST  291
            W CDFSQ+ATLSS NPSYDGC YP GST
Sbjct  451  WTCDFSQSATLSSNNPSYDGCNYPGGST  478



>gb|KJB32498.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=323

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  134  YSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  193

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGL++ DL+MT+D G+SK+    P   +P        +  WCVPK G+SDAQLQ++LDY
Sbjct  194  AFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPTATGWCVPKAGISDAQLQSSLDY  253

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDCS IQPGG CFEPNTVASHAAYAMNL YQ + KNPWNCDFSQTATL+S NP+Y
Sbjct  254  ACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPTY  313

Query  320  DGCTYPSGST  291
            + C YP GST
Sbjct  314  NNCIYPGGST  323



>emb|CDP07525.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   279 bits (713),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 149/194 (77%), Gaps = 13/194 (7%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDSNEVGPSLENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp-------------spkSGAWCVPKEGVSDAQL  519
            +FGLF+ D+TM +D GLSKT                       K   WCVPK GVSDAQL
Sbjct  331  AFGLFKLDMTMNYDTGLSKTSQAPSNAKNPATPTIPTTPAPKAKKSVWCVPKAGVSDAQL  390

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            QANLDY C  G DCS+IQPGG CFEPNT+ASHA YAMNLLYQTAG+NPWNCDFSQTATLS
Sbjct  391  QANLDYACSHGTDCSSIQPGGACFEPNTIASHATYAMNLLYQTAGRNPWNCDFSQTATLS  450

Query  338  STNPSYDGCTYPSG  297
            +TNPSY+ C YP G
Sbjct  451  TTNPSYNACQYPGG  464



>gb|KHG11479.1| hypothetical protein F383_06303 [Gossypium arboreum]
Length=456

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  267  YSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGL++PDL+M +D G+SK+        +P        +  WCVPK G+SDAQLQ++LDY
Sbjct  327  AFGLYKPDLSMVYDVGISKSSQTPSTPSTPVTPQPKPTATGWCVPKAGISDAQLQSSLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDCS IQPGG CFEPNT+ASHAAYAMNL YQ++ KNPWNCDFSQTATL+S NPSY
Sbjct  387  ACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSY  446

Query  320  DGCTYPSGST  291
            + C YP GST
Sbjct  447  NNCIYPGGST  456



>emb|CAN61862.1| hypothetical protein VITISV_043447 [Vitis vinifera]
Length=479

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 150/187 (80%), Gaps = 8/187 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GD+ EVGPSIENAKAY GNLI HLRS+ GTPLMP KSVDTY+FALYDE LKPGP SER
Sbjct  291  YSGDANEVGPSIENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDENLKPGPGSER  350

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps--------pkSGAWCVPKEGVSDAQLQANLD  504
            +FGLF+PDL+MT+D  LSK+        +          S  WCVPK GVSDAQLQANLD
Sbjct  351  AFGLFKPDLSMTYDVSLSKSSQTPSTPETPVNPSPNPTASSVWCVPKTGVSDAQLQANLD  410

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            Y C QGIDC+ IQPGG CFEPNTVASHAAYAMNLLYQ++GKN WNCDF+QTATL+S+NPS
Sbjct  411  YACSQGIDCTPIQPGGACFEPNTVASHAAYAMNLLYQSSGKNSWNCDFTQTATLTSSNPS  470

Query  323  YDGCTYP  303
            Y+ CT+P
Sbjct  471  YNACTFP  477



>gb|KDO49091.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
 gb|KDO49092.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
Length=222

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 150/196 (77%), Gaps = 13/196 (7%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  EVGPS+ENAKAY GNLI HLRS+ GTPLMP KSVDTY+FALYDE LKPGP  ER
Sbjct  27   YRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPAFER  86

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------------tpspkSGAWCVPKEGVSDAQL  519
            SFGLF+PDL+  +D G+SK+                   +P P +  WCVPK G+SDAQL
Sbjct  87   SFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPKTPTTPSPKPTAAGWCVPKAGISDAQL  146

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            QA+LDY C QGIDCS IQPGG CFEPNTV SHAA+AMNL YQT+ KNPWNCDFS+TATL+
Sbjct  147  QASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLT  206

Query  338  STNPSYDGCTYPSGST  291
            S NPSY+GC YPSG T
Sbjct  207  SQNPSYNGCVYPSGGT  222



>ref|XP_006384505.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|ABK95331.1| unknown [Populus trichocarpa]
 gb|ERP62302.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=456

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 153/189 (81%), Gaps = 7/189 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGP IENA+AY GNL+ HLRS+VGTPLMP KSVDTY+FALYDE LK GP SER
Sbjct  267  YKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPASER  326

Query  659  SFGLFRPDLTMTFDAGLsktv-------tptpvtpspkSGAWCVPKEGVSDAQLQANLDY  501
            SFGLF+PDL+MT+D GLSK+        TP   +P P    WCVPK GVSDAQLQA+LDY
Sbjct  327  SFGLFKPDLSMTYDIGLSKSSLPPSTPKTPVTPSPKPTKADWCVPKAGVSDAQLQASLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDC  IQPGG CFEPNTVASHA+YAMNL YQ + KNPWNCDFS+TATL+  NPSY
Sbjct  387  ACGQGIDCGPIQPGGACFEPNTVASHASYAMNLYYQKSAKNPWNCDFSETATLTFKNPSY  446

Query  320  DGCTYPSGS  294
            +GCTYP GS
Sbjct  447  NGCTYPGGS  455



>ref|XP_012069916.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Jatropha curcas]
 gb|KDP46246.1| hypothetical protein JCGZ_10086 [Jatropha curcas]
Length=459

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 151/190 (79%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENA+AY GNLI HLR+LVGTPLMP KSVDTYLFALYDE LKPGP+SER
Sbjct  270  YSGDSNEVGPSIENARAYNGNLINHLRTLVGTPLMPGKSVDTYLFALYDEDLKPGPSSER  329

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGLF+ DL+MT+D GL+K+        +P        +  WC+PK GVSDAQLQA+LDY
Sbjct  330  AFGLFKTDLSMTYDVGLTKSSQVPSTPTTPATPSAKPTATGWCMPKSGVSDAQLQASLDY  389

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDC  IQPGG CFEPN + SHAAYAMNL YQ + KNPWNCDFSQTATL+S NPSY
Sbjct  390  ACGQGIDCGPIQPGGACFEPNNLVSHAAYAMNLYYQASSKNPWNCDFSQTATLTSKNPSY  449

Query  320  DGCTYPSGST  291
            +GC YP GST
Sbjct  450  NGCVYPGGST  459



>ref|XP_011037536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
 ref|XP_011037537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 151/189 (80%), Gaps = 7/189 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGP IENA+AY GNL+ HLRS+VGTPLMP KSVDTY+FALYDE LK GP SER
Sbjct  267  YKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPASER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            SFGL++PDL+MT+D GLSK+             +P P    WCVPK GVSDAQLQA+LDY
Sbjct  327  SFGLYKPDLSMTYDIGLSKSSLTPSTPKTPVTPSPKPTKAGWCVPKAGVSDAQLQASLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDC  IQPGG CFEPNTVASHA+YAMNL YQ + KNPWNCDFS+TATL+  NPSY
Sbjct  387  ACGQGIDCGPIQPGGACFEPNTVASHASYAMNLYYQKSAKNPWNCDFSETATLTFKNPSY  446

Query  320  DGCTYPSGS  294
            +GCTYP GS
Sbjct  447  NGCTYPGGS  455



>ref|XP_011048644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS+EVGPS+ENA+AY GNLI+HLRS+VGTPLMP KSVDTY+FALYDE LKPGP SER
Sbjct  267  YNGDSSEVGPSVENARAYNGNLISHLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPASER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGA-------WCVPKEGVSDAQLQANLDY  501
            SFGLF+PDL+MT+D GLSK+        +P + +       WCVPK G S AQLQA+LDY
Sbjct  327  SFGLFKPDLSMTYDIGLSKSSLTPSTPKTPVTSSPKPAAVGWCVPKTGASGAQLQASLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDC  IQPGG CF+P+T+ASHAAYA+NL YQ + KNPWNCDFS+TATL+S NPSY
Sbjct  387  ACGQGIDCGPIQPGGACFQPDTLASHAAYAINLYYQASAKNPWNCDFSETATLTSKNPSY  446

Query  320  DGCTYPSGST  291
            +GCTYP GST
Sbjct  447  NGCTYPGGST  456



>ref|XP_009364443.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=470

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 153/202 (76%), Gaps = 20/202 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPGSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp--------------------kSGAWCVPKE  540
            +FGLF+PDLTMT+D GLSK+        +P                    K G++CVPK 
Sbjct  328  AFGLFKPDLTMTYDVGLSKSTQTPTTPTTPSTPTTPSMPPTPVNPSGPKPKKGSYCVPKA  387

Query  539  GVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDF  360
            GVSD+QLQAN+DYVCG G DC+ IQPGG CFEPNTV SHA YAMNLLYQTAG+ PWNCDF
Sbjct  388  GVSDSQLQANIDYVCGHGFDCTPIQPGGSCFEPNTVKSHATYAMNLLYQTAGREPWNCDF  447

Query  359  SQTATLSSTNPSYDGCTYPSGS  294
            SQTATL+S NPSYD C YP GS
Sbjct  448  SQTATLTSNNPSYDSCNYPGGS  469



>ref|XP_006423251.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 ref|XP_006487152.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Citrus sinensis]
 gb|ESR36491.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=467

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 152/196 (78%), Gaps = 13/196 (7%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  EVGPS+ENAKAY GNLI HLRS+ GTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  272  YRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------------tpspkSGAWCVPKEGVSDAQL  519
            SFGLF+PDL+  +D G+SK+                   +P P +  WCVPK G+SDAQL
Sbjct  332  SFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPKTPTTPSPKPTAAGWCVPKAGISDAQL  391

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            QA+LDY C QGIDCS IQPGG CFEPNTV SHAA+AMNL YQT+ KNPWNCDFS+TATL+
Sbjct  392  QASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLT  451

Query  338  STNPSYDGCTYPSGST  291
            S NPSY+GC YPSG T
Sbjct  452  SQNPSYNGCVYPSGGT  467



>gb|KJB32496.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=456

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  267  YSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGL++ DL+MT+D G+SK+    P   +P        +  WCVPK G+SDAQLQ++LDY
Sbjct  327  AFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPTATGWCVPKAGISDAQLQSSLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CGQGIDCS IQPGG CFEPNTVASHAAYAMNL YQ + KNPWNCDFSQTATL+S NP+Y
Sbjct  387  ACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPTY  446

Query  320  DGCTYPSGST  291
            + C YP GST
Sbjct  447  NNCIYPGGST  456



>ref|XP_008457927.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis melo]
Length=464

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 149/190 (78%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVG S+ENA+AY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  275  YRGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPTSER  334

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG-------AWCVPKEGVSDAQLQANLDY  501
            SFGLF P+LTMT+D GLSK         +P +         WC+PK  + D QLQ+NLDY
Sbjct  335  SFGLFYPNLTMTYDVGLSKNSQTPTTPTTPTTPSPKPTAPVWCLPKADIPDDQLQSNLDY  394

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CG GIDC  IQPGG CFEPNTV SHAAYAMNL YQ+ GKNPWNCDFSQTATL+STNPSY
Sbjct  395  ACGHGIDCGPIQPGGACFEPNTVKSHAAYAMNLYYQSLGKNPWNCDFSQTATLTSTNPSY  454

Query  320  DGCTYPSGST  291
            + CTYP GST
Sbjct  455  NACTYPGGST  464



>ref|XP_011024410.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Populus euphratica]
Length=510

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 151/189 (80%), Gaps = 7/189 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  E+GPSIENAKAY GNLI HLRS+ GTPLMP KSVDTYLF LYDE LKPGP SER
Sbjct  319  YKGDDNEIGPSIENAKAYNGNLIAHLRSMEGTPLMPGKSVDTYLFGLYDEDLKPGPGSER  378

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            SFGLF+PDLTM ++ GLSK+             +P+ K   WCVPK G SDAQLQANLDY
Sbjct  379  SFGLFKPDLTMAYNVGLSKSSQTPATPKTPTNPSPTSKKATWCVPKSGASDAQLQANLDY  438

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CG+GIDCS I+PGG CFEPNT+ASHAAYAMNL YQT+ K+P NCDFSQ+ATLSS NPSY
Sbjct  439  ACGRGIDCSPIEPGGACFEPNTIASHAAYAMNLFYQTSDKSPLNCDFSQSATLSSNNPSY  498

Query  320  DGCTYPSGS  294
            + CTYPSGS
Sbjct  499  NACTYPSGS  507



>ref|XP_010065396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Eucalyptus 
grandis]
 gb|KCW62850.1| hypothetical protein EUGRSUZ_G00445 [Eucalyptus grandis]
Length=470

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 152/195 (78%), Gaps = 12/195 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVG S+ENAKAY GNLI HLRSLVGTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  276  YNGDSNEVGTSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPTSER  335

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGA------------WCVPKEGVSDAQLQ  516
            SFG+++PDLTMT+D GL+K+        +P +              WCVPK GVSDAQLQ
Sbjct  336  SFGMYKPDLTMTYDIGLAKSSQTPASPKAPVTPTPVTPTPKPTGPGWCVPKSGVSDAQLQ  395

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            A+LDY C   IDCS IQPGG CF+PNT+ASHAA+AMNL YQT G+NPWNCDFSQTATL++
Sbjct  396  ASLDYACSNNIDCSPIQPGGACFDPNTIASHAAFAMNLYYQTLGRNPWNCDFSQTATLTT  455

Query  335  TNPSYDGCTYPSGST  291
             NPSY+GC YP GST
Sbjct  456  NNPSYNGCVYPGGST  470



>ref|XP_010263687.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Nelumbo nucifera]
Length=465

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 155/195 (79%), Gaps = 12/195 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KS+DTYLFALYDE LKPGP SER
Sbjct  271  YKGDSNEVGPSMENAKAYNGNLINHLRSMVGTPLMPGKSIDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp------------spkSGAWCVPKEGVSDAQLQ  516
            +FGLF+PDLTMT+D GLSK+   TP TP              K   WCVPK+G+S+AQLQ
Sbjct  331  AFGLFKPDLTMTYDVGLSKSNQQTPATPTPTPTTPVNPSPQSKMTVWCVPKDGISEAQLQ  390

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            ANLDY CGQGIDCS +QPGG C+EPNTVASHAA+AMNL YQ + +NP NCDFSQTATL+S
Sbjct  391  ANLDYACGQGIDCSPLQPGGACYEPNTVASHAAFAMNLFYQKSARNPLNCDFSQTATLTS  450

Query  335  TNPSYDGCTYPSGST  291
             NPSY+ C Y  GS+
Sbjct  451  NNPSYNSCIYLGGSS  465



>ref|XP_008220789.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Prunus mume]
Length=480

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 152/213 (71%), Gaps = 30/213 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HLRS+ GTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDSNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDENLKPGPGSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp------------------------------  570
            +FGLF+PDLTMT+D GLSKT        S                               
Sbjct  328  AFGLFKPDLTMTYDVGLSKTGQTPSTPSSTPSTPSTTPSTTPSTPSAVPKTPVNPSAPKP  387

Query  569  kSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQT  390
            K  AWC+PK GVSD+QLQAN+DYVCG G DCS IQ GG CFEPNTV SHAAYAMNLLYQT
Sbjct  388  KKAAWCLPKAGVSDSQLQANIDYVCGHGFDCSPIQQGGACFEPNTVQSHAAYAMNLLYQT  447

Query  389  AGKNPWNCDFSQTATLSSTNPSYDGCTYPSGST  291
            AG +P NCDFSQTATLSS NPSYDGC YP GST
Sbjct  448  AGGDPLNCDFSQTATLSSNNPSYDGCHYPGGST  480



>gb|KJB34916.1| hypothetical protein B456_006G090600 [Gossypium raimondii]
Length=448

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 148/183 (81%), Gaps = 1/183 (1%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD+ EVGPSIENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LK GP S+R
Sbjct  267  YRGDNNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKVGPGSKR  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            +FGL++PDL+MT+D G+S             +  WCVPK G+SDAQLQ++LDY CGQGID
Sbjct  327  AFGLYKPDLSMTYDVGISNCYPTPSTLKPTAT-IWCVPKAGISDAQLQSSLDYACGQGID  385

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            CS IQPGG CFEPN VASHAAYAMNL YQ + KNPWNCDFSQTATL+S NPSY+ C YP 
Sbjct  386  CSPIQPGGACFEPNIVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPSYNNCIYPG  445

Query  299  GST  291
            GST
Sbjct  446  GST  448



>ref|XP_004147788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis sativus]
 gb|KGN59949.1| hypothetical protein Csa_3G855430 [Cucumis sativus]
Length=478

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 155/208 (75%), Gaps = 25/208 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ EVG S+ENAKA+ GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDNDEVGSSLENAKAFNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-------------------------SGAW  555
            +FGLF+PDLTM +D GLSK    TP +P                             G+W
Sbjct  331  AFGLFKPDLTMAYDVGLSKNGQSTPTSPKTTPVTTPSSPANNPSTKSPTSPKPKAGGGSW  390

Query  554  CVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNP  375
            C+PK GVSDAQLQANLDY CG+G+DCSAIQPGG CFEPNT+ASHAAYAMNL +Q  G++P
Sbjct  391  CLPKGGVSDAQLQANLDYACGRGLDCSAIQPGGACFEPNTIASHAAYAMNLFFQNGGRDP  450

Query  374  WNCDFSQTATLSSTNPSYDGCTYPSGST  291
            W CDFSQ+ATLSS NPSY+GC YP GST
Sbjct  451  WTCDFSQSATLSSNNPSYNGCNYPGGST  478



>ref|XP_007222662.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
 gb|EMJ23861.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
Length=483

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 152/216 (70%), Gaps = 33/216 (15%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENAKAY GNLI HLRS+ GTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDSNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDENLKPGPGSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp------------------------------  570
            +FGLF+PDLTMT+D GLSKT        S                               
Sbjct  328  AFGLFKPDLTMTYDVGLSKTRQTPSTPSSTPSTPSTTPSTPSTTPSTPSAVPQTPVNPSA  387

Query  569  ---kSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLL  399
               K  AWC+PK GVSD+QLQAN+DYVCG G DCS IQ GG CFEPNTV SHAAYAMNLL
Sbjct  388  PKPKKAAWCLPKAGVSDSQLQANIDYVCGHGFDCSPIQQGGACFEPNTVQSHAAYAMNLL  447

Query  398  YQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPSGST  291
            YQTAG +P NCDFSQTATLSS NPSYDGC YP GST
Sbjct  448  YQTAGGDPLNCDFSQTATLSSNNPSYDGCHYPGGST  483



>ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Vitis vinifera]
 emb|CBI32582.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 149/187 (80%), Gaps = 8/187 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GD+  VGPSIENAKAY GNLI HLRS+ GTPLMP KSVDTY+FALYDE LKPGP SER
Sbjct  302  YSGDANGVGPSIENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDENLKPGPGSER  361

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps--------pkSGAWCVPKEGVSDAQLQANLD  504
            +FGLF+PDL+MT+D  LSK+        +          S  WCVPK GVSDAQLQANLD
Sbjct  362  AFGLFKPDLSMTYDVSLSKSSQTPSTPETPVNPSPNPTASSVWCVPKTGVSDAQLQANLD  421

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            Y C QGIDC+ IQPGG CFEPNTVASHAAYAMNLLYQ++GKN WNCDF+QTATL+S+NPS
Sbjct  422  YACSQGIDCTPIQPGGACFEPNTVASHAAYAMNLLYQSSGKNSWNCDFTQTATLTSSNPS  481

Query  323  YDGCTYP  303
            Y+ CT+P
Sbjct  482  YNACTFP  488



>ref|XP_006379239.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
 gb|ABK95837.1| unknown [Populus trichocarpa]
 gb|ERP57036.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
Length=452

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 151/187 (81%), Gaps = 4/187 (2%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPS+ENA+AY GNLI+ LRS+VGTPLMP KSVDTY+FALYDE LKPGP SER
Sbjct  266  YKGDSNEVGPSVENARAYNGNLISRLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPASER  325

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG----AWCVPKEGVSDAQLQANLDYVCG  492
            SFGLF+PDL+MT+D GLSK+        +         WCVPK G S+AQLQA+LDY CG
Sbjct  326  SFGLFKPDLSMTYDIGLSKSSLTPSTPVTSSPKPATVGWCVPKTGASEAQLQASLDYACG  385

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC  IQPGG CF P+T+ASHAAYA+NL +Q + K+PWNCDFS+TATL+S NPSY+GC
Sbjct  386  QGIDCGPIQPGGACFIPDTLASHAAYAINLYFQASAKSPWNCDFSETATLTSKNPSYNGC  445

Query  311  TYPSGST  291
            TYP GST
Sbjct  446  TYPGGST  452



>ref|XP_004148850.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis sativus]
 gb|KGN61789.1| hypothetical protein Csa_2G246520 [Cucumis sativus]
Length=464

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 148/190 (78%), Gaps = 7/190 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVG S+ENA+AY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  275  YRGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPTSER  334

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG-------AWCVPKEGVSDAQLQANLDY  501
            +FGLF P+LTMT+D GLSK         +P +         WC+PK  + D QLQ+NLDY
Sbjct  335  AFGLFYPNLTMTYDVGLSKNSQTPTTPTTPTTPSSKPTAPVWCLPKADIPDDQLQSNLDY  394

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             CG GIDC  IQPGG CFEPNT+ SHAAYAMNL YQ+ GKNPWNCDFSQTATL+S NPSY
Sbjct  395  ACGHGIDCGPIQPGGACFEPNTIQSHAAYAMNLYYQSLGKNPWNCDFSQTATLTSANPSY  454

Query  320  DGCTYPSGST  291
            + CTYP GST
Sbjct  455  NACTYPGGST  464



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 152/195 (78%), Gaps = 12/195 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVGPS+ENA+AY GNLI HLRS VGTPLMP KSV+TY+FALYDE LKPG TSER
Sbjct  270  YRGDSNEVGPSVENARAYNGNLIAHLRSQVGTPLMPGKSVETYIFALYDEDLKPGGTSER  329

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk------------SGAWCVPKEGVSDAQLQ  516
            SFGL++PDLT+T+D GLSK+        +              S AWCVPK GVSDAQLQ
Sbjct  330  SFGLYKPDLTVTYDVGLSKSSQTPSTPSTSTPTTPRVTPSPKPSSAWCVPKAGVSDAQLQ  389

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            ANLDY CG GIDCSAIQPGG CF+PNTVASHAAYAMNL Y T G  P NCDFSQTATL+S
Sbjct  390  ANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTIPLNCDFSQTATLTS  449

Query  335  TNPSYDGCTYPSGST  291
            +NPSY+ CTYP G+T
Sbjct  450  SNPSYNACTYPGGNT  464



>ref|XP_008236880.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Prunus mume]
Length=463

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 153/194 (79%), Gaps = 11/194 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVGPS+ENA+AY GNLI HLRS VGTPLMP KSV+TY+FALYDE LKPG TSER
Sbjct  270  YRGDSNEVGPSVENARAYNGNLIAHLRSRVGTPLMPGKSVETYIFALYDEDLKPGGTSER  329

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-----------SGAWCVPKEGVSDAQLQA  513
            SFGL++PDLT+T+D GLSK+      TPS             S AWCVPK GVSDAQLQA
Sbjct  330  SFGLYKPDLTVTYDVGLSKSSQTPSTTPSTPSTPRVTPSPKPSSAWCVPKAGVSDAQLQA  389

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            NLDY CG GIDCSAIQPGG CF+PNTVASHAAYAMNL Y T G  P NCDFSQTATL S+
Sbjct  390  NLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTIPLNCDFSQTATLISS  449

Query  332  NPSYDGCTYPSGST  291
            NPSY+ CTYP G+T
Sbjct  450  NPSYNACTYPGGNT  463



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVG S+ENA+A+ GNLI HLRS+VGTPLMP KSV+TY+FALYDE LKPGPTSER
Sbjct  272  YHGDSNEVGTSVENARAFNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPTSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-----kSGAWCVPKEGVSDAQLQANLDYVC  495
            SFGLF+PDLT T++ GL+K+                SG WCVPK GVSDAQLQANLDY C
Sbjct  332  SFGLFKPDLTATYEVGLTKSSQTPSTPMVSPSPKPTSGQWCVPKSGVSDAQLQANLDYAC  391

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            G GIDCSAIQPGG CF+PNTVASHAAYAMNL Y T G  P NCDFSQTA L+S+NPSY+ 
Sbjct  392  GHGIDCSAIQPGGSCFDPNTVASHAAYAMNLYYHTVGTIPLNCDFSQTAMLTSSNPSYNA  451

Query  314  CTYPSGST  291
            C+Y  GST
Sbjct  452  CSYTGGST  459



>ref|XP_004230886.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Solanum lycopersicum]
Length=473

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 153/201 (76%), Gaps = 19/201 (9%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP  SVDTY+FALYDE LKPGP SER
Sbjct  272  YKGDPNEVGPSMDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-------------------SGAWCVPKEG  537
            SFGLF+PDL+ T+DAGLSK         +P                    S  WC+PK G
Sbjct  332  SFGLFKPDLSTTYDAGLSKNSQAPTAPVTPAPVTPTTPITPVTPAPKPTGSATWCLPKPG  391

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
            + D++LQ+NLDY C  GIDCS IQ GGPCFEPNTVASHAAYAMN+LYQTAG+NPWNCDFS
Sbjct  392  IPDSELQSNLDYACSMGIDCSPIQEGGPCFEPNTVASHAAYAMNVLYQTAGRNPWNCDFS  451

Query  356  QTATLSSTNPSYDGCTYPSGS  294
            QTA+L+STNPSY+GCTYP G+
Sbjct  452  QTASLTSTNPSYNGCTYPGGN  472



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 147/188 (78%), Gaps = 5/188 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVG S+ENA+AY GNLI HLRS+VGTPLMP KSV+TY+FALYDE LKPGP SER
Sbjct  272  YHGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPASER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-----kSGAWCVPKEGVSDAQLQANLDYVC  495
            SFGLF+PDLT T++ GL+K+                SG WCVPK GVSDAQLQANLDY C
Sbjct  332  SFGLFKPDLTATYEVGLTKSSQTPSTPTVSPSPKPTSGQWCVPKSGVSDAQLQANLDYAC  391

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            G GIDCSAIQPGG CF+PNTVASHAAYAMNL Y T G  P NCDFSQTA L+S+NPSY+ 
Sbjct  392  GHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTVPLNCDFSQTAMLTSSNPSYNA  451

Query  314  CTYPSGST  291
            C+Y  GST
Sbjct  452  CSYTGGST  459



>gb|KCW67838.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=352

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 148/206 (72%), Gaps = 23/206 (11%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRSLVGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  147  YKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTSER  206

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-----------------------SGAWCV  549
            +FGLF+ DL+M +D GLSK+         P                           WC+
Sbjct  207  AFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANWCI  266

Query  548  PKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN  369
            PK GVSDAQLQANLDY CGQGIDC  IQPGG CFEPNT+A+HAAYAMNL YQ + ++P N
Sbjct  267  PKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRSPTN  326

Query  368  CDFSQTATLSSTNPSYDGCTYPSGST  291
            CDFSQ+AT SS NPSY+GC YPSG +
Sbjct  327  CDFSQSATFSSNNPSYNGCVYPSGKS  352



>ref|NP_001275210.1| glucan endo-1,3-beta-D-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52647.1| beta-1,3-glucanase 12 [Solanum tuberosum]
Length=470

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 152/198 (77%), Gaps = 16/198 (8%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP  SVDTY+FALYDE LKPGP SER
Sbjct  272  YKGDPNEVGPSMDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk----------------SGAWCVPKEGVSD  528
            SFGLF+PDL+ T+DAGLSK         +P                 S  WC+PK G+ D
Sbjct  332  SFGLFKPDLSTTYDAGLSKKSQTPTAPVTPAPATPTTPVTPAPKPTGSATWCLPKPGIPD  391

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
            ++LQ+NLDY C  GIDCS IQ GGPCFEP TVASHAAYAMN+LYQTAG+NPWNCDFSQTA
Sbjct  392  SELQSNLDYACSMGIDCSPIQEGGPCFEPITVASHAAYAMNVLYQTAGRNPWNCDFSQTA  451

Query  347  TLSSTNPSYDGCTYPSGS  294
            +L+STNPSY+GCTYP G+
Sbjct  452  SLTSTNPSYNGCTYPGGN  469



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 146/188 (78%), Gaps = 5/188 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVG S+ENA+AY GNLI HLRS+VGTPLMP KSV+TY+FALYDE LKPGP SER
Sbjct  272  YHGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPASER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-----kSGAWCVPKEGVSDAQLQANLDYVC  495
            SFGLF+PDLT T++ GL+K+                S  WCVPK GVSDAQLQANLDY C
Sbjct  332  SFGLFKPDLTATYEVGLTKSSQTPSTPTVSPSPKPTSAQWCVPKSGVSDAQLQANLDYAC  391

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            G GIDCSAIQPGG CF+PNTVASHAAYAMNL Y T G  P NCDFSQTA L+S+NPSY+ 
Sbjct  392  GHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTVPLNCDFSQTAMLTSSNPSYNA  451

Query  314  CTYPSGST  291
            C+Y  GST
Sbjct  452  CSYTGGST  459



>gb|KHN33758.1| Glucan endo-1,3-beta-glucosidase 7, partial [Glycine soja]
Length=403

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 4/186 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS E+GPS+ENAKAY GNLI+HLRSLVGTPLMP KSVDTY+FALYDE LK GP SER+
Sbjct  218  RGDSNELGPSVENAKAYNGNLISHLRSLVGTPLMPGKSVDTYIFALYDEDLKQGPGSERA  277

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCGQ  489
            FG+F+ D T+++D GL+K+   TP T     +PK+  WC+PK GVSDAQLQAN+DY C Q
Sbjct  278  FGMFKTDRTVSYDVGLTKSSQQTPSTSPTTPAPKTAGWCIPKAGVSDAQLQANIDYACSQ  337

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GIDC  IQPGG CFEPNTVASHAAY+MNL YQT+GKN WNCDFSQ+ATL+S NPSY+ C 
Sbjct  338  GIDCGPIQPGGACFEPNTVASHAAYSMNLYYQTSGKNQWNCDFSQSATLTSQNPSYNACI  397

Query  308  YPSGST  291
            Y  GST
Sbjct  398  YTGGST  403



>ref|XP_010060942.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67837.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=474

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 148/206 (72%), Gaps = 23/206 (11%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRSLVGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  269  YKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTSER  328

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-----------------------SGAWCV  549
            +FGLF+ DL+M +D GLSK+         P                           WC+
Sbjct  329  AFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANWCI  388

Query  548  PKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN  369
            PK GVSDAQLQANLDY CGQGIDC  IQPGG CFEPNT+A+HAAYAMNL YQ + ++P N
Sbjct  389  PKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRSPTN  448

Query  368  CDFSQTATLSSTNPSYDGCTYPSGST  291
            CDFSQ+AT SS NPSY+GC YPSG +
Sbjct  449  CDFSQSATFSSNNPSYNGCVYPSGKS  474



>ref|XP_004293211.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 151/211 (72%), Gaps = 29/211 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTY FALYDE LKPGP SER
Sbjct  269  YKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYFFALYDENLKPGPGSER  328

Query  659  SFGLFRPDLTMTFDAGLsktvtpt-----------------------------pvtpspk  567
            +FGLF+PDLTMT+D GL+K+ + T                                P P 
Sbjct  329  AFGLFKPDLTMTYDVGLAKSASQTPTTPTMPATPTVPTTPKTPSTGPKTPANPSAAPKPN  388

Query  566  SGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
             G WC+PK+G S+ QLQAN+DYVCG G DCS IQPGG CFEPN VASHAAYAMN+LYQTA
Sbjct  389  KGVWCLPKKGASETQLQANIDYVCGHGFDCSPIQPGGACFEPNNVASHAAYAMNILYQTA  448

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYPSGS  294
            G +  NCDFSQTATLSS NPSYD C YPSGS
Sbjct  449  GHDAQNCDFSQTATLSSNNPSYDSCNYPSGS  479



>ref|XP_010519110.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Tarenaya hassleriana]
Length=475

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 155/204 (76%), Gaps = 21/204 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVG ++ENAKAY  NL++HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  272  YKGDPNEVGATVENAKAYNENLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPMSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps--------------------pkSGAWCVPKE  540
            +FGLFRPDLTMT+D GLSK+ +      +                     K+  WCVPK 
Sbjct  332  AFGLFRPDLTMTYDVGLSKSSSSGGNNQAPATPKTPATSPRSPATTPAPNKNTNWCVPKA  391

Query  539  GVSDAQLQANLDYVCG-QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCD  363
            GVSD+QLQAN+DYVCG Q +DCSAIQPGG CFEPNTVASHA YAMNLL+  AG NPWNCD
Sbjct  392  GVSDSQLQANIDYVCGTQALDCSAIQPGGSCFEPNTVASHATYAMNLLFHAAGSNPWNCD  451

Query  362  FSQTATLSSTNPSYDGCTYPSGST  291
            FSQTATL+S NPSY+GCTY SGST
Sbjct  452  FSQTATLTSNNPSYNGCTYASGST  475



>gb|KHN20071.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=445

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENAKAY GNLI HLRSLVGTPLMP KSVDTY+FALYDE LKPGP SER+
Sbjct  261  RGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGSERA  320

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS---GAWCVPKEGVSDAQLQANLDYVCGQG  486
            FG+F+ D T+ +D GL+K+   TP TP   +     WCV K GVSDAQLQAN+DY C QG
Sbjct  321  FGMFKTDRTVLYDVGLTKSSQQTPTTPVTPAPNTAGWCVAKAGVSDAQLQANIDYACSQG  380

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  IQPGG CFEPNT+ASHAA+AMNL YQT+GKN WNCDFSQ+ATL+S NPSY+ C Y
Sbjct  381  IDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKNQWNCDFSQSATLTSQNPSYNACIY  440

Query  305  PSGST  291
              GST
Sbjct  441  TGGST  445



>ref|XP_009605959.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 152/208 (73%), Gaps = 26/208 (13%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTP+MP  SVDTY+FALYDE LKPGP SER
Sbjct  272  YKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPVMPGISVDTYIFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkS-------------------------GAW  555
            SFGLF+PDL++T+D GLSK         +P S                          AW
Sbjct  332  SFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGSAW  391

Query  554  CVPKEGVSDAQLQANLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKN  378
            C+PK G  DA+LQANLDY C Q GIDC+ IQ GG CFEPNTVASHAAYAMNLLYQTAG+N
Sbjct  392  CMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVASHAAYAMNLLYQTAGRN  451

Query  377  PWNCDFSQTATLSSTNPSYDGCTYPSGS  294
            PWNCDFSQTA L+STNPSYDGCTYP GS
Sbjct  452  PWNCDFSQTAALTSTNPSYDGCTYPGGS  479



>ref|XP_006581121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=459

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENAKAY GNLI HLRSLVGTPLMP KSVDTY+FALYDE LKPGP SER+
Sbjct  275  RGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGSERA  334

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS---GAWCVPKEGVSDAQLQANLDYVCGQG  486
            FG+F+ D T+ +D GL+K+   TP TP   +     WCV K GVSDAQLQAN+DY C QG
Sbjct  335  FGMFKTDRTVLYDVGLTKSSQQTPTTPVTPAPNTAGWCVAKAGVSDAQLQANIDYACSQG  394

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  IQPGG CFEPNT+ASHAA+AMNL YQT+GKN WNCDFSQ+ATL+S NPSY+ C Y
Sbjct  395  IDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKNQWNCDFSQSATLTSQNPSYNACIY  454

Query  305  PSGST  291
              GST
Sbjct  455  TGGST  459



>ref|XP_006581120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=480

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENAKAY GNLI HLRSLVGTPLMP KSVDTY+FALYDE LKPGP SER+
Sbjct  296  RGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGSERA  355

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS---GAWCVPKEGVSDAQLQANLDYVCGQG  486
            FG+F+ D T+ +D GL+K+   TP TP   +     WCV K GVSDAQLQAN+DY C QG
Sbjct  356  FGMFKTDRTVLYDVGLTKSSQQTPTTPVTPAPNTAGWCVAKAGVSDAQLQANIDYACSQG  415

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  IQPGG CFEPNT+ASHAA+AMNL YQT+GKN WNCDFSQ+ATL+S NPSY+ C Y
Sbjct  416  IDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKNQWNCDFSQSATLTSQNPSYNACIY  475

Query  305  PSGST  291
              GST
Sbjct  476  TGGST  480



>ref|XP_003522947.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Glycine max]
Length=459

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 4/186 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS E+GPS+ENAKAY GNLI+HLRSLVGTPLMP KSVDTY+FALYDE LK GP SER+
Sbjct  274  RGDSNELGPSVENAKAYNGNLISHLRSLVGTPLMPGKSVDTYIFALYDEDLKQGPGSERA  333

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCGQ  489
            FG+F+ D T+++D GL+K+   TP T     +PK+  WC+PK GVSDAQLQAN+DY C Q
Sbjct  334  FGMFKTDRTVSYDVGLTKSSQQTPSTSPTTPAPKTAGWCIPKAGVSDAQLQANIDYACSQ  393

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GIDC  IQPGG CFEPNTVASHAAY+MNL YQT+GKN WNCDFSQ+ATL+S NPSY+ C 
Sbjct  394  GIDCGPIQPGGACFEPNTVASHAAYSMNLYYQTSGKNQWNCDFSQSATLTSQNPSYNACI  453

Query  308  YPSGST  291
            Y  GST
Sbjct  454  YTGGST  459



>ref|XP_010664681.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Vitis 
vinifera]
Length=500

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 145/184 (79%), Gaps = 12/184 (7%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI+HLRSLVGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  271  YKGDSNEVGPSIENAKAYNGNLISHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps------------pkSGAWCVPKEGVSDAQLQ  516
            +FGLF+ DLTMT+D GLSK    T   P+              +G WCVPK  VS+AQLQ
Sbjct  331  AFGLFKTDLTMTYDVGLSKGAQNTTPAPATPKTPATPSPSPSTNGTWCVPKSVVSNAQLQ  390

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            ANLDY CGQGIDC  +QPGG CFEPNTVASHAAYAMNL YQ + +NPWNCDFSQTATL+S
Sbjct  391  ANLDYACGQGIDCRPVQPGGACFEPNTVASHAAYAMNLFYQNSARNPWNCDFSQTATLTS  450

Query  335  TNPS  324
             NPS
Sbjct  451  KNPS  454



>ref|XP_010942826.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Elaeis guineensis]
Length=464

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 148/191 (77%), Gaps = 12/191 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVG ++ENA+A+VGNL++HLRS+ GTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  271  YRGDSDEVGATVENARAFVGNLVSHLRSMNGTPLMPGKSVDTYIFALYDEDLKPGPTSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp-----------spkSGAWCVPKEGVSDAQLQA  513
            SFGLFRPDLTMT+DAGLSK+ +                 +  +  WCVPKEG +D +LQ 
Sbjct  331  SFGLFRPDLTMTYDAGLSKSGSTAQGNSSSAGAPAKGSPAAATAGWCVPKEGATDEELQT  390

Query  512  NLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            NLDY CGQ G+DC  IQPGG C+EPNTV SHAAYAMN LYQ +G+NPWNCDF Q+ATL+S
Sbjct  391  NLDYACGQAGVDCGPIQPGGACYEPNTVRSHAAYAMNQLYQMSGRNPWNCDFQQSATLTS  450

Query  335  TNPSYDGCTYP  303
             NPSY  C YP
Sbjct  451  ANPSYSTCVYP  461



>ref|XP_009804916.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
sylvestris]
Length=480

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 151/208 (73%), Gaps = 26/208 (13%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS++NAKAY GNLI HLRS+VGTPLMP  SVDTY+FALYDE LKPGP SER
Sbjct  272  YKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkS-------------------------GAW  555
            SFGLF+PDL++T+D GLSK         +P S                          AW
Sbjct  332  SFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGAAW  391

Query  554  CVPKEGVSDAQLQANLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKN  378
            C+PK G  DA+LQANLDY C Q GIDC+ IQ GG CFEPNTVASHAAYAMNLLYQTAG+N
Sbjct  392  CMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVASHAAYAMNLLYQTAGRN  451

Query  377  PWNCDFSQTATLSSTNPSYDGCTYPSGS  294
            PWNCDFSQTA L+STNPSY GCTYP GS
Sbjct  452  PWNCDFSQTAALTSTNPSYGGCTYPGGS  479



>gb|AFS50098.1| glucan endo-1,3-beta-glucosidase [Elaeis guineensis]
Length=465

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 148/191 (77%), Gaps = 12/191 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GDS EVG ++ENA+A+VGNL++HLRS+ GTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  272  YRGDSDEVGATVENARAFVGNLVSHLRSMNGTPLMPGKSVDTYIFALYDEDLKPGPTSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp-----------spkSGAWCVPKEGVSDAQLQA  513
            SFGLFRPDLTMT+DAGLSK+ +                 +  +  WCVPKEG +D +LQ 
Sbjct  332  SFGLFRPDLTMTYDAGLSKSGSTAQGNSSSAGAPAKGSPAAATAGWCVPKEGATDEELQT  391

Query  512  NLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            NLDY CGQ G+DC  IQPGG C+EPNTV SHAAYAMN LYQ +G+NPWNCDF Q+ATL+S
Sbjct  392  NLDYACGQAGVDCGPIQPGGACYEPNTVRSHAAYAMNQLYQMSGRNPWNCDFQQSATLTS  451

Query  335  TNPSYDGCTYP  303
             NPSY  C YP
Sbjct  452  ANPSYSTCVYP  462



>ref|XP_009365605.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=483

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 151/216 (70%), Gaps = 33/216 (15%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDDNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPGSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp------------------------------  570
            +FGLF+PDLTM +D GLSK+        +P                              
Sbjct  328  AFGLFKPDLTMAYDVGLSKSSQTPTTPITPTTPSMPTTPSTPSASPMPSAVPKTPVNPSG  387

Query  569  ---kSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLL  399
               K  ++CVPK GVSD+QLQAN+DYVCG+G DC+ IQPGG CFEPN V SHAAYAMNLL
Sbjct  388  PNPKKESYCVPKAGVSDSQLQANIDYVCGRGFDCTPIQPGGSCFEPNNVKSHAAYAMNLL  447

Query  398  YQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPSGST  291
            YQT G +P NCDFSQTATLSS NPSYD C YP GST
Sbjct  448  YQTTGGDPQNCDFSQTATLSSNNPSYDSCNYPGGST  483



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 148/191 (77%), Gaps = 12/191 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD+ EVG ++ENAKAYVGNL+  L+S+VGTPLMP KSVDTY+FALYDE LKPGPTSER
Sbjct  271  YRGDADEVGATVENAKAYVGNLVARLKSMVGTPLMPGKSVDTYIFALYDEDLKPGPTSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------AWCVPKEGVSDAQLQA  513
            SFGLFRPDL+MT+DAGLSK+ +      S  +             WCVPKEG +D +LQA
Sbjct  331  SFGLFRPDLSMTYDAGLSKSSSTAQGNSSSAAAPAKRSPAAAATGWCVPKEGATDEELQA  390

Query  512  NLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            NLDY CGQ G+DC  IQPGG C+EPNT+ SHAAYAMN LYQ AG+NPWNCDFSQ+A L+S
Sbjct  391  NLDYACGQAGVDCGPIQPGGACYEPNTLRSHAAYAMNQLYQVAGRNPWNCDFSQSAALTS  450

Query  335  TNPSYDGCTYP  303
             NPSY  C YP
Sbjct  451  ANPSYATCVYP  461



>ref|XP_004500813.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cicer arietinum]
Length=440

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 144/177 (81%), Gaps = 7/177 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENA AY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LK GP SER+
Sbjct  269  RGDSNEVGPSVENASAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKSGPGSERA  328

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FGLF+PDL+M++D GL+K+   TP         WC+PK GVSD QLQ+N+DY CGQGIDC
Sbjct  329  FGLFKPDLSMSYDVGLAKSTHQTP-------AGWCIPKAGVSDTQLQSNIDYACGQGIDC  381

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
              I+PGG CFEPNTVASHAA+ MNL YQT G+N WNCDFSQTATL+S NPSY+ C Y
Sbjct  382  GPIKPGGACFEPNTVASHAAFVMNLYYQTFGRNQWNCDFSQTATLTSQNPSYNACIY  438



>gb|AES74164.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=325

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 148/187 (79%), Gaps = 6/187 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVGPS+ENAKAY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LKPGP SER+F
Sbjct  139  GDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGSERAF  198

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA------WCVPKEGVSDAQLQANLDYVCG  492
            GLF+ DL+M++D GL+K+    P + SP + A      WCVPK GVSDAQLQ N+DY C 
Sbjct  199  GLFKTDLSMSYDIGLAKSSQQNPPSTSPVTPAPITSAGWCVPKAGVSDAQLQNNIDYACS  258

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC  I PGG CFEPNTVASHAA+ MNL YQT G+N WNCDF+QTA L+S NPSY+ C
Sbjct  259  QGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRNQWNCDFTQTAKLTSQNPSYNAC  318

Query  311  TYPSGST  291
             Y  GST
Sbjct  319  NYAGGST  325



>gb|KHN20986.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=318

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 147/207 (71%), Gaps = 25/207 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS E GPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  111  YKGDSNEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPASER  170

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv-------------------------tpspkSGAW  555
            +FGL+ PD +M +DAGLSK    +                           T +  S  W
Sbjct  171  AFGLYNPDQSMIYDAGLSKQQETSSPVPTVAPTTPDVSKSPSTPKPTVSSPTKTNNSATW  230

Query  554  CVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNP  375
            CVPK GV+DAQLQANLDY CGQGIDC+AIQ GG CFEPNT+ +HAAYAMNLLYQTAG+NP
Sbjct  231  CVPKGGVADAQLQANLDYACGQGIDCTAIQQGGACFEPNTLVNHAAYAMNLLYQTAGRNP  290

Query  374  WNCDFSQTATLSSTNPSYDGCTYPSGS  294
              CDFSQTA LS+ NPSY  C Y  G+
Sbjct  291  LTCDFSQTAMLSTNNPSYKSCLYAGGN  317



>ref|XP_008377425.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=474

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 149/207 (72%), Gaps = 24/207 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPS+ENAKAY GNLI HLRS++GTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  268  YKGDDNEVGPSVENAKAYNGNLIAHLRSMLGTPLMPGKSVDTYLFALYDENLKPGPGSER  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG------------------------AWC  552
            +FGLF+PDLTM +D GLSK+        +P +                         ++C
Sbjct  328  AFGLFKPDLTMAYDVGLSKSSXTPTTPITPTTPSASPMPSAVPKTPVNPSGPNPKKESYC  387

Query  551  VPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPW  372
            VPK GVSD+QLQAN+DYVCG G DC+ IQPGG CFEPN V SHAAYAMNLLYQT G +  
Sbjct  388  VPKAGVSDSQLQANIDYVCGSGFDCTPIQPGGSCFEPNNVKSHAAYAMNLLYQTTGGDTQ  447

Query  371  NCDFSQTATLSSTNPSYDGCTYPSGST  291
            NCDFSQTATLSS NPSYD C YP GST
Sbjct  448  NCDFSQTATLSSNNPSYDSCNYPGGST  474



>ref|XP_007136171.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
 gb|ESW08165.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
Length=457

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 146/187 (78%), Gaps = 7/187 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENAKA+ GNLI HLRSLVGTPLMP KSVDTY+FALYDE LKPGP SER+
Sbjct  269  RGDSNEVGPSLENAKAFNGNLINHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGSERA  328

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspk-------SGAWCVPKEGVSDAQLQANLDYV  498
            FGLF+ D TM +DAGL+K+   TP T           +  WCVPK G+SD QLQAN+DY 
Sbjct  329  FGLFKTDGTMAYDAGLAKSSQQTPSTSPKTPVTPAPNTSGWCVPKAGISDDQLQANIDYA  388

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C QGIDC  IQPGG CFEPNTVASHAA+AMNL YQT+ KN WNCDFSQ+ATL+S NPSY+
Sbjct  389  CSQGIDCGPIQPGGACFEPNTVASHAAFAMNLYYQTSAKNQWNCDFSQSATLTSQNPSYN  448

Query  317  GCTYPSG  297
             C Y  G
Sbjct  449  ACIYSGG  455



>gb|KJB32499.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=484

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 145/179 (81%), Gaps = 7/179 (4%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HL+S+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  267  YSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  326

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp-------kSGAWCVPKEGVSDAQLQANLDY  501
            +FGL++ DL+MT+D G+SK+    P   +P        +  WCVPK G+SDAQLQ++LDY
Sbjct  327  AFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPTATGWCVPKAGISDAQLQSSLDY  386

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
             CGQGIDCS IQPGG CFEPNTVASHAAYAMNL YQ + KNPWNCDFSQTATL+S NPS
Sbjct  387  ACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPS  445



>ref|XP_004299094.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 146/201 (73%), Gaps = 20/201 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPS+ENAKAY GNLI HLRS+VGTPL+P K V+TY+FALYDE LKPGP SER
Sbjct  269  YHGDSNEVGPSVENAKAYNGNLIQHLRSMVGTPLIPGKPVETYIFALYDEDLKPGPASER  328

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtps-------------------pkSGAWCVPK-E  540
            SFGLF+PDL+ T+DAGLSK+                              S  WCVPK  
Sbjct  329  SFGLFKPDLSPTYDAGLSKSSQTPSTPSVTPSPKPTPSTPSVTPSPKPATSSKWCVPKTS  388

Query  539  GVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDF  360
            GVSDAQLQANLDY CG GIDCS IQPGG CF+PNTVASHAAYAMNL Y T G +P NCDF
Sbjct  389  GVSDAQLQANLDYACGHGIDCSPIQPGGACFDPNTVASHAAYAMNLYYHTVGTDPMNCDF  448

Query  359  SQTATLSSTNPSYDGCTYPSG  297
            SQTATL+STNPSY+ C YP G
Sbjct  449  SQTATLTSTNPSYNACVYPGG  469



>ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES74163.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=459

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 148/187 (79%), Gaps = 6/187 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVGPS+ENAKAY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LKPGP SER+F
Sbjct  273  GDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGSERAF  332

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA------WCVPKEGVSDAQLQANLDYVCG  492
            GLF+ DL+M++D GL+K+    P + SP + A      WCVPK GVSDAQLQ N+DY C 
Sbjct  333  GLFKTDLSMSYDIGLAKSSQQNPPSTSPVTPAPITSAGWCVPKAGVSDAQLQNNIDYACS  392

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC  I PGG CFEPNTVASHAA+ MNL YQT G+N WNCDF+QTA L+S NPSY+ C
Sbjct  393  QGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRNQWNCDFTQTAKLTSQNPSYNAC  452

Query  311  TYPSGST  291
             Y  GST
Sbjct  453  NYAGGST  459



>ref|XP_007160762.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32756.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=473

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 146/202 (72%), Gaps = 20/202 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD++E GPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPG  SER
Sbjct  271  YKGDTSEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGDASER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtptpv--------------------tpspkSGAWCVPKE  540
            +FGLF PD +M +DAGL+K                           T +  SG WCVPK 
Sbjct  331  AFGLFNPDQSMIYDAGLTKQQQTNSPVPVSAPTTPDLSKSPVTPKPTKTNSSGTWCVPKA  390

Query  539  GVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDF  360
            GVSDA+LQANLDY CGQGIDC AIQ GG CFEPNT+ +HAAYAMNLLYQTAG+NP  CDF
Sbjct  391  GVSDAELQANLDYACGQGIDCVAIQQGGACFEPNTLLNHAAYAMNLLYQTAGRNPLTCDF  450

Query  359  SQTATLSSTNPSYDGCTYPSGS  294
            SQTA LS+ NPSY  C Y  G+
Sbjct  451  SQTAMLSTNNPSYKSCLYAGGN  472



>ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=477

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 148/187 (79%), Gaps = 6/187 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVGPS+ENAKAY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LKPGP SER+F
Sbjct  291  GDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGSERAF  350

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA------WCVPKEGVSDAQLQANLDYVCG  492
            GLF+ DL+M++D GL+K+    P + SP + A      WCVPK GVSDAQLQ N+DY C 
Sbjct  351  GLFKTDLSMSYDIGLAKSSQQNPPSTSPVTPAPITSAGWCVPKAGVSDAQLQNNIDYACS  410

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC  I PGG CFEPNTVASHAA+ MNL YQT G+N WNCDF+QTA L+S NPSY+ C
Sbjct  411  QGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRNQWNCDFTQTAKLTSQNPSYNAC  470

Query  311  TYPSGST  291
             Y  GST
Sbjct  471  NYAGGST  477



>ref|XP_004507424.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cicer arietinum]
Length=458

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E+GPS+ENAKAY GNLITHLRSLVGTPLMP KS+DTY+F LYDE LKPGP SER+
Sbjct  272  RGDNNEIGPSVENAKAYNGNLITHLRSLVGTPLMPAKSIDTYIFGLYDEDLKPGPGSERA  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCG-  492
            FGL++ DLT+ +D GL K+   +P +        +  WC+P  GV+D+QLQ NLDYVC  
Sbjct  332  FGLYKIDLTVAYDVGLDKSTQKSPSSSPKGRVTPATQWCIPVVGVTDSQLQTNLDYVCSR  391

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            +GIDC  IQ GG CFEPNT+ASHAAYAMN  YQ  GKNPWNCDF+QTATL+S NPSY+ C
Sbjct  392  EGIDCKEIQQGGACFEPNTIASHAAYAMNFYYQKFGKNPWNCDFAQTATLTSQNPSYNTC  451

Query  311  TYPSGST  291
             YPSGST
Sbjct  452  IYPSGST  458



>ref|XP_003544417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=484

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 148/207 (71%), Gaps = 25/207 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS E GPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  277  YKGDSNEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPASER  336

Query  659  SFGLFRPDLTMTFDAGLsktv-------------------------tptpvtpspkSGAW  555
            +FGL+ PD +M +DAGLSK                           T +  T +  S  W
Sbjct  337  AFGLYNPDQSMIYDAGLSKQQETSSPVPTVAPTTPDVSKSPSTPKPTVSSPTKTNNSATW  396

Query  554  CVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNP  375
            CVPK GV+DAQLQANLDY CGQGIDC+AIQ GG CFEPNT+ +HAAYAMNLLYQTAG+NP
Sbjct  397  CVPKGGVADAQLQANLDYACGQGIDCTAIQQGGACFEPNTLVNHAAYAMNLLYQTAGRNP  456

Query  374  WNCDFSQTATLSSTNPSYDGCTYPSGS  294
              CDFSQTA LS+ NPSY  C Y  G+
Sbjct  457  LTCDFSQTAMLSTNNPSYKSCLYAGGN  483



>ref|XP_003606895.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89092.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=464

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 151/192 (79%), Gaps = 10/192 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVGPS+ENAKAY GNLITHLRSLVGTPLMP KS+DTY+FALYDE LKPG  SER+
Sbjct  273  RGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLMPGKSIDTYIFALYDEDLKPGAGSERA  332

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtps---------pkSGAWCVPKEGVSDAQLQANLD  504
            FGL++ DLT+ +D GL K+    P + S           +  WC+PK GVSD QLQANLD
Sbjct  333  FGLYKTDLTVAYDVGLDKSTQKGPPSTSPNAPVTPAPKTTSQWCIPKGGVSDDQLQANLD  392

Query  503  YVCG-QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            Y C  +G+DC  IQPGG C++PNTVASH+A+AMNL YQ  G+NPWNCDFSQTA+L+S NP
Sbjct  393  YACSREGMDCGPIQPGGACYDPNTVASHSAFAMNLYYQKFGRNPWNCDFSQTASLTSQNP  452

Query  326  SYDGCTYPSGST  291
            SY+GCTYPSGST
Sbjct  453  SYNGCTYPSGST  464



>gb|KJB58293.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=472

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 153/202 (76%), Gaps = 19/202 (9%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVG SIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGPTSER
Sbjct  271  YKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPTSER  330

Query  659  SFGLFR-PDLTMTFDAGLsktvtptpvtpspk------------------SGAWCVPKEG  537
            SFGL++  DLTMT+D GLSK+ +      SP                     +WCVPK+ 
Sbjct  331  SFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPATLSVVAPSPEPKKASWCVPKKD  390

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
            V+DA+LQA+LDY C  GIDCS IQPGG CFEPNT+++HAAYAMNL YQ++G +P +CDFS
Sbjct  391  VTDAELQASLDYACAHGIDCSPIQPGGSCFEPNTLSAHAAYAMNLYYQSSGPDPSSCDFS  450

Query  356  QTATLSSTNPSYDGCTYPSGST  291
            Q A LSS+NPSY+GCT+P GST
Sbjct  451  QAAMLSSSNPSYNGCTFPGGST  472



>gb|EPS59066.1| hypothetical protein M569_15744, partial [Genlisea aurea]
Length=440

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD TE+GPS++NAKAY GNLI HLRS+VGTPLMPRKSVDTYLFALYDE LKPGP SER
Sbjct  261  YRGDPTEIGPSLDNAKAYNGNLINHLRSMVGTPLMPRKSVDTYLFALYDEDLKPGPLSER  320

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            SFGLF+PDL+ T++ GLS                WCVP+ GV DA+LQ+NLDY CGQGID
Sbjct  321  SFGLFKPDLSTTYNVGLSSLSVSPARPTPSA-ARWCVPRAGVGDAELQSNLDYACGQGID  379

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            C  IQPGG CFEP  VASHAAYAMNLLYQT G+NPWNCDF QTA ++ TNPSYD C YP 
Sbjct  380  CGPIQPGGACFEPAAVASHAAYAMNLLYQTEGRNPWNCDFRQTAAVTDTNPSYDSCVYPG  439

Query  299  G  297
            G
Sbjct  440  G  440



>gb|KHG04672.1| hypothetical protein F383_30229 [Gossypium arboreum]
Length=472

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 154/202 (76%), Gaps = 19/202 (9%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVG SIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LK GPTSER
Sbjct  271  YKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKSGPTSER  330

Query  659  SFGLFR-PDLTMTFDAGLsktvtptpvtpspkS------------------GAWCVPKEG  537
            SFGL++  DLTMT+D GLSK+ +      SP +                   +WCVPK+ 
Sbjct  331  SFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPETPSAVAPSPEPKKASWCVPKKD  390

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
            V+D++LQA+LDY C  GIDCS IQPGG CFEPNT+++HAAYAMNL YQ++G++P +CDFS
Sbjct  391  VTDSELQASLDYACAHGIDCSPIQPGGSCFEPNTLSAHAAYAMNLYYQSSGRDPSSCDFS  450

Query  356  QTATLSSTNPSYDGCTYPSGST  291
            Q A LSS+NPSY+GCT+P GST
Sbjct  451  QAAMLSSSNPSYNGCTFPGGST  472



>ref|XP_007042209.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX98040.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=511

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 139/177 (79%), Gaps = 10/177 (6%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LK GP SER
Sbjct  310  YAGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPASER  369

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp----------spkSGAWCVPKEGVSDAQLQAN  510
            +FGLFRPDL+MT+DAGLSK+                   P +  WCVPK G+SDAQLQA+
Sbjct  370  AFGLFRPDLSMTYDAGLSKSSQTPSTPQNPVTPVTPQPKPTASGWCVPKAGISDAQLQAS  429

Query  509  LDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            LDY C QGIDC  IQPGG CFEPNTVASHAAYAMNL YQT+GKN WNCDFSQTAT++
Sbjct  430  LDYACSQGIDCGPIQPGGACFEPNTVASHAAYAMNLYYQTSGKNLWNCDFSQTATVT  486



>ref|XP_010530842.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Tarenaya hassleriana]
Length=499

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 146/185 (79%), Gaps = 5/185 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENAKAY GNLI HLRS+ GTPLMP K VDTY+FALYDE  KPGP SER+
Sbjct  267  RGDSNEVGPSLENAKAYNGNLIAHLRSMAGTPLMPGKPVDTYIFALYDENQKPGPPSERA  326

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSG-----AWCVPKEGVSDAQLQANLDYVCG  492
            FGLF  DL+M +D GL+K+ + +  + +P SG      WCVPK+ V+D QLQA+LD+ CG
Sbjct  327  FGLFNTDLSMVYDVGLAKSSSASNTSQAPPSGKTTSVGWCVPKKDVTDEQLQASLDWSCG  386

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
             GIDC  IQPGG C+EPN+VASHAAYAMNL +Q +GKNPW+CDFSQTA L+S NPSYD C
Sbjct  387  HGIDCGPIQPGGACYEPNSVASHAAYAMNLYFQMSGKNPWDCDFSQTAALTSQNPSYDNC  446

Query  311  TYPSG  297
             YP G
Sbjct  447  VYPGG  451



>gb|AIR93908.1| glucanase [Cicer arietinum]
Length=454

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 140/171 (82%), Gaps = 7/171 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVGPS+ENA AY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LK GP SER+
Sbjct  269  RGDSNEVGPSVENASAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKSGPGSERA  328

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FGLF+PDL+M++D GL+K+   TP         WC+PK GVSD QLQ+N+DY CGQGIDC
Sbjct  329  FGLFKPDLSMSYDVGLAKSTHQTP-------AGWCIPKAGVSDTQLQSNIDYACGQGIDC  381

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
              I+PGG CFEPNTVASHAA+ MNL YQT G+N WNCDFSQTATL+S NPS
Sbjct  382  GPIKPGGACFEPNTVASHAAFVMNLYYQTFGRNQWNCDFSQTATLTSQNPS  432



>ref|XP_008375942.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7 [Malus domestica]
Length=486

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 145/198 (73%), Gaps = 15/198 (8%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GD  E+GPS+ENA+AY GNLI HLRS+VGTPLMP +SV+TY+FALYDE LKPGP SER
Sbjct  274  YHGDDNEIGPSVENARAYNGNLIAHLRSMVGTPLMPGQSVETYIFALYDEDLKPGPASER  333

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp---------------kSGAWCVPKEGVSDA  525
             FGLF+PDLT T+D GL+K+   T +                    S  WCVPK  V  A
Sbjct  334  YFGLFKPDLTATYDVGLTKSSQMTHLKTFQRNTPSTPTVSPSPKPTSAQWCVPKSDVFIA  393

Query  524  QLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTAT  345
            QLQANLDY CG GIDCSAIQPGG CF+PNTVASHAAYAMNL Y      P NC+FSQTAT
Sbjct  394  QLQANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHIVVTVPLNCNFSQTAT  453

Query  344  LSSTNPSYDGCTYPSGST  291
            L+S+NPSY+GC+YP GST
Sbjct  454  LTSSNPSYNGCSYPGGST  471



>ref|XP_006856026.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Amborella trichopoda]
 gb|ERN17493.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
Length=457

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 6/188 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  EVG ++ENAKAY GNLI HLRS VGTPL P  S DTY+FAL+DE LK GP+SER
Sbjct  270  YEGDPNEVGANLENAKAYNGNLIKHLRSRVGTPLRPNTSPDTYIFALFDEDLKGGPSSER  329

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpsp------kSGAWCVPKEGVSDAQLQANLDYV  498
             FGL++PDL+MT+D GL K     P           K+G WC+PK GVS++ LQANLDY 
Sbjct  330  HFGLYKPDLSMTYDIGLEKGTQVNPSPSVNPSPSAGKAGTWCMPKAGVSESDLQANLDYA  389

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            CGQGIDCSA+QPGG CF PNTV +HAAYAMNLLYQT+ +NPWNCDF QTA L+STNPSY 
Sbjct  390  CGQGIDCSALQPGGACFLPNTVVAHAAYAMNLLYQTSARNPWNCDFKQTAILTSTNPSYQ  449

Query  317  GCTYPSGS  294
            GC++  G+
Sbjct  450  GCSFAGGT  457



>gb|KHN25369.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=321

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 142/190 (75%), Gaps = 8/190 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS EVG S+ENAKAY GNLI HLRSLVGTPLMP KSVDT++FALYDE LK GP SER+
Sbjct  132  RGDSNEVGASVENAKAYNGNLIEHLRSLVGTPLMPGKSVDTFIFALYDEDLKRGPASERA  191

Query  656  FGLFRPDLTMTFDAGLsktvtptp-------vtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            FGLF+ DLTM +D GL K+ +                   WC+PK  V++AQLQAN+DY+
Sbjct  192  FGLFKTDLTMAYDVGLDKSGSTHKNPPTSPVTPAPKTGTQWCIPKVEVTEAQLQANIDYI  251

Query  497  CG-QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            CG Q +DC  IQP G C+EPNT++SHAA+AMNL YQ  G+NPWNCDFSQTA L+S NPSY
Sbjct  252  CGSQVVDCGPIQPEGACYEPNTISSHAAFAMNLYYQKFGRNPWNCDFSQTAMLTSQNPSY  311

Query  320  DGCTYPSGST  291
            + C YP GST
Sbjct  312  NACVYPGGST  321



>sp|Q94G86.1|ALL9_OLEEU RecName: Full=Glucan endo-1,3-beta-D-glucosidase; AltName: Full=Major 
pollen allergen Ole e 9; AltName: Allergen=Ole e 9; 
Flags: Precursor [Olea europaea]
 gb|AAK58515.1|AF249675_1 beta-1,3-glucanase-like protein [Olea europaea]
Length=460

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 142/187 (76%), Gaps = 5/187 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            + GDS EVGPS++NAKAYVGNLI HL+S VGTPLMP KS+DTYLF+LYDE  K G +SE+
Sbjct  273  HGGDSNEVGPSLDNAKAYVGNLINHLKSKVGTPLMPGKSIDTYLFSLYDEDKKTGASSEK  332

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkS-----GAWCVPKEGVSDAQLQANLDYVC  495
             FGLF+PD + T+D GL K         +P       G+WCVPK GVSD QL  N++Y C
Sbjct  333  YFGLFKPDGSTTYDVGLLKNTQNPTTPATPTPTPKAAGSWCVPKPGVSDDQLTGNINYAC  392

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPNTV +HAAY MNL YQ+AG+N WNCDFSQTATL++TNPSY  
Sbjct  393  GQGIDCGPIQPGGACFEPNTVKAHAAYVMNLYYQSAGRNSWNCDFSQTATLTNTNPSYGA  452

Query  314  CTYPSGS  294
            C +PSGS
Sbjct  453  CNFPSGS  459



>ref|XP_006412222.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
 gb|ESQ53675.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
Length=504

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 7/187 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LKPGP+SER+
Sbjct  270  RGDTNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp-------spkSGAWCVPKEGVSDAQLQANLDYV  498
            FGLF+ DL+M +D GL+K+   +              S  WCVPK+G +D QLQA+LD+ 
Sbjct  330  FGLFKTDLSMAYDVGLAKSSGSSSGNSSSQTPSGKVTSTGWCVPKKGATDEQLQASLDWA  389

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            CGQGIDC  IQPGG CFEPN VASHAA+AMN+ +Q + KNP +CDFSQTAT++S NPSY+
Sbjct  390  CGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKNPADCDFSQTATITSQNPSYN  449

Query  317  GCTYPSG  297
             C YP G
Sbjct  450  SCVYPGG  456



>ref|XP_010060941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67839.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=480

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 140/196 (71%), Gaps = 23/196 (12%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVGPSIENAKAY GNLI HLRSLVGTPLMP  SVDTYLFALYDE LKPGPTSER
Sbjct  269  YKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTSER  328

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspk-----------------------SGAWCV  549
            +FGLF+ DL+M +D GLSK+         P                           WC+
Sbjct  329  AFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANWCI  388

Query  548  PKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN  369
            PK GVSDAQLQANLDY CGQGIDC  IQPGG CFEPNT+A+HAAYAMNL YQ + ++P N
Sbjct  389  PKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRSPTN  448

Query  368  CDFSQTATLSSTNPSY  321
            CDFSQ+AT SS NPS+
Sbjct  449  CDFSQSATFSSNNPSW  464



>ref|XP_004499144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Cicer arietinum]
Length=485

 Score =   250 bits (639),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 147/212 (69%), Gaps = 29/212 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ E GPS+ENAKAY GNLI+HLRS VGTPLMP KSVDTY+FALYDE LKPG  SER
Sbjct  274  YKGDNDEAGPSLENAKAYNGNLISHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAASER  333

Query  659  SFGLFRPDLTMTFDAGLskt-----------------------------vtptpvtpspk  567
            +FGL+ PD +M +D GLSK                                 +P  P+  
Sbjct  334  AFGLYNPDQSMIYDVGLSKQQSTSPTPTTSPMVAPINPNVSKSPTNSTPKVSSPTKPNNS  393

Query  566  SGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
            + AWCVPK GV+DAQLQANLDY CGQGIDCS IQPGG CFEPNT+A+HAAYAMNL Y T 
Sbjct  394  NIAWCVPKPGVTDAQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTV  453

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYPSGST  291
            G+NP  CDFSQTATL++ NPSY+ C Y  G+ 
Sbjct  454  GQNPLTCDFSQTATLTTNNPSYNSCIYAGGNV  485



>ref|XP_007131842.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
 gb|ESW03836.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
Length=459

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG ++ENA+AY GNLI HLRS+VGTP MP KSVDT++FALYDE LKPGP SER+
Sbjct  270  RGDTNEVGATLENARAYNGNLIAHLRSMVGTPSMPGKSVDTFIFALYDEDLKPGPASERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptp-------vtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            FGLF+ DLTM++D GL  + +               +   WC+PK  VS+AQLQ N+DY+
Sbjct  330  FGLFKTDLTMSYDVGLDNSASSHKNPPTGPVTPAPKRETEWCIPKVEVSEAQLQTNVDYI  389

Query  497  CG-QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            CG Q IDC  IQPGG C+EPNTV SHAA+AMNL YQ  G+NPWNCDFSQTA L+S NPSY
Sbjct  390  CGSQVIDCGPIQPGGACYEPNTVLSHAAFAMNLYYQKVGRNPWNCDFSQTAMLTSQNPSY  449

Query  320  DGCTYPSGST  291
              C YP  ST
Sbjct  450  SACVYPGEST  459



>gb|ACN26761.1| unknown [Zea mays]
Length=323

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 139/186 (75%), Gaps = 6/186 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G ++ENA+AYV NL+ HLRS  GTPLMP +SVDTYLFALYDE LKPGPTSERS
Sbjct  136  RGDAGEPGATVENARAYVSNLVAHLRSGAGTPLMPGRSVDTYLFALYDEDLKPGPTSERS  195

Query  656  FGLFRPDLTMTFDAGLsktvtp-----tpvtpspkSGAWCVPKEGVSDAQLQANLDYVCG  492
            FGL+  DLTM +DAGL+          T     PK+G WCV ++G SDA+LQA+LDY C 
Sbjct  196  FGLYHTDLTMAYDAGLTSNSNAGGGTGTAAPAQPKAGGWCVARDGASDAELQADLDYACS  255

Query  491  Q-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG+ PWNCDF  +ATL+S NPSY  
Sbjct  256  QVGVDCGAIQPGGACFEPNTVHAHAAYAMNQLYQAAGRQPWNCDFRASATLTSENPSYGA  315

Query  314  CTYPSG  297
            C Y  G
Sbjct  316  CVYTGG  321



>gb|KEH40123.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=479

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 144/211 (68%), Gaps = 29/211 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ E GPSIENAKAY GNLI HLRS VGTPLMP KSVDTY+FALYDE LKPG  SE+
Sbjct  268  YKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAGSEK  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG---------------------------  561
            +FGL+  D +M +DAGLSK  + TP   S                               
Sbjct  328  AFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTPYNS  387

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
              AWCVPK G++D QLQANLDY CGQGIDCS IQPGG CFEPNT+A+HAAYAMNL Y T 
Sbjct  388  NIAWCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTV  447

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYPSGS  294
            G+NP  CDFSQTATL+S NPSY+ C Y  G+
Sbjct  448  GQNPLTCDFSQTATLTSNNPSYNSCIYTGGN  478



>emb|CDX75437.1| BnaA01g02650D [Brassica napus]
Length=506

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 143/184 (78%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HL+S+VGTPLMP KSVDTY+FALYDE LKPGP+SER+
Sbjct  270  RGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +DAGL+K+   +  +          S  WCVP+ G +D QLQA+LD+ C
Sbjct  330  FGLFKTDLSMAYDAGLAKSSGSSSNSSGQTPSGKVTSTGWCVPRNGATDEQLQASLDWAC  389

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAA+AMN+ +Q + K P +CDFSQTATL+S NPSY+ 
Sbjct  390  GQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKKPTDCDFSQTATLTSQNPSYNS  449

Query  314  CTYP  303
            C YP
Sbjct  450  CVYP  453



>ref|XP_009112198.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=506

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HL+S+VGTPLMP KSVDTY+FALYDE LKPGP+SER+
Sbjct  270  RGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +DAGL+K+   +  +          S  WCVP+ G +D QLQA+LD+ C
Sbjct  330  FGLFKTDLSMAYDAGLAKSSGSSSNSSGQTPSGKVTSTGWCVPRNGATDEQLQASLDWAC  389

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAA+AMN+ +Q + K P +CDFSQTAT++S NPSY+ 
Sbjct  390  GQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKKPTDCDFSQTATITSQNPSYNS  449

Query  314  CTYP  303
            C YP
Sbjct  450  CVYP  453



>emb|CDX69064.1| BnaC01g03890D [Brassica napus]
Length=505

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HL+S+VGTPLMP KSVDTY+FALYDE LKPGP+SER+
Sbjct  270  RGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL++ +DAGL+K+   +  +          S  WCVP+ G +D QLQA+LD+ C
Sbjct  330  FGLFKTDLSIAYDAGLAKSSGSSSNSSSQTPSGKVTSTGWCVPRNGATDQQLQASLDWAC  389

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAA+AMN+ +Q + K P +CDFSQTATL+S NPSY+ 
Sbjct  390  GQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKKPTDCDFSQTATLTSQNPSYNS  449

Query  314  CTYP  303
            C YP
Sbjct  450  CVYP  453



>ref|XP_006409465.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
 gb|ESQ50918.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
Length=526

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  EVGPS+ENAKAY GNLI HLRS+VGTPLMP KSVDTY FAL+DE LKPGP+ ERSF
Sbjct  286  GDINEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYTFALFDENLKPGPSFERSF  345

Query  653  GLFRPDLTMTFDAGLsktvtptpvtp-----spkSGAWCVPKEGVSDAQLQANLDYVCGQ  489
            GLF+PDL+M +D GL+KT +              S  WCVPKE  ++ QLQA+LD+VCGQ
Sbjct  346  GLFKPDLSMAYDIGLTKTTSSQASQSPPLGKETTSTGWCVPKEDATEEQLQASLDWVCGQ  405

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GIDC  I PGG CFEPN +ASHAAYAMNL +Q + +NP +CDFSQTA ++S NPSY+ C 
Sbjct  406  GIDCRPIMPGGACFEPNNIASHAAYAMNLNFQKSPENPTDCDFSQTARITSDNPSYNNCV  465

Query  308  YP  303
            YP
Sbjct  466  YP  467



>ref|XP_010690894.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 149/219 (68%), Gaps = 40/219 (18%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY G LI+HLRS+ GTPLMP KSVDTY+FALYDE LKPG  SER
Sbjct  275  YHGDSNEVGPSIENAKAYNGGLISHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGAASER  334

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtp--------------------------------  576
             FGL++PDL+MT+D  LSK+ + +P T                                 
Sbjct  335  YFGLYKPDLSMTYDLDLSKSSSQSPTTTPSTSPAPSTTPSAPSTTPLAPSRTPSAPVMTP  394

Query  575  --------spkSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHA  420
                       SG WCVPK+GVSDAQL+ANLDY CG G+DCS +Q GGPC +P+TVASHA
Sbjct  395  TAPVTPSPKSSSGTWCVPKKGVSDAQLKANLDYACGHGVDCSKLQAGGPCHDPDTVASHA  454

Query  419  AYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYP  303
            AYAMNLLYQTAG+ P +CDFSQTAT++STNPSY  C YP
Sbjct  455  AYAMNLLYQTAGRTPGSCDFSQTATVTSTNPSYGSCVYP  493



>ref|XP_006299612.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
 gb|EOA32510.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
Length=499

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ ERSF
Sbjct  266  GDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFERSF  325

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA----WCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +       P   A    WCVPKE  ++ QLQ +LD+VCGQG
Sbjct  326  GLFKPDLSMAYDIGLTKTTSSQTSQSPPLGEATSMGWCVPKEDATEEQLQESLDWVCGQG  385

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  I PGG CFEPN + SH AYAMNL +Q + +NP +CDFS+TA ++S NPSYD C Y
Sbjct  386  IDCGPIMPGGVCFEPNNLVSHTAYAMNLYFQKSPENPTDCDFSKTARITSDNPSYDSCVY  445

Query  305  P  303
            P
Sbjct  446  P  446



>gb|AIR93913.1| glucanase [Cicer arietinum]
Length=460

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 138/176 (78%), Gaps = 5/176 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E+GPS+ENAKAY GNLITHLRSLVGTPLMP KS+DTY+F LYDE LKPGP SER+
Sbjct  272  RGDNNEIGPSVENAKAYNGNLITHLRSLVGTPLMPAKSIDTYIFGLYDEDLKPGPGSERA  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCG-  492
            FGL++ DLT+ +D GL K+   +P +        +  WC+P  GV+D+QLQ NLDYVC  
Sbjct  332  FGLYKIDLTVAYDVGLDKSTQKSPSSSPKGRVTPATQWCIPVVGVTDSQLQTNLDYVCSR  391

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            +GIDC  IQ GG CFEPNT+ASHAAYAMN  YQ  GKNPWNCDF+QTATL+S NPS
Sbjct  392  EGIDCKEIQQGGACFEPNTIASHAAYAMNFYYQKFGKNPWNCDFAQTATLTSQNPS  447



>ref|XP_004499143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Cicer arietinum]
Length=520

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 143/207 (69%), Gaps = 29/207 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ E GPS+ENAKAY GNLI+HLRS VGTPLMP KSVDTY+FALYDE LKPG  SER
Sbjct  274  YKGDNDEAGPSLENAKAYNGNLISHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAASER  333

Query  659  SFGLFRPDLTMTFDAGLskt-----------------------------vtptpvtpspk  567
            +FGL+ PD +M +D GLSK                                 +P  P+  
Sbjct  334  AFGLYNPDQSMIYDVGLSKQQSTSPTPTTSPMVAPINPNVSKSPTNSTPKVSSPTKPNNS  393

Query  566  SGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
            + AWCVPK GV+DAQLQANLDY CGQGIDCS IQPGG CFEPNT+A+HAAYAMNL Y T 
Sbjct  394  NIAWCVPKPGVTDAQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTV  453

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTY  306
            G+NP  CDFSQTATL++ NPS   C +
Sbjct  454  GQNPLTCDFSQTATLTTNNPSKSSCDF  480



>ref|NP_001148381.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG31222.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 tpg|DAA50560.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=461

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 139/186 (75%), Gaps = 6/186 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G ++ENA+AYV NL+ HLRS  GTPLMP +SVDTYLFALYDE LKPGPTSERS
Sbjct  274  RGDAGEPGATVENARAYVSNLVAHLRSGAGTPLMPGRSVDTYLFALYDEDLKPGPTSERS  333

Query  656  FGLFRPDLTMTFDAGLsktvtp-----tpvtpspkSGAWCVPKEGVSDAQLQANLDYVCG  492
            FGL+  DLTM +DAGL+          T     PK+G WCV ++G SDA+LQA+LDY C 
Sbjct  334  FGLYHTDLTMAYDAGLTSNSNAGGGTGTAAPAQPKAGGWCVARDGASDAELQADLDYACS  393

Query  491  Q-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG+ PWNCDF  +ATL+S NPSY  
Sbjct  394  QVGVDCGAIQPGGACFEPNTVHAHAAYAMNQLYQAAGRQPWNCDFRASATLTSENPSYGA  453

Query  314  CTYPSG  297
            C Y  G
Sbjct  454  CVYTGG  459



>ref|XP_006283912.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
 gb|EOA16810.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
Length=385

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NAKAY GNLI HL+S++GTPLMP K VDTY+FALY+E LKPGP+SER+
Sbjct  149  RGDANEVGTSVDNAKAYNGNLIAHLKSMIGTPLMPGKPVDTYIFALYEENLKPGPSSERA  208

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +D GL+K+ +    +          S  WCVPK+G ++ QLQA+LD+ C
Sbjct  209  FGLFKTDLSMAYDVGLAKSSSSGSNSSGQTPSGKVTSTGWCVPKKGATNEQLQASLDWAC  268

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC AIQPGG CFEPN VASHAAYAMN+ YQ + K   +CDFS+TAT++S NPSY+ 
Sbjct  269  GQGIDCGAIQPGGACFEPNNVASHAAYAMNMYYQKSPKQTTDCDFSKTATVTSQNPSYNS  328

Query  314  CTYP  303
            C YP
Sbjct  329  CVYP  332



>ref|NP_195174.6| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
 sp|Q9M069.2|E137_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 7; AltName: Full=(1->3)-beta-glucan 
endohydrolase 7; Short=(1->3)-beta-glucanase 
7; AltName: Full=Beta-1,3-endoglucanase 7; Short=Beta-1,3-glucanase 
7; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86384.1| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
Length=504

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NAKAY GNLI HLRS+VGTPLMP K VDTY+FALYDE LKPGP+SER+
Sbjct  270  RGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpv-tpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            FGLF+ DL+M +D GL+K+ + +   +    S  WCVPK+G ++ +LQA+LD+ CG GID
Sbjct  330  FGLFKTDLSMVYDVGLAKSSSSSQTPSGKVTSSGWCVPKKGATNEELQASLDWACGHGID  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYP  303
            C AIQPGG CFEPN V SHAAYAMN+ +Q + K P +CDFS+TAT++S NPSY+ C YP
Sbjct  390  CGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNCVYP  448



>gb|KJB58294.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=491

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 144/191 (75%), Gaps = 19/191 (10%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGDS EVG SIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGPTSER
Sbjct  271  YKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPTSER  330

Query  659  SFGLFR-PDLTMTFDAGLsktvtptpvtpspkS------------------GAWCVPKEG  537
            SFGL++  DLTMT+D GLSK+ +      SP +                   +WCVPK+ 
Sbjct  331  SFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPATLSVVAPSPEPKKASWCVPKKD  390

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
            V+DA+LQA+LDY C  GIDCS IQPGG CFEPNT+++HAAYAMNL YQ++G +P +CDFS
Sbjct  391  VTDAELQASLDYACAHGIDCSPIQPGGSCFEPNTLSAHAAYAMNLYYQSSGPDPSSCDFS  450

Query  356  QTATLSSTNPS  324
            Q A LSS+NPS
Sbjct  451  QAAMLSSSNPS  461



>gb|KFK30062.1| hypothetical protein AALP_AA7G211800 [Arabis alpina]
Length=503

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 142/183 (78%), Gaps = 5/183 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NAKAY GNLI HL+S+VGTPLMP KSVDTY+FALYDE LKPGP+SER+
Sbjct  271  RGDANEVGTSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSSERA  330

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSG-----AWCVPKEGVSDAQLQANLDYVCG  492
            FGLF+ DL+M +D GL+K+ +    +    SG      WCVPK+G +  QLQA+LD+ CG
Sbjct  331  FGLFKTDLSMAYDVGLAKSSSSGNSSGQTPSGKVTSTGWCVPKKGATVEQLQASLDWACG  390

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC  IQPGG CF+PN VASHAA+AMN+ +Q + K   +CDFSQTAT++S NPSY+ C
Sbjct  391  QGIDCGPIQPGGVCFDPNNVASHAAFAMNMYFQKSAKKSTDCDFSQTATITSQNPSYNSC  450

Query  311  TYP  303
             YP
Sbjct  451  VYP  453



>ref|XP_010432409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NA+AY GNLI HL+S+VGTPLMP K VDTYLFALYDE LKPGP+SER+
Sbjct  272  RGDANEVGTSVDNARAYNGNLIAHLKSMVGTPLMPGKPVDTYLFALYDENLKPGPSSERA  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +D GL+K+ +    +          S  WCVPK+G +D QLQ++LD+ C
Sbjct  332  FGLFKTDLSMAYDVGLAKSSSSDSNSSGQTPSGKMTSTGWCVPKKGATDDQLQSSLDWAC  391

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAAYAMN+ +Q + K P +CDFS+TAT++S NPSY+ 
Sbjct  392  GQGIDCGPIQPGGACFEPNNVASHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNS  451

Query  314  CTYP  303
            C YP
Sbjct  452  CVYP  455



>ref|NP_179219.4| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC06477.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=503

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ E+SF
Sbjct  270  GDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFEQSF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +             S  WCVPKE  +  QLQ +LD+VCGQG
Sbjct  330  GLFKPDLSMAYDIGLTKTTSSQTSQSPQLGKVTSMGWCVPKEDATQEQLQDSLDWVCGQG  389

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  I PGG CFEPN VASH AYAMNL +Q + +NP +CDFS+TA ++S NPSY  C Y
Sbjct  390  IDCGPIMPGGVCFEPNNVASHTAYAMNLYFQKSPENPTDCDFSKTARITSENPSYSSCVY  449

Query  305  P  303
            P
Sbjct  450  P  450



>gb|KDO84535.1| hypothetical protein CISIN_1g040787mg, partial [Citrus sinensis]
Length=436

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  E   +I+ AK Y   LITHLRS  GTPLMP K+ DTYLFALYDE LK GP SERS
Sbjct  247  KGDDKEPWATIDKAKDYYSGLITHLRSKAGTPLMPGKTTDTYLFALYDENLKQGPISERS  306

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FGLF+PD T  FD GL K     P  P+     WCVPKEGV++ QLQAN+DY CG+GIDC
Sbjct  307  FGLFKPDRTANFDVGLLKNNKENPGAPNK--AMWCVPKEGVTNKQLQANIDYACGRGIDC  364

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPSG  297
            S I PGG CFEP+T+ASHAAYAMNL +QT G+N W+CDFS+TATLSS +PSY GC YPS 
Sbjct  365  SPIAPGGACFEPDTLASHAAYAMNLHHQTNGRNAWDCDFSKTATLSSKDPSYKGCIYPSN  424

Query  296  S  294
            +
Sbjct  425  A  425



>ref|XP_006434974.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
 gb|ESR48214.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
Length=436

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  E   +I+ AK Y   LITHLRS  GTPLMP K+ DTYLFALYDE LK GP SERS
Sbjct  247  KGDDKEPWATIDKAKDYYSGLITHLRSKAGTPLMPGKTTDTYLFALYDENLKQGPISERS  306

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FGLF+PD T  FD GL K     P  P+     WCVPKEGV++ QLQAN+DY CG+GIDC
Sbjct  307  FGLFKPDRTANFDVGLLKNNKENPGAPNK--AMWCVPKEGVTNKQLQANIDYACGRGIDC  364

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPSG  297
            S I PGG CFEP+T+ASHAAYAMNL +QT G+N W+CDFS+TATLSS +PSY GC YPS 
Sbjct  365  SPIAPGGACFEPDTLASHAAYAMNLHHQTNGRNAWDCDFSKTATLSSKDPSYKGCIYPSN  424

Query  296  S  294
            +
Sbjct  425  A  425



>ref|XP_010447074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NA+AY GNLI HL+S++GTPLMP K VDTYLFALYDE LKPGP+SER+
Sbjct  272  RGDANEVGTSVDNARAYNGNLIAHLKSMIGTPLMPGKPVDTYLFALYDENLKPGPSSERA  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +D GL+K+ +    +          S  WCVPK+G +D QLQ++LD+ C
Sbjct  332  FGLFKTDLSMAYDVGLAKSSSSDSNSSGQTPSGKVTSTGWCVPKKGATDDQLQSSLDWAC  391

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAAYAMN+ +Q + K P +CDFS+TAT++S NPSY+ 
Sbjct  392  GQGIDCGPIQPGGACFEPNNVASHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNS  451

Query  314  CTYP  303
            C YP
Sbjct  452  CVYP  455



>ref|XP_010467346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Camelina sativa]
Length=503

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS EVGPS+ENAKAY GNL+ HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ ERSF
Sbjct  270  GDSNEVGPSVENAKAYNGNLVAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFERSF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA----WCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +       P   A    WCVPK+  ++ QLQ +LD+VCGQG
Sbjct  330  GLFKPDLSMAYDIGLTKTTSSQTSQSPPLGEATSMGWCVPKDDATEEQLQDSLDWVCGQG  389

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  I PGG CFEPN + SH AYAMNL +Q + +NP +CDFS+TA ++S NPSY+ C Y
Sbjct  390  IDCGPIMPGGLCFEPNNLMSHTAYAMNLYFQKSPENPTDCDFSKTARITSNNPSYNSCIY  449

Query  305  P  303
            P
Sbjct  450  P  450



>ref|XP_009138298.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Brassica rapa]
 ref|XP_009138299.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X3 
[Brassica rapa]
Length=505

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LK GP+SER+
Sbjct  270  RGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKSGPSSERA  329

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtps------pkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ D +M +D GL+K+   +    S        S  WCV K+  +D QLQ+++D+ C
Sbjct  330  FGLFKTDHSMAYDVGLAKSSGSSTSNSSSQTPSGKASTGWCVSKKDATDEQLQSSIDWAC  389

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC AIQPGG CFEPN VASHAA+AMN+ YQ + K P +CDFSQTAT++S NPSY+ 
Sbjct  390  GQGIDCGAIQPGGACFEPNNVASHAAFAMNMYYQKSPKRPTDCDFSQTATITSQNPSYNS  449

Query  314  CTYP  303
            C YP
Sbjct  450  CVYP  453



>ref|XP_009138297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Brassica rapa]
Length=528

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LK GP+SER+
Sbjct  293  RGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKSGPSSERA  352

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtps------pkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ D +M +D GL+K+   +    S        S  WCV K+  +D QLQ+++D+ C
Sbjct  353  FGLFKTDHSMAYDVGLAKSSGSSTSNSSSQTPSGKASTGWCVSKKDATDEQLQSSIDWAC  412

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC AIQPGG CFEPN VASHAA+AMN+ YQ + K P +CDFSQTAT++S NPSY+ 
Sbjct  413  GQGIDCGAIQPGGACFEPNNVASHAAFAMNMYYQKSPKRPTDCDFSQTATITSQNPSYNS  472

Query  314  CTYP  303
            C YP
Sbjct  473  CVYP  476



>gb|KEH40124.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=486

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 140/207 (68%), Gaps = 29/207 (14%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ E GPSIENAKAY GNLI HLRS VGTPLMP KSVDTY+FALYDE LKPG  SE+
Sbjct  268  YKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAGSEK  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG---------------------------  561
            +FGL+  D +M +DAGLSK  + TP   S                               
Sbjct  328  AFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTPYNS  387

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
              AWCVPK G++D QLQANLDY CGQGIDCS IQPGG CFEPNT+A+HAAYAMNL Y T 
Sbjct  388  NIAWCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTV  447

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTY  306
            G+NP  CDFSQTATL+S NPS   C +
Sbjct  448  GQNPLTCDFSQTATLTSNNPSKFSCGF  474



>ref|XP_002466692.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
 gb|EER93690.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Length=475

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 138/193 (72%), Gaps = 12/193 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD+ E G + ENA+AYV NL+ HLRS  GTPLMP +SV+TYLFALYDE LKPGPTSERS
Sbjct  282  KGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGRSVETYLFALYDEDLKPGPTSERS  341

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtps-----------pkSGAWCVPKEGVSDAQLQAN  510
            FGL+  DLTM +DAGL+ + +                   + G WCV ++G SDA LQA+
Sbjct  342  FGLYHTDLTMAYDAGLTSSSSAGAAGGGGGGGGSAAAQPKQGGGWCVARDGASDADLQAD  401

Query  509  LDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            LDY C Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG++PWNCDF  +ATL+S 
Sbjct  402  LDYACSQLGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGRHPWNCDFRASATLTSE  461

Query  332  NPSYDGCTYPSGS  294
            NPSY  C Y  G+
Sbjct  462  NPSYGACVYTGGA  474



>ref|XP_010423738.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=523

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS EVGPS+E AKAY GNLI HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ ERSF
Sbjct  270  GDSNEVGPSVEKAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFERSF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA----WCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +       P   A    WCVPK+  ++ QLQ +LD+VCGQG
Sbjct  330  GLFKPDLSMAYDIGLTKTTSSQTSQSPPLGEATSMGWCVPKDDATEEQLQDSLDWVCGQG  389

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IDC  I PGG CFEPN + SH AYAMNL +Q + +NP +CDFS+TA ++S NPSY+ C Y
Sbjct  390  IDCGPITPGGVCFEPNNLMSHTAYAMNLYFQKSPENPTDCDFSKTARITSDNPSYNSCVY  449

Query  305  P  303
            P
Sbjct  450  P  450



>ref|XP_010444969.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7-like [Camelina sativa]
Length=507

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ EVG S++NA+AY GNLI HL+S++GTPLMP K VDTYLFALYDE LKPGP+SER+
Sbjct  271  RGDANEVGTSVDNARAYNGNLIAHLKSMIGTPLMPGKPVDTYLFALYDENLKPGPSSERA  330

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M +D GL+K+ +    +          S  WCVPK+G +D QLQ++LD+ C
Sbjct  331  FGLFKTDLSMAYDVGLAKSSSSDSNSSGQTPSGKVTSTGWCVPKKGATDDQLQSSLDWAC  390

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VAS AAYAMN+ +Q + K P +CDFS+TAT++S NPSY+ 
Sbjct  391  GQGIDCGPIQPGGACFEPNNVASRAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNS  450

Query  314  CTYP  303
            C YP
Sbjct  451  CVYP  454



>gb|KEH40125.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=481

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 137/200 (69%), Gaps = 29/200 (15%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD+ E GPSIENAKAY GNLI HLRS VGTPLMP KSVDTY+FALYDE LKPG  SE+
Sbjct  268  YKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAGSEK  327

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSG---------------------------  561
            +FGL+  D +M +DAGLSK  + TP   S                               
Sbjct  328  AFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTPYNS  387

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
              AWCVPK G++D QLQANLDY CGQGIDCS IQPGG CFEPNT+A+HAAYAMNL Y T 
Sbjct  388  NIAWCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTV  447

Query  386  GKNPWNCDFSQTATLSSTNP  327
            G+NP  CDFSQTATL+S NP
Sbjct  448  GQNPLTCDFSQTATLTSNNP  467



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  EVG ++ENA+AY G L++HLRSL GTP+ P KSVDTY+FALYDE LKPGPTSER
Sbjct  272  YRGDEGEVGATVENAQAYNGGLVSHLRSLAGTPMAPGKSVDTYIFALYDEDLKPGPTSER  331

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGA--------WCVPKEGVSDAQLQANLD  504
            SFGLF PDLT T+D GL+++ + +       + A        WCVP+EG +DA+LQANLD
Sbjct  332  SFGLFHPDLTPTYDIGLARSSSSSTPAQGNGTSAPRAAAAKGWCVPREGATDAELQANLD  391

Query  503  YVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            Y CGQ G+DC  IQ GG C+ PNTV SHAAYAMN  YQ +G+N W C FS +A L++ NP
Sbjct  392  YACGQPGVDCRPIQEGGACYLPNTVRSHAAYAMNQFYQASGRNSWECGFSDSAVLTTDNP  451

Query  326  SYDGCTYPSG  297
            SY  C Y  G
Sbjct  452  SYATCVYAGG  461



>ref|XP_004982218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Setaria italica]
Length=469

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 136/186 (73%), Gaps = 6/186 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD+ E G ++ENA+AYV NL++HLRS  GTPL+P K V+TYLFALYDE LKPGP SERS
Sbjct  282  KGDAGEPGATVENARAYVSNLVSHLRSGAGTPLVPGKPVETYLFALYDEDLKPGPESERS  341

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp-----spkSGAWCVPKEGVSDAQLQANLDYVCG  492
            FGL+  DL+  +DAGL+ +             +  SG WCV ++G +DA LQA+LDY C 
Sbjct  342  FGLYHTDLSAAYDAGLTSSGAAAGSPSAGGGPAKASGGWCVARDGATDADLQADLDYACA  401

Query  491  Q-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG++PWNCDF  +ATL+S NPSY  
Sbjct  402  QVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGRHPWNCDFRASATLTSDNPSYGA  461

Query  314  CTYPSG  297
            C Y  G
Sbjct  462  CVYTGG  467



>gb|AAD22313.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=456

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 133/174 (76%), Gaps = 4/174 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS EVGPS+ENAKAY GNLI HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ E+SF
Sbjct  270  GDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFEQSF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtp----spkSGAWCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +             S  WCVPKE  +  QLQ +LD+VCGQG
Sbjct  330  GLFKPDLSMAYDIGLTKTTSSQTSQSPQLGKVTSMGWCVPKEDATQEQLQDSLDWVCGQG  389

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            IDC  I PGG CFEPN VASH AYAMNL +Q + +NP +CDFS+TA ++S NPS
Sbjct  390  IDCGPIMPGGVCFEPNNVASHTAYAMNLYFQKSPENPTDCDFSKTARITSENPS  443



>emb|CDX72483.1| BnaC07g45050D [Brassica napus]
Length=885

 Score =   237 bits (605),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 140/183 (77%), Gaps = 5/183 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HLRS+VGTPLMP KSVDTY+FALYDE LK GP+SER+
Sbjct  286  RGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKTGPSSERA  345

Query  656  FGLFRPDLTMTFDAGLsktvtptpvt-----pspkSGAWCVPKEGVSDAQLQANLDYVCG  492
            FGLF+ D +M +D GL+K+   +  +         S  WCV K+  +D QLQ+++D+ CG
Sbjct  346  FGLFKTDHSMAYDVGLAKSSGSSSNSSCQTPSGKASTGWCVSKKDATDKQLQSSIDWACG  405

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QGIDC AIQPGG CFEPN VASHAA+AMN+ YQ + K P +CDFSQTAT++S NPSY+ C
Sbjct  406  QGIDCGAIQPGGACFEPNNVASHAAFAMNMYYQKSPKRPTDCDFSQTATITSQNPSYNSC  465

Query  311  TYP  303
             YP
Sbjct  466  VYP  468



>ref|XP_003561438.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Brachypodium 
distachyon]
Length=463

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 133/187 (71%), Gaps = 7/187 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD TE G S++NAKAYV NL+ HLRS  GTPLMP K+VDTYLFALYDE LKPGP SERS
Sbjct  276  KGDPTEAGASVDNAKAYVANLVAHLRSGAGTPLMPGKAVDTYLFALYDEDLKPGPASERS  335

Query  656  FGLFRPDLTMTFDAGLsktvtptp------vtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGL+  DL+M +DAGL+ +               P  G WCV     +DAQLQ ++DY C
Sbjct  336  FGLYHTDLSMAYDAGLAASAASGSNGNGQGAAVQPTKGGWCVASVAATDAQLQTDMDYAC  395

Query  494  GQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
             Q G+DC AIQPGG CFEPNTV +HAAYAMN LY  AG +PWNCDF Q+ATL+S+NPSY 
Sbjct  396  AQVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYHAAGAHPWNCDFRQSATLTSSNPSYG  455

Query  317  GCTYPSG  297
             C +  G
Sbjct  456  SCVFTGG  462



>ref|XP_002886212.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62471.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 131/174 (75%), Gaps = 4/174 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVGPS+ENAKAY GNLI HLRS+VGTPLMP KS+DTY+FAL+DE LKPGP+ ERSF
Sbjct  270  GDNNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSFERSF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA----WCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PDL+M +D GL+KT +           A    WCVPKE  +  QLQ +LD+VCGQG
Sbjct  330  GLFKPDLSMAYDIGLTKTTSSQTSQSPQLGKATSMGWCVPKEDATQEQLQDSLDWVCGQG  389

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            IDC  I PGG CFEPN + SH AYAMNL +Q + +NP +CDFS+ A ++S NPS
Sbjct  390  IDCGPIMPGGVCFEPNNLVSHTAYAMNLYFQKSPENPMDCDFSKAARITSENPS  443



>emb|CDY26761.1| BnaC09g08880D [Brassica napus]
Length=512

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 135/184 (73%), Gaps = 7/184 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS  VGPS+ENA+ Y GNLI HLRS+VGTPL P K +DTY+FAL+DE LKPGP+ ERSF
Sbjct  271  GDSNVVGPSVENAQTYNGNLIAHLRSMVGTPLRPGKPIDTYIFALFDENLKPGPSFERSF  330

Query  653  GLFRPDLTMTFDAGLsktvtptpvt-------pspkSGAWCVPKEGVSDAQLQANLDYVC  495
            GLF+PDLTM +D GL+KT +    T        S  S  WCVP E  ++ QLQA+LD+VC
Sbjct  331  GLFKPDLTMAYDIGLTKTSSSGSQTSQSPPLGKSATSVGWCVPMEDATEEQLQASLDWVC  390

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  I PGG CFEPN V SH AYAMNL +Q + +NP +CDFSQTA ++S NPSY  
Sbjct  391  GQGIDCGPITPGGVCFEPNNVMSHTAYAMNLYFQKSPENPTDCDFSQTARITSNNPSYSN  450

Query  314  CTYP  303
            C YP
Sbjct  451  CVYP  454



>dbj|BAJ87172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 131/188 (70%), Gaps = 8/188 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  E G +++NA+AYV NL+ HL S  GTPLMP + VDTYLFALYDE LKPGP SER+
Sbjct  273  KGDPAEAGATVDNARAYVSNLVAHLGSGAGTPLMPGRPVDTYLFALYDEDLKPGPASERA  332

Query  656  FGLFRPDLTMTFDAGLsktvtptp-------vtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            FGL+  DLTM +DAGL+ + +                   WCV   G ++AQLQ ++DY 
Sbjct  333  FGLYHTDLTMAYDAGLTSSGSGAATTPTTPTTPSKGSGSGWCVASAGATEAQLQTDMDYA  392

Query  497  CGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            C Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG +PWNCDF Q+ATL+STNPSY
Sbjct  393  CSQVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGSHPWNCDFRQSATLTSTNPSY  452

Query  320  DGCTYPSG  297
              C +  G
Sbjct  453  GSCVFTGG  460



>gb|EMS60868.1| Glucan endo-1,3-beta-glucosidase 7 [Triticum urartu]
Length=351

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD TE G +++NA+AYV NL+ HLRS  GTPLMP + VDTYLFALYDE LKPGP SER+
Sbjct  111  KGDPTEQGATVDNARAYVSNLVAHLRSGAGTPLMPGRPVDTYLFALYDEDLKPGPASERA  170

Query  656  FGLFRPDLTMTFDAGL------------sktvtptpvtpspkSGAWCVPKEGVSDAQLQA  513
            FGL+  DLTM +DAGL            + T TPT  TPS  SG WCV   G +DAQLQ 
Sbjct  171  FGLYHTDLTMAYDAGLTSSSSGGGGGSTATTPTPTTPTPSKGSGGWCVASAGATDAQLQT  230

Query  512  NLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            +LDY C Q G+DC AIQPGG CF+PNTV +HAAYAMN LYQ AG +PWNCDF Q+ATL+S
Sbjct  231  DLDYACSQVGVDCGAIQPGGACFQPNTVRAHAAYAMNQLYQAAGSHPWNCDFRQSATLTS  290

Query  335  TNPS  324
            TNPS
Sbjct  291  TNPS  294



>gb|AAP44659.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF98103.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE63416.1| hypothetical protein OsJ_18228 [Oryza sativa Japonica Group]
Length=464

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 134/190 (71%), Gaps = 10/190 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G + +NA+AYV NL++HLRS  GTPLMP K VDTYLFALYDE LKPGPTSERS
Sbjct  274  RGDAGEAGATADNARAYVSNLVSHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPTSERS  333

Query  656  FGLFRPDLTMTFDAGLsktvt---------ptpvtpspkSGAWCVPKEGVSDAQLQANLD  504
            FGL+  DLTM +DAGL+ +            +   P    G WCV   G ++A LQA+LD
Sbjct  334  FGLYHTDLTMAYDAGLTSSSGGAASPSNGGASQQQPRGGGGGWCVASAGATEADLQADLD  393

Query  503  YVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            Y C Q G+DC AIQ GG CFEPNTV +HAAYAMN LYQ AG++PWNCDF  +ATL+S NP
Sbjct  394  YACAQVGVDCGAIQAGGACFEPNTVRAHAAYAMNQLYQAAGRHPWNCDFRSSATLTSDNP  453

Query  326  SYDGCTYPSG  297
            SY  C Y  G
Sbjct  454  SYGSCVYTGG  463



>ref|XP_009123249.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
 emb|CDY37244.1| BnaA09g08650D [Brassica napus]
Length=512

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 135/184 (73%), Gaps = 7/184 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS  VGPS+ENA+ Y GNLI HLRS+VGTPL P K +DTY+FAL+DE LKPGP+ ERSF
Sbjct  271  GDSNVVGPSVENAQTYNGNLIAHLRSMVGTPLRPGKPIDTYIFALFDENLKPGPSFERSF  330

Query  653  GLFRPDLTMTFDAGLsktvtptpvt-------pspkSGAWCVPKEGVSDAQLQANLDYVC  495
            GLF+ DLTM +D GL+KT +    T        S  S  WCVPKE  ++ QLQA+LD+VC
Sbjct  331  GLFKRDLTMAYDIGLTKTSSSGSQTSQSPPLGKSATSVGWCVPKEDATEEQLQASLDWVC  390

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  I PGG CFEPN V SH AYAMNL +Q + +NP +CDFSQTA ++S NPSY  
Sbjct  391  GQGIDCGPITPGGVCFEPNNVMSHTAYAMNLYFQKSPENPTDCDFSQTARITSNNPSYSH  450

Query  314  CTYP  303
            C YP
Sbjct  451  CVYP  454



>ref|NP_001141090.1| uncharacterized protein LOC100273173 [Zea mays]
 gb|ACF85381.1| unknown [Zea mays]
 gb|AFW68016.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=324

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 134/187 (72%), Gaps = 7/187 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G + ENA+AYV NL+ HLRS  GTPLMP K+V+TYLFALYDE LKPGPTSERS
Sbjct  136  RGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTSERS  195

Query  656  FGLFRPDLTMTFD------AGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGL+  DL+M +D      A              P+ G WCV + G SDA+LQA+LDY C
Sbjct  196  FGLYHTDLSMAYDAGLASSAAAGGRGGGGGGAAQPRGGGWCVARAGASDAELQADLDYAC  255

Query  494  GQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
             Q G+DCSAIQPGG CFEPNTV +HAAYA+N LYQ AG++PWNCDF  +ATL+S +PSY 
Sbjct  256  SQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGRHPWNCDFRASATLTSDDPSYG  315

Query  317  GCTYPSG  297
             C Y  G
Sbjct  316  ACVYTGG  322



>ref|XP_010690895.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 136/206 (66%), Gaps = 40/206 (19%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y GDS EVGPSIENAKAY G LI+HLRS+ GTPLMP KSVDTY+FALYDE LKPG  SER
Sbjct  275  YHGDSNEVGPSIENAKAYNGGLISHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGAASER  334

Query  659  SFGLFRPDLTMTFD----------------------------------------AGLskt  600
             FGL++PDL+MT+D                                        A +   
Sbjct  335  YFGLYKPDLSMTYDLDLSKSSSQSPTTTPSTSPAPSTTPSAPSTTPLAPSRTPSAPVMTP  394

Query  599  vtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHA  420
              P   +P   SG WCVPK+GVSDAQL+ANLDY CG G+DCS +Q GGPC +P+TVASHA
Sbjct  395  TAPVTPSPKSSSGTWCVPKKGVSDAQLKANLDYACGHGVDCSKLQAGGPCHDPDTVASHA  454

Query  419  AYAMNLLYQTAGKNPWNCDFSQTATL  342
            AYAMNLLYQTAG+ P +CDFSQTAT+
Sbjct  455  AYAMNLLYQTAGRTPGSCDFSQTATV  480



>gb|EAY91326.1| hypothetical protein OsI_12942 [Oryza sativa Indica Group]
Length=464

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 134/190 (71%), Gaps = 10/190 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G + +NA+AYV NL++HLRS  GTPLMP K VDTYLFALYDE LKPGPTSERS
Sbjct  274  RGDAGEPGATADNARAYVSNLVSHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPTSERS  333

Query  656  FGLFRPDLTMTFDAGLsktvt---------ptpvtpspkSGAWCVPKEGVSDAQLQANLD  504
            FGL+  DLTM +DAGL+ +            +   P    G WCV   G ++A LQA+LD
Sbjct  334  FGLYHTDLTMAYDAGLTSSSGGAASPSNGGASQQQPRGGGGGWCVASAGATEADLQADLD  393

Query  503  YVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            Y C Q G+DC AIQ GG CFEPNTV +HAAYAMN LYQ AG++PWNCDF  +ATL+S NP
Sbjct  394  YACAQVGVDCGAIQAGGACFEPNTVRAHAAYAMNQLYQAAGRHPWNCDFRSSATLTSDNP  453

Query  326  SYDGCTYPSG  297
            SY  C Y  G
Sbjct  454  SYGSCVYTGG  463



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 138/184 (75%), Gaps = 6/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  EVGPS++NAKAY GNLI HLRS+VGTPLMP K VDTY+FALYDE LK GP+SER+
Sbjct  287  RGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKSGPSSERA  346

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtps------pkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGLF+ D +M +D GL+K+   +    S        S  WCV K+  +D QLQ+++D+ C
Sbjct  347  FGLFKTDHSMAYDVGLAKSSGSSSSNSSSQTPSGKASTGWCVSKKDATDEQLQSSIDWAC  406

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            GQGIDC  IQPGG CFEPN VASHAA+AMN+ YQ + K P +CDFSQTAT++S NPSY+ 
Sbjct  407  GQGIDCGPIQPGGACFEPNNVASHAAFAMNMYYQKSPKRPTDCDFSQTATITSQNPSYNS  466

Query  314  CTYP  303
            C YP
Sbjct  467  CVYP  470



>ref|XP_008681422.1| PREDICTED: uncharacterized protein LOC100273173 isoform X2 [Zea 
mays]
Length=463

 Score =   224 bits (570),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 134/187 (72%), Gaps = 7/187 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G + ENA+AYV NL+ HLRS  GTPLMP K+V+TYLFALYDE LKPGPTSERS
Sbjct  275  RGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTSERS  334

Query  656  FGLFRPDLTMTFD------AGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGL+  DL+M +D      A              P+ G WCV + G SDA+LQA+LDY C
Sbjct  335  FGLYHTDLSMAYDAGLASSAAAGGRGGGGGGAAQPRGGGWCVARAGASDAELQADLDYAC  394

Query  494  GQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
             Q G+DCSAIQPGG CFEPNTV +HAAYA+N LYQ AG++PWNCDF  +ATL+S +PSY 
Sbjct  395  SQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGRHPWNCDFRASATLTSDDPSYG  454

Query  317  GCTYPSG  297
             C Y  G
Sbjct  455  ACVYTGG  461



>ref|XP_004982217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Setaria italica]
Length=483

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD+ E G ++ENA+AYV NL++HLRS  GTPL+P K V+TYLFALYDE LKPGP SERS
Sbjct  282  KGDAGEPGATVENARAYVSNLVSHLRSGAGTPLVPGKPVETYLFALYDEDLKPGPESERS  341

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtp-----spkSGAWCVPKEGVSDAQLQANLDYVCG  492
            FGL+  DL+  +DAGL+ +             +  SG WCV ++G +DA LQA+LDY C 
Sbjct  342  FGLYHTDLSAAYDAGLTSSGAAAGSPSAGGGPAKASGGWCVARDGATDADLQADLDYACA  401

Query  491  Q-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            Q G+DC AIQPGG CFEPNTV +HAAYAMN LYQ AG++PWNCDF  +ATL+S NPS   
Sbjct  402  QVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGRHPWNCDFRASATLTSDNPSK--  459

Query  314  CTYP  303
            CT P
Sbjct  460  CTAP  463



>gb|EMT27870.1| Glucan endo-1,3-beta-glucosidase 7 [Aegilops tauschii]
Length=339

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD TE G +++NA+AYV NL+ HLRS  GTPLMP K VDTYLFALYDE LKPGP SER+
Sbjct  141  RGDPTEQGATVDNARAYVSNLVAHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPASERA  200

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS--------GAWCVPKEGVSDAQLQANLDY  501
            FGL+  DLTM +DAGL+ +   +    +  +          WCV   G +DAQLQ +LDY
Sbjct  201  FGLYHTDLTMAYDAGLTSSSPGSGGGSTATTPTTTPSKGSGWCVASAGATDAQLQTDLDY  260

Query  500  VCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
             C Q G+DC AIQPGG CF+PNTV +HAAYAMN LYQ AG +PWNCDF Q+ATL+STNPS
Sbjct  261  ACSQVGVDCGAIQPGGACFQPNTVRAHAAYAMNQLYQAAGSHPWNCDFRQSATLTSTNPS  320



>ref|XP_009407686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 130/184 (71%), Gaps = 6/184 (3%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            Y+GD  E G +++NAKA+  NL+ HLRS+ GTPLMP +SVDTY+FALYDE LKPGPTSER
Sbjct  271  YRGDQDEAGATVDNAKAFNVNLVAHLRSMAGTPLMPGRSVDTYIFALYDEDLKPGPTSER  330

Query  659  SFGLFRPDLTMTFDAGLsktvtpt-----pvtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            SFGLFR DL+  +DAGL+KT T            P +  WCVPK   +D  LQANLDY C
Sbjct  331  SFGLFRADLSPVYDAGLAKTGTTQGNSTGTPARKPVAAGWCVPKAEATDEDLQANLDYAC  390

Query  494  G-QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
              QG+DC  IQ GG C+ PNTV SHAAYAMN LYQ  G++ W+CDF +TA L+  NPSY 
Sbjct  391  AQQGVDCRPIQEGGACYLPNTVRSHAAYAMNQLYQNTGRHGWDCDFRKTAVLTRDNPSYA  450

Query  317  GCTY  306
             C Y
Sbjct  451  TCVY  454



>ref|XP_008681421.1| PREDICTED: uncharacterized protein LOC100273173 isoform X1 [Zea 
mays]
Length=465

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 130/178 (73%), Gaps = 7/178 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+ E G + ENA+AYV NL+ HLRS  GTPLMP K+V+TYLFALYDE LKPGPTSERS
Sbjct  275  RGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTSERS  334

Query  656  FGLFRPDLTMTFD------AGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            FGL+  DL+M +D      A              P+ G WCV + G SDA+LQA+LDY C
Sbjct  335  FGLYHTDLSMAYDAGLASSAAAGGRGGGGGGAAQPRGGGWCVARAGASDAELQADLDYAC  394

Query  494  GQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
             Q G+DCSAIQPGG CFEPNTV +HAAYA+N LYQ AG++PWNCDF  +ATL+S +P+
Sbjct  395  SQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGRHPWNCDFRASATLTSDDPN  452



>gb|ABK25242.1| unknown [Picea sitchensis]
Length=491

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 129/207 (62%), Gaps = 31/207 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD TE G S++NA AY GNLI H+ S+ GTPL P + + TY+F+L++E LKPGPTSER++
Sbjct  282  GDPTEAGASLQNAIAYNGNLIKHVTSMAGTPLRPNRYIHTYIFSLFNEDLKPGPTSERNY  341

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+ D+TM +D GL ++ +  P       G                             
Sbjct  342  GLFKADMTMAYDVGLLQSPSAGPSPAPRTGGPVTATPPRAGGSVTAPPTRTGGPVTAPPT  401

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
               WC+ K G  +  L+ANL+Y CGQGIDC  IQPGGPC+ PNTVA HAAYAMN  YQ A
Sbjct  402  GKVWCITKPGADEKTLEANLNYACGQGIDCRPIQPGGPCYSPNTVACHAAYAMNAYYQAA  461

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTY  306
            G+N WNCDF QT TL+ST+PSY GC Y
Sbjct  462  GRNSWNCDFGQTGTLTSTDPSYGGCVY  488



>gb|ABK24319.1| unknown [Picea sitchensis]
 gb|ACN40930.1| unknown [Picea sitchensis]
Length=491

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 129/207 (62%), Gaps = 31/207 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD TE G S++NA AY GNLI H+ S+ GTPL P + + TY+F+L++E LK GPTSER++
Sbjct  282  GDPTEAGASLQNAIAYNGNLIKHVTSMAGTPLRPNRYIHTYIFSLFNEDLKSGPTSERNY  341

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+ D+TM +D GL ++ +  P       G                             
Sbjct  342  GLFKADMTMAYDVGLLQSPSAGPSPAPRTGGPVTATPPLAGGSVTSPPTRTGGPVTAPPT  401

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
               WC+ K G  +  L+ANL+Y CGQGIDC  IQPGGPC+ PNTVA HAAYAMN  YQ A
Sbjct  402  GKVWCITKPGADEKTLEANLNYACGQGIDCRPIQPGGPCYSPNTVACHAAYAMNAYYQAA  461

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTY  306
            G+N WNCDF+QT TL+ST+PSY GC Y
Sbjct  462  GRNSWNCDFAQTGTLTSTDPSYGGCVY  488



>gb|ADE76367.1| unknown [Picea sitchensis]
Length=472

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD +E G S++NA AY GNLI H+ S+ GTP+MP +SV+ Y+F L++E LKPGPTSER+F
Sbjct  282  GDPSEAGVSLQNAIAYNGNLIKHVTSMAGTPMMPNRSVEIYIFGLFNEDLKPGPTSERNF  341

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkS----------GAWCVPKEGVSDAQLQANLD  504
            GLF+ D+TM +D GL ++ +  P T +P++            WCV K    +  L+ NLD
Sbjct  342  GLFKADMTMAYDVGLLRSQSAGPSTAAPRTDGPVIAPPTGKVWCVAKPSADENSLKENLD  401

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            Y CGQ IDC  IQ GGPC+ PNT+ASHA YAMN  YQ+AG+N  +CDF+QT TL+S +PS
Sbjct  402  YACGQSIDCKPIQQGGPCYLPNTMASHATYAMNAYYQSAGRNSLSCDFAQTGTLTSKDPS  461

Query  323  YDGCTY  306
            Y GC Y
Sbjct  462  YGGCVY  467



>ref|XP_012071831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Jatropha 
curcas]
 gb|KDP38495.1| hypothetical protein JCGZ_04420 [Jatropha curcas]
Length=437

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            YKGD  EVGPSIENAKAY GNLI HLRS+VGTPLMP KSVDTYLFALYDE LKPGP SER
Sbjct  270  YKGDDNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSER  329

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkS--------GAWCVPKEGVSDAQLQANLD  504
            +FGLF+PDLTM +D GLSK+        +P            WC PK  VSDA+ QANLD
Sbjct  330  AFGLFKPDLTMIYDIGLSKSNQAPSTPKTPSVSPSPTPNQATWCTPKAAVSDAKSQANLD  389

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNL  402
            Y C  G DCS  +PGG CFEP+ VASHAAYAMN 
Sbjct  390  YACENGKDCSPKKPGGTCFEPHIVASHAAYAMNF  423



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 126/182 (69%), Gaps = 4/182 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ +   +I+NA +Y GNLI H+ S  GTPLMP +S +T++FAL++E LKPGPT ER+F
Sbjct  274  GDANQPDVNIQNAISYNGNLIKHVNSGKGTPLMPNRSFETFIFALFNENLKPGPTPERNF  333

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG----AWCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PD T  +D+G+ +           +       WCVPK   SD  LQAN++YVCG G
Sbjct  334  GLFQPDFTPVYDSGVMRGQMRGRRRRRRRGAPAGKVWCVPKAEASDEALQANINYVCGTG  393

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            +DC  IQPGG CF+PNT+ SHA+Y MN  YQTAG++ +NCDFS TA L++T+PS+  C Y
Sbjct  394  VDCKLIQPGGNCFDPNTIRSHASYVMNAYYQTAGRHSFNCDFSHTAVLTTTDPSHGTCQY  453

Query  305  PS  300
             S
Sbjct  454  IS  455



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 124/180 (69%), Gaps = 5/180 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S++NA +Y  NL+ H+ S +GTPLMP ++ DTY+F+L++E LKPG  SE++F
Sbjct  278  GDPNQPGVSLDNAISYNANLVRHVNSGLGTPLMPNRTFDTYIFSLFNEDLKPG-ISEQNF  336

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG----AWCVPKEGVSDAQLQANLDYVCGQG  486
            GLFRPD +  +D G+ +        P   +      WCVPK+  SD  LQ+N+DYVCG G
Sbjct  337  GLFRPDFSPVYDVGILRNQQGVGPAPVTPAAPDDKKWCVPKDDASDGALQSNIDYVCGSG  396

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            +DC  IQ GGPCFEPNTV SHAAYAMN  YQ  G+N +NCDF  TA +++ NPSY GCTY
Sbjct  397  VDCQPIQNGGPCFEPNTVRSHAAYAMNAYYQAHGRNDYNCDFIGTAAITTANPSYQGCTY  456



>emb|CAN83700.1| hypothetical protein VITISV_027546 [Vitis vinifera]
Length=325

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 126/179 (70%), Gaps = 1/179 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +VG ++ENA  Y GNL+ H+ S  GTPLMP +   TYLF+L++E LKPG T+ER+F
Sbjct  147  GDPNQVGVNLENAATYNGNLLKHISSGKGTPLMPNRRFQTYLFSLFNENLKPGSTAERNF  206

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-WCVPKEGVSDAQLQANLDYVCGQGIDC  477
            GLFRPD T  +D G+ K       TP+  SG  WCVPK   +D  LQ+N++YVC  G+DC
Sbjct  207  GLFRPDFTPVYDIGILKQSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYVCSTGVDC  266

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
              IQPGG C++PNT+ SHA+YAMN  YQT+G++ +NCDF+ T  L++++PS+  C Y S
Sbjct  267  KPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHGPCQYIS  325



>emb|CBI31680.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 127/179 (71%), Gaps = 1/179 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +VG ++ENA +Y GNL+ H+ S  GTPLMP +   TYLF+L++E LKPG T+ER+F
Sbjct  228  GDPNQVGVNLENAASYNGNLLKHISSGKGTPLMPNRRFQTYLFSLFNENLKPGSTAERNF  287

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-WCVPKEGVSDAQLQANLDYVCGQGIDC  477
            GLFRPD T  +D G+ K       TP+  SG  WCVPK   +D  LQ+N++YVC  G+DC
Sbjct  288  GLFRPDFTPVYDIGILKQSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYVCSTGVDC  347

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
              IQPGG C++PNT+ SHA+YAMN  YQT+G++ +NCDF+ T  L++++PS+  C Y S
Sbjct  348  KPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHGPCQYIS  406



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 127/179 (71%), Gaps = 1/179 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +VG ++ENA +Y GNL+ H+ S  GTPLMP +   TYLF+L++E LKPG T+ER+F
Sbjct  269  GDPNQVGVNLENAASYNGNLLKHISSGKGTPLMPNRRFQTYLFSLFNENLKPGSTAERNF  328

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-WCVPKEGVSDAQLQANLDYVCGQGIDC  477
            GLFRPD T  +D G+ K       TP+  SG  WCVPK   +D  LQ+N++YVC  G+DC
Sbjct  329  GLFRPDFTPVYDIGILKQSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYVCSTGVDC  388

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
              IQPGG C++PNT+ SHA+YAMN  YQT+G++ +NCDF+ T  L++++PS+  C Y S
Sbjct  389  KPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHGPCQYIS  447



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 5/181 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y GNL+ H+ S +GTPLMP ++ +TYLFAL++E LKP   SE++F
Sbjct  266  GDPNQPGVSLENALSYNGNLVKHVNSGIGTPLMPNRTFETYLFALFNENLKPT-VSEQNF  324

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA----WCVPKEGVSDAQLQANLDYVCGQG  486
            GLF+PD T  +D G+ +       T    S +    WCVPK   S+  LQ N+DYVC  G
Sbjct  325  GLFKPDFTPVYDVGVLRNPRAKGPTAPAPSSSQGKKWCVPKSDASEDALQKNIDYVCSTG  384

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            +DC AIQ GGPCF+PNTV SHA+YAMN  YQT G+  +NCDF+ T  L++++PSY+ C+Y
Sbjct  385  VDCRAIQAGGPCFDPNTVRSHASYAMNAYYQTFGRQDYNCDFNHTGRLTNSDPSYEACSY  444

Query  305  P  303
            P
Sbjct  445  P  445



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ +   ++ENA +Y GNLI H+ +  GTPLMP ++ +TY+F+L++E LKPG T+ER+F
Sbjct  275  GDTNQPDVNLENAISYNGNLIKHVNTGKGTPLMPNRNFETYIFSLFNENLKPGSTAERNF  334

Query  653  GLFRPDLTMTFDAGLsktvtp--tpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLFRPDLT  ++ G+ +  +   TP TPS     WCVPK   SD  LQAN+DYVC  G+D
Sbjct  335  GLFRPDLTPVYNVGIMRGQSGGPTPTTPSGSGKKWCVPKADASDGALQANIDYVCSLGVD  394

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C  IQ GG CF PNT+ SHA+YAMN  YQT+G++ +NCDF+ T  ++S +PS+D C Y
Sbjct  395  CRPIQAGGDCFNPNTIRSHASYAMNAYYQTSGRHDFNCDFAHTGVITSLDPSHDTCRY  452



>ref|XP_008223598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=517

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 125/207 (60%), Gaps = 31/207 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD T+   +++NA +Y GNL+ H+ S  GTPLMP ++ DTY+F+L++E LKP  TSER++
Sbjct  275  GDPTQPDVNVDNAASYNGNLVRHVSSGKGTPLMPNRTFDTYIFSLFNENLKPT-TSERNY  333

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+PDL   +D G+ +       T    SG                             
Sbjct  334  GLFKPDLNPVYDVGILRNQQAAGPTSGVASGPSSGGAPGPTSGGASGPASDGARAPSSSE  393

Query  560  -AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAG  384
              WCVP+  VSDA LQAN+DYVC  G+DC AIQ GGPCF+PNTV SHAAY MN  YQ+ G
Sbjct  394  KRWCVPRSNVSDAALQANIDYVCSSGVDCKAIQKGGPCFQPNTVRSHAAYVMNAYYQSVG  453

Query  383  KNPWNCDFSQTATLSSTNPSYDGCTYP  303
               +NCDF  T  +++T+PSYD CTYP
Sbjct  454  PQDYNCDFKHTGFITTTDPSYDACTYP  480



>ref|XP_007205054.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
 gb|EMJ06253.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
Length=516

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 125/207 (60%), Gaps = 31/207 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD T+   +++NA +Y GNL+ H+ S  GTPLMP ++ +TY+FAL++E LKP  TSER++
Sbjct  275  GDPTQPDVNVDNAASYNGNLVRHVSSGKGTPLMPNRTFETYIFALFNENLKPT-TSERNY  333

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+PDL   +D G+ +       T    SG                             
Sbjct  334  GLFKPDLNPVYDVGILRNQQAAGPTSGVASGPSSGGAAGPTSGGASGPTSGGARAPSSSE  393

Query  560  -AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAG  384
              WCVP+  VSDA LQAN+DYVC  G+DC AIQ GGPCF+PNTV SHAAY MN  YQ+ G
Sbjct  394  KRWCVPRSNVSDAALQANIDYVCSSGVDCKAIQKGGPCFQPNTVRSHAAYVMNAYYQSVG  453

Query  383  KNPWNCDFSQTATLSSTNPSYDGCTYP  303
               +NCDF  T  +++T+PSYD CTYP
Sbjct  454  PQDYNCDFKHTGFITTTDPSYDACTYP  480



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA AY GNLI H+ S  GTPLMP +  +TY+FAL++E LKPG T+ER++
Sbjct  269  GDPNQPACTVENAVAYNGNLIKHVTSGKGTPLMPNRRFETYIFALFNENLKPGSTAERNW  328

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-WCVPKEGVSDAQLQANLDYVCGQGIDC  477
            GLFRPD +  ++ G+ +        P+P +G  WCVPK   +D QLQAN+DYVC QG+DC
Sbjct  329  GLFRPDFSPVYNVGVLRNEQTNTPNPNPTTGKKWCVPKAEANDQQLQANIDYVCSQGVDC  388

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
              IQ GG CF+PN + SHA++AMN  YQT G+N +NCDFS TA +++ +PS
Sbjct  389  KPIQAGGACFDPNNIRSHASFAMNSFYQTHGRNDFNCDFSHTAVITTADPS  439



>ref|XP_011029787.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=451

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 113/175 (65%), Gaps = 7/175 (4%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ENA  + GNL+   R   GTPLMP +  +TYLF+L++E LKPGPT+ER++GLFRPD T
Sbjct  276  SMENAAWFNGNLVRRSRQGKGTPLMPNRRFETYLFSLFNENLKPGPTAERNWGLFRPDFT  335

Query  629  MTFDAGLsktvtptpvtpspkSGA-------WCVPKEGVSDAQLQANLDYVCGQGIDCSA  471
              +DAG+ +           +          WCVPK GVSD  LQAN+DY C QG+DC  
Sbjct  336  PIYDAGILRNGQRGSGRGGGRQRPRPTPGKQWCVPKPGVSDQALQANIDYACSQGVDCKP  395

Query  470  IQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IQPGG CF+PN V SHA+Y MN  YQT G+  +NCDFS T  L++ NP +  C Y
Sbjct  396  IQPGGACFDPNNVRSHASYVMNFFYQTHGRQAFNCDFSNTGVLTAVNPGHGTCRY  450



>ref|XP_011658156.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 125/184 (68%), Gaps = 8/184 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TY+F+L++E LKP  TSER++
Sbjct  265  GDPNQAGVSMENAISYNRNLVKHVNSGKGTPLMPNRTFETYIFSLFNENLKPS-TSERNY  323

Query  653  GLFRPDLTMTFDAGLsktvtptpvtp-------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            GLF+PD T  +D G+ +       T        S +   WCVPK   SD  LQ N+DYVC
Sbjct  324  GLFQPDFTPVYDVGILQNPPAMGPTSPVGGPKPSDEEREWCVPKTDASDEALQKNIDYVC  383

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
              G+DC  IQ GG C++PNTV SHA+YAMN  +QTAG++ +NCDF+ TA L+ST+PSY+ 
Sbjct  384  SSGVDCGPIQEGGACYDPNTVRSHASYAMNAYFQTAGRHEFNCDFNHTAILTSTDPSYEA  443

Query  314  CTYP  303
            C+YP
Sbjct  444  CSYP  447



>ref|XP_010091148.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB42894.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=248

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S++NA+ Y  NLI H+ S  GTPLMP +  +TYLF+L++E LKPGPT+ER++GLF+PD T
Sbjct  89   SVQNARDYTTNLIRHVNSGKGTPLMPNRRFETYLFSLFNENLKPGPTAERNWGLFQPDFT  148

Query  629  MTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPC  450
              +DAG+ +               WCVPK   S   LQAN+DYVC  G+DC  IQ GGPC
Sbjct  149  PVYDAGILRNGVRPGGGLGK---KWCVPKSDSSTQALQANIDYVCSSGVDCRPIQGGGPC  205

Query  449  FEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            FEPN + SHA++ MN  YQT G+N +NCDF++T  ++ TNPS
Sbjct  206  FEPNDIRSHASFVMNSFYQTKGRNDYNCDFAKTGVITYTNPS  247



>ref|XP_004505325.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Cicer 
arietinum]
Length=492

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 123/186 (66%), Gaps = 6/186 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G  IENA +Y GNLI H+ S  GTPLMP ++ +TY+F+L++E LKP   SER++
Sbjct  268  GDPNQPGVGIENAVSYNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-VSERNY  326

Query  653  GLFRPDLTMTFDAGLsktvtpt-----pvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQ  489
            GLF+P+L   +D G+                   S  WCVPK   S+  LQAN+DYVC +
Sbjct  327  GLFKPNLAPVYDVGVFTQQAMGPASGPTAMVPLGSKKWCVPKANASEKALQANIDYVCSR  386

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GI+C  I+ GGPCF+PNT+ SHAAYAMN  YQ +G++ ++CDF  T  ++ TNPSY+ CT
Sbjct  387  GINCGPIKDGGPCFKPNTLRSHAAYAMNAYYQQSGRHDFDCDFGHTGVITFTNPSYEKCT  446

Query  308  YPSGST  291
            YPS +T
Sbjct  447  YPSAAT  452



>ref|XP_006827757.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Amborella trichopoda]
Length=461

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  ++G S+ NA AY GNLI H+ S +GTPLMP ++ +TY+F+L++E LK GPT+ER+F
Sbjct  273  GDPGQIGVSVANAAAYNGNLIRHVNSGIGTPLMPNQTFETYIFSLFNENLKLGPTAERNF  332

Query  653  GLFRPDLTMTFDAGLsktvtpt-----------pvtpspkSGAWCVPKEGVSDAQLQANL  507
            GLFRPD    +D G+ ++                         WC+PK       LQ N+
Sbjct  333  GLFRPDFVPAYDIGILRSEARMPAPINPTPLAPINQVPTNMKQWCLPKANADPRALQENI  392

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DY CGQG+DC  IQ GG CF PNT+ +HAAYAMN  YQ+AG++ ++CDF QT  +S+ +P
Sbjct  393  DYACGQGLDCRPIQIGGACFLPNTIQAHAAYAMNAYYQSAGRHAYDCDFKQTGAISTVDP  452

Query  326  SYDGCTYPS  300
            SY  C Y S
Sbjct  453  SYGSCIYNS  461



>ref|XP_002312098.1| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89465.1| glucan endo-1 family protein [Populus trichocarpa]
Length=454

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 113/175 (65%), Gaps = 7/175 (4%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ENA  + GNL+   R   GTPLMP +  +TYLF+L++E LKPGPT+ER++GLFRPD +
Sbjct  279  SMENAAWFNGNLVRRARQGKGTPLMPNRRFETYLFSLFNENLKPGPTAERNWGLFRPDFS  338

Query  629  MTFDAGLsktvtptpvtpspkSGA-------WCVPKEGVSDAQLQANLDYVCGQGIDCSA  471
              +DAG+ +           +          WCVPK GVSD  LQAN+DY C QG+DC  
Sbjct  339  PIYDAGILRNGQRGSGRGGGRQRPRPTPGKQWCVPKPGVSDQALQANIDYACSQGVDCKP  398

Query  470  IQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IQPGG CF+PN V SHA+Y MN  YQT G+  +NCDFS T  L++ NP +  C +
Sbjct  399  IQPGGACFDPNNVRSHASYVMNFFYQTHGRQAFNCDFSNTGVLTAVNPGHGTCRF  453



>ref|XP_004505326.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Cicer 
arietinum]
Length=495

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 9/189 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G  IENA +Y GNLI H+ S  GTPLMP ++ +TY+F+L++E LKP   SER++
Sbjct  268  GDPNQPGVGIENAVSYNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-VSERNY  326

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA--------WCVPKEGVSDAQLQANLDYV  498
            GLF+P+L   +D G+     P  + P+    A        WCVPK   S+  LQAN+DYV
Sbjct  327  GLFKPNLAPVYDVGVFTQQVPQAMGPASGPTAMVPLGSKKWCVPKANASEKALQANIDYV  386

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C +GI+C  I+ GGPCF+PNT+ SHAAYAMN  YQ +G++ ++CDF  T  ++ TNPSY+
Sbjct  387  CSRGINCGPIKDGGPCFKPNTLRSHAAYAMNAYYQQSGRHDFDCDFGHTGVITFTNPSYE  446

Query  317  GCTYPSGST  291
             CTYPS +T
Sbjct  447  KCTYPSAAT  455



>ref|XP_012075958.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Jatropha 
curcas]
 gb|KDP34495.1| hypothetical protein JCGZ_11045 [Jatropha curcas]
Length=494

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TYLFAL++E LKP   SER+F
Sbjct  268  GDPNQPGVSLENAVSYNANLVKHVNSGKGTPLMPNRTFETYLFALFNENLKPT-ISERNF  326

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA--------WCVPKEGVSDAQLQANLDYV  498
            GLF+PDL+  +D G+ +       T +  + A        WCVPK    D  LQ N+DYV
Sbjct  327  GLFKPDLSPVYDVGVLRNGQAHGPTAATTAAAPSSSLDRRWCVPKSDAGDEALQKNIDYV  386

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C   +DC AIQ GGPCF+PNTV SHA+YAMN  YQT G++ +NCDF+ +  L++ NPSY+
Sbjct  387  CSNRVDCRAIQAGGPCFDPNTVRSHASYAMNAYYQTFGRHDYNCDFNGSGVLTTVNPSYE  446

Query  317  GCTYP  303
             C YP
Sbjct  447  ACNYP  451



>ref|XP_008778544.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=455

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 118/179 (66%), Gaps = 1/179 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVG  +++A+ Y  NL+ H  S +GTPLMP ++ DTY+F+L++E LKPGPTSER+F
Sbjct  277  GDAWEVGADMDSARDYNKNLVRHAASGIGTPLMPNRTFDTYIFSLFNENLKPGPTSERNF  336

Query  653  GLFRPDLTMTFDAG-LsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            GLF P++T  +D G L           +  +  WCVPK       LQ N++YVC QGIDC
Sbjct  337  GLFYPNMTPVYDIGILRTEAREQVKPMASDAKRWCVPKPNADVMSLQENIEYVCAQGIDC  396

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            + I+PGG C+ P+T   HAAY MN  YQ+ G+N ++CDF QT  +S+ +PSY  C Y S
Sbjct  397  NPIRPGGACYRPDTAQGHAAYVMNEYYQSFGRNSFDCDFGQTGVISTIDPSYGNCIYRS  455



>ref|XP_006846179.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 124/208 (60%), Gaps = 32/208 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  E   ++ NA +Y GNLI H+ S VGTP+MPRK  +TY+F+L++E LKPG T+ER+F
Sbjct  272  GDPNEPAVNMANAVSYNGNLIRHVSSWVGTPMMPRKKFETYIFSLFNENLKPGSTAERNF  331

Query  653  GLFRPDLTMTFDAG--------------------------------Lsktvtptpvtpsp  570
            GLF+ DLT  +D G                                L       P   +P
Sbjct  332  GLFKADLTPVYDVGVMKGQSGAPTPANPSPVTPAPTNPSPVNPAPQLPSPAPENPAPGAP  391

Query  569  kSGAWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQT  390
                WCVPK  V D +LQAN+DYVC QG+DC+ IQ GG C+ P+T+ SHAAYAMN  YQ 
Sbjct  392  SEKLWCVPKPEVEDVKLQANIDYVCSQGVDCTPIQAGGACYLPDTLQSHAAYAMNAYYQF  451

Query  389  AGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            AG+N +NCDF+QT  L+S+NPSY  C +
Sbjct  452  AGRNDFNCDFAQTGVLTSSNPSYGDCNF  479



>ref|XP_011015294.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=496

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 121/188 (64%), Gaps = 12/188 (6%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TY+F+L++E LKP   SER+F
Sbjct  270  GDPNQPGVSMENAISYNKNLVKHVNSGKGTPLMPNRTFETYVFSLFNENLKPS-VSERNF  328

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----------WCVPKEGVSDAQLQANL  507
            GLF+PDLT  +D G+ +       T    + A           WCVPK   SD  LQ N+
Sbjct  329  GLFKPDLTPVYDVGVLRNDKALAPTSGTAADAPSSSSPGREKQWCVPKSDASDDSLQKNI  388

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DYVC  G+DC  IQ GGPCF P+TV SHA+YAMN  YQ +G++ ++CDF+ T  L+S +P
Sbjct  389  DYVCSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDFDCDFNHTGVLTSIDP  448

Query  326  SYDGCTYP  303
            SY+ C YP
Sbjct  449  SYEACDYP  456



>ref|XP_011035318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=504

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 121/188 (64%), Gaps = 12/188 (6%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TY+F+L++E LKP   SER+F
Sbjct  278  GDPNQPGVSMENAISYNKNLVKHVNSGKGTPLMPNRTFETYVFSLFNENLKPS-VSERNF  336

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----------WCVPKEGVSDAQLQANL  507
            GLF+PDLT  +D G+ +       T    + A           WCVPK   SD  LQ N+
Sbjct  337  GLFKPDLTPVYDVGVLRNDKALAPTSGTAADAPSSSSPGRERRWCVPKSDASDDALQKNI  396

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DYVC  G+DC  IQ GGPCF P+TV SHA+YAMN  YQ +G++ ++CDF+ T  L+S +P
Sbjct  397  DYVCSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDFDCDFNHTGVLTSIDP  456

Query  326  SYDGCTYP  303
            SY+ C YP
Sbjct  457  SYEACDYP  464



>ref|XP_012089256.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Jatropha 
curcas]
 gb|KDP44958.1| hypothetical protein JCGZ_01458 [Jatropha curcas]
Length=446

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA ++ GNLI H+ S  GTPLMP +   TY+FAL++E LKPG T+ER++
Sbjct  266  GDPDQPACTVENAVSFNGNLIKHVTSGKGTPLMPNRKFQTYIFALFNENLKPGTTAERNW  325

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkS----GAWCVPKEGVSDAQLQANLDYVCGQG  486
            GLFRPD +  ++ G+ +     P  P P        WCVPK   ++ QLQ N+DYVC QG
Sbjct  326  GLFRPDFSPVYNVGILRNPQKNPTVPQPTPTTGGKKWCVPKAEATEQQLQGNIDYVCSQG  385

Query  485  IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            +DC  IQ GG CF+PN V SHA++ MN  YQT G+N +NCDFS+T  +++++PS+ GC Y
Sbjct  386  VDCKPIQAGGACFDPNNVRSHASFVMNSFYQTHGRNDFNCDFSKTGEVTTSDPSHGGCKY  445



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 117/182 (64%), Gaps = 6/182 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
             D  ++G   ENA  Y GNLI H+   VGTPLMP ++ +TY+FAL++E LKPGPT ER+F
Sbjct  274  ADPGQLGVDSENAAEYNGNLIKHVTYGVGTPLMPNRTFETYIFALFNENLKPGPTYERNF  333

Query  653  GLFRPDLTMTFDAGLsktvtptpv------tpspkSGAWCVPKEGVSDAQLQANLDYVCG  492
            GLF+PD+T  +D G+ +      +        +PK   WC+PK       LQ N+DYVCG
Sbjct  334  GLFQPDMTPVYDIGIQRPTRSASLPLNPSPVVTPKQKRWCLPKSDADPKALQNNIDYVCG  393

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
             G DC  IQ GG CF PNTV +HAAY MN  YQ  G+N ++CDF+QT  +S+ +PSY GC
Sbjct  394  LGFDCRPIQDGGACFLPNTVQAHAAYVMNAYYQATGRNAYDCDFAQTGAISTVDPSYGGC  453

Query  311  TY  306
             Y
Sbjct  454  RY  455



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 118/186 (63%), Gaps = 6/186 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  ++ A  +  N++  + S +GTPLMP ++ +TY+FAL++E LKPGPTSER+
Sbjct  253  EGDIDQIGVDVDTAAEFNKNIVDRVNSGIGTPLMPNRTFETYIFALFNENLKPGPTSERN  312

Query  656  FGLFRPDLTMTFDAGLsktvtptpv------tpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            FG+FR DLT  +D G+ +                     WCV K G     LQ N+DYVC
Sbjct  313  FGIFRSDLTPVYDIGILRPTANPENNPRSPPVRGSSEKRWCVTKSGAETVDLQRNIDYVC  372

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
            G G+DC  I+  GPCF PNTV +H+AYAMNL YQT GK+ ++CDF +T  +++ +PSY  
Sbjct  373  GLGLDCRPIKENGPCFLPNTVKAHSAYAMNLFYQTMGKHEFDCDFDKTGVITTIDPSYGS  432

Query  314  CTYPSG  297
            C Y +G
Sbjct  433  CAYQAG  438



>ref|XP_012089248.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Jatropha 
curcas]
Length=448

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 120/182 (66%), Gaps = 6/182 (3%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA ++ GNLI H+ S  GTPLMP +   TY+FAL++E LKPG T+ER++
Sbjct  266  GDPDQPACTVENAVSFNGNLIKHVTSGKGTPLMPNRKFQTYIFALFNENLKPGTTAERNW  325

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkS------GAWCVPKEGVSDAQLQANLDYVCG  492
            GLFRPD +  ++ G+ +          P+         WCVPK   ++ QLQ N+DYVC 
Sbjct  326  GLFRPDFSPVYNVGILRNPQVRKNPTVPQPTPTTGGKKWCVPKAEATEQQLQGNIDYVCS  385

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QG+DC  IQ GG CF+PN V SHA++ MN  YQT G+N +NCDFS+T  +++++PS+ GC
Sbjct  386  QGVDCKPIQAGGACFDPNNVRSHASFVMNSFYQTHGRNDFNCDFSKTGEVTTSDPSHGGC  445

Query  311  TY  306
             Y
Sbjct  446  KY  447



>ref|XP_004309121.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 121/189 (64%), Gaps = 12/189 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD+ +VG  +E+A  Y  NLI H+ S  GTPLMP ++ +TY+FAL++E LKPGPTSER+
Sbjct  320  KGDAGQVGVDLESAADYNQNLIRHMTSGNGTPLMPNRTFETYIFALFNENLKPGPTSERN  379

Query  656  FGLFRPDLTMTFDAGLsktvtptpv------------tpspkSGAWCVPKEGVSDAQLQA  513
            FGLFRPD+T  ++ G+ +    +              +P      +C+PK G     LQ 
Sbjct  380  FGLFRPDMTPVYNVGVLRHTASSSTPGNESPSPKQTPSPLHAGKQYCLPKNGADTEALQK  439

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            N+DYVCG G+DC  I+ GGPCF PNTV +HAAYAMN+ YQ  G+N ++CDF QT   ++ 
Sbjct  440  NIDYVCGLGLDCGPIKQGGPCFMPNTVRAHAAYAMNIYYQAMGRNGYDCDFEQTGATTTV  499

Query  332  NPSYDGCTY  306
            +P Y  C Y
Sbjct  500  DPGYGKCKY  508



>ref|XP_004295910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 124/206 (60%), Gaps = 29/206 (14%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  ++G S+ENA+AY GNLI H+ S  GTPLMP ++ +TY+FAL++E LKP   SE+++
Sbjct  266  GDPNQLGVSVENAEAYNGNLIRHVSSGKGTPLMPNRTFETYIFALFNENLKPT-LSEQNY  324

Query  653  GLFRPDLTMTFDAGLsktvtp----------------------------tpvtpspkSGA  558
            GLF+PDL   +D GL +                                   +P+    +
Sbjct  325  GLFKPDLDPVYDVGLLRNGQAEGPTSGPALSPASGPAAGPEAMGPAPDVVAQSPAAAGKS  384

Query  557  WCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKN  378
            WCVPK  VSDA LQ N+DYVC  G+DC  I+ GGPCFEPN+V SHAAY MN  YQ  G  
Sbjct  385  WCVPKSNVSDAALQKNIDYVCSSGVDCKPIKQGGPCFEPNSVKSHAAYVMNAYYQEHGPQ  444

Query  377  PWNCDFSQTATLSSTNPSYDGCTYPS  300
              NCDF+ T  ++ST+PSY  CTYP+
Sbjct  445  NINCDFNGTGVVTSTDPSYKTCTYPT  470



>gb|EYU33213.1| hypothetical protein MIMGU_mgv1a006294mg [Erythranthe guttata]
Length=449

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 115/175 (66%), Gaps = 7/175 (4%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ENA AY G L+    S  GTPLMPRK ++TY+F L++E LK GP SE++FGLFRPD T
Sbjct  273  SVENAAAYNGGLVRKYNSGRGTPLMPRKRLETYIFGLFNENLKSGPLSEKNFGLFRPDFT  332

Query  629  MTFDAGLsktvtptpvtpspkS-------GAWCVPKEGVSDAQLQANLDYVCGQGIDCSA  471
              +DAG+ +  +        K          WCVPK   SD++LQ N+DYVC QG+DC  
Sbjct  333  PAYDAGIMRVGSTAAPVQPIKRPTPAQDGKKWCVPKAEASDSELQKNIDYVCSQGVDCGP  392

Query  470  IQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            IQPGG CF+PNTV SHA++ MN  YQ  G++ +NC+FS +  ++ST+PS   C Y
Sbjct  393  IQPGGACFDPNTVRSHASFVMNAFYQREGRHDFNCNFSGSGLITSTDPSTGNCKY  447



>ref|XP_011091523.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=457

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ NA AY G L+   +S  GTPLMPRK  DTY+F L++E LK GP SER+FGLFRPD T
Sbjct  278  SVANAAAYNGGLVRKYKSGRGTPLMPRKRFDTYIFGLFNENLKTGPLSERNFGLFRPDFT  337

Query  629  MTFDAGLsktvtptpvtpspkSGA----------WCVPKEGVSDAQLQANLDYVCGQGID  480
              +D G+ +  T           A          WCVPK   +DA+LQAN+DYVC QG++
Sbjct  338  PVYDIGVLRQGTAAAPQQPVPRPALPAPAQEGKKWCVPKPDATDAELQANIDYVCSQGLN  397

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            C  IQPGGPCF+PNTV +HA++ MN  YQ+ G++ +NCDFS +  L+ T+PS   C Y S
Sbjct  398  CQPIQPGGPCFDPNTVRAHASFVMNTYYQSEGRHDFNCDFSGSGVLTFTDPSNGPCKYVS  457



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 8/184 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TY+F+L++E LKP  TSER++
Sbjct  345  GDPNQPGVSMENAISYNRNLVKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-TSERNY  403

Query  653  GLFRPDLTMTFDAGLsktvtptpvtp-------spkSGAWCVPKEGVSDAQLQANLDYVC  495
            GLF+PD T  +D G+ +       T        S +   WCVPK   SD  LQ N+DYVC
Sbjct  404  GLFQPDFTPVYDVGILRNPPTMGPTSPVGGPKPSDEGRRWCVPKTDASDEALQKNIDYVC  463

Query  494  GQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
              G+DC  IQ GG C++PNTV SHA+YAMN  +QTAG++ +NCDF+ TA L+ T+PSY+ 
Sbjct  464  SSGVDCGPIQEGGACYDPNTVRSHASYAMNAYFQTAGRHDFNCDFNHTAILTFTDPSYEA  523

Query  314  CTYP  303
            C+YP
Sbjct  524  CSYP  527



>emb|CDP00093.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G++ E   +  NA AY G L+    S  GTPLMP + ++TY+FAL++E  KPG  +ERS
Sbjct  269  QGETFEPQCTPANAAAYNGGLVKKYNSGSGTPLMPHRKIETYIFALFNENQKPGSLAERS  328

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----WCVPKEGVSDAQLQANLDYVCG  492
            +GLFRPD T  +D G+ +    +   P P + A     WCVPK G +DA LQ+N+DYVC 
Sbjct  329  WGLFRPDFTPVYDVGIMRGGQSSQPVPVPAAPALQGKKWCVPKAGATDAALQSNIDYVCS  388

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QG+DCS IQ  G CF PN V SHAA+ MN  YQ+ GK  +NCDFSQT  L+STNPSY  C
Sbjct  389  QGLDCSPIQAEGACFNPNNVRSHAAFVMNSWYQSKGKADYNCDFSQTGFLTSTNPSYGTC  448

Query  311  TYPS  300
             Y S
Sbjct  449  QYTS  452



>ref|XP_011029669.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=448

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA +Y  N+I  + S  GTPLMP++   TY+F+L++E LKPG T+ER++
Sbjct  270  GDPNQPMCTVENAVSYNKNMIKVVTSGNGTPLMPKRRFQTYVFSLFNENLKPGSTAERNW  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvt--pspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLFRPD T  +D G+ +       T     KS  WCVPK   +D  LQAN+DYVC QG+D
Sbjct  330  GLFRPDFTPVYDVGIMRNGQSNRPTPPSPTKSKKWCVPKADATDKALQANIDYVCSQGMD  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C  IQ GG CF PN V SHA+Y MN  YQ+ G+N +NCDFSQTA L++++PS+  C Y
Sbjct  390  CKPIQAGGACFSPNNVRSHASYIMNSYYQSHGRNDFNCDFSQTAVLTTSDPSHGTCKY  447



>ref|XP_010106478.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC10654.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=489

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 114/185 (62%), Gaps = 9/185 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA +Y GNL+ H+ S  GTPLMP ++ +TY+F+L++E LKP  TSER++
Sbjct  269  GDPNQPDVNLENALSYNGNLVKHVSSGKGTPLMPNRTFETYIFSLFNENLKPS-TSERNY  327

Query  653  GLFRPDLTMTFDAGLs--------ktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            GLF+PDLT  +D  +                         WCVP+   SD  LQ N+DYV
Sbjct  328  GLFKPDLTPVYDVSVLRNDQALGPTADVAQAPKAVDTRRKWCVPRSDASDEALQKNIDYV  387

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C  G+DC  IQ GGPCF+PNTV SHA+YAMN  YQ  G   +NCDF  T  ++ T+PSY 
Sbjct  388  CSAGVDCKPIQSGGPCFDPNTVRSHASYAMNAYYQAFGPQDYNCDFGHTGVITDTDPSYQ  447

Query  317  GCTYP  303
             CTYP
Sbjct  448  ACTYP  452



>gb|ERM95173.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
Length=468

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  ++G S+ NA AY GNLI H+ S +GTPLMP ++ +TY+F+L++E LK GPT+ER+F
Sbjct  275  GDPGQIGVSVANAAAYNGNLIRHVNSGIGTPLMPNQTFETYIFSLFNENLKLGPTAERNF  334

Query  653  GLFRPDLTMTFDAGLsktvtpt-----------pvtpspkSGAWCVPKEGVSDAQLQANL  507
            GLFRPD    +D G+ ++                         WC+PK       LQ N+
Sbjct  335  GLFRPDFVPAYDIGILRSEARMPAPINPTPLAPINQVPTNMKQWCLPKANADPRALQENI  394

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DY CGQG+DC  IQ GG CF PNT+ +HAAYAMN  YQ+AG++ ++CDF QT  +S+ +P
Sbjct  395  DYACGQGLDCRPIQIGGACFLPNTIQAHAAYAMNAYYQSAGRHAYDCDFKQTGAISTVDP  454

Query  326  S  324
            S
Sbjct  455  S  455



>ref|XP_012075168.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Jatropha curcas]
Length=466

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 118/193 (61%), Gaps = 16/193 (8%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
             GDS++VG + E+A  Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKPGP  ER+
Sbjct  274  NGDSSQVGVNAESAAQYNGNLIQHVMSGSGTPLMPNRTFETYIFALFNENLKPGPACERN  333

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspk----------------SGAWCVPKEGVSDA  525
            FGLF  D+T  ++ G+ ++   + +                        WC+PK G    
Sbjct  334  FGLFEADMTPVYNIGILRSTASSSIPRHRSPVPVAAPRSSAPAGPPGKRWCLPKTGADVE  393

Query  524  QLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTAT  345
             LQ N+DYVCG G+DC  I+ GG CF PNTV +HAA+AMN  YQ  GKN ++CDF QT  
Sbjct  394  ALQRNIDYVCGMGVDCGPIKSGGECFMPNTVRAHAAFAMNAYYQAMGKNDYDCDFEQTGA  453

Query  344  LSSTNPSYDGCTY  306
            +SS +PSY  C Y
Sbjct  454  ISSLDPSYGNCKY  466



>gb|ACJ84511.1| unknown [Medicago truncatula]
Length=407

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
             GD+ EVGPS+ENAKAY GNLITHLRSLVGTPL+P KSVDTY+FALYDE LKPGP SER+
Sbjct  272  SGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGSERA  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA------WCVPKEGVSDAQLQANLDYVC  495
            FGLF+ DL+M++D GL+K+    P + SP + A      WCVPK GVSDAQLQ N+DY C
Sbjct  332  FGLFKTDLSMSYDIGLAKSSQQNPPSTSPVTPAPITSAGWCVPKAGVSDAQLQNNIDYAC  391

Query  494  GQGIDCSAIQPGGPCF  447
             QGIDC  I PGG CF
Sbjct  392  SQGIDCGPILPGGACF  407



>gb|KHG22731.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=465

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 117/192 (61%), Gaps = 16/192 (8%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDS +VG     A  Y GNL  H+ S  GTPLMP ++ +TY+FAL++E LKPGPTSER+F
Sbjct  274  GDSPQVGVDANVASEYNGNLKRHVSSGAGTPLMPNRTFETYIFALFNEDLKPGPTSERNF  333

Query  653  GLFRPDLTMTFDAGLsktvtptp----------------vtpspkSGAWCVPKEGVSDAQ  522
            GLF+PD+T  +D G+ +    +                    S K   WC+PK G  D  
Sbjct  334  GLFQPDMTPVYDIGILRPTARSSIPNNPTPVPRVAPSNPTPRSSKRKQWCLPKTGADDNA  393

Query  521  LQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATL  342
            LQ N+DYVCG G+DC  IQ  G CF PNTV +HAA+AMNL YQ+ G N  +CDF QT  +
Sbjct  394  LQRNIDYVCGLGLDCGPIQQHGACFLPNTVRAHAAFAMNLYYQSTGNNDSDCDFDQTGAI  453

Query  341  SSTNPSYDGCTY  306
            ++ +PSY  C Y
Sbjct  454  TNVDPSYGKCQY  465



>ref|XP_006653891.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=415

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 116/177 (66%), Gaps = 1/177 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  EVG     A+ Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP SER+F
Sbjct  238  GEYWEVGAGAVLARDYNKNAIRHLGSGVGTPLMPNRTFELSIFSLFDENLKPGPVSERNF  297

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQG-IDC  477
            GL+  D+T  +DAG+           +P    WCVPK    +  LQ N+D+VCGQG IDC
Sbjct  298  GLYHADMTPVYDAGILTVPQEVAPAAAPAPRRWCVPKPAADEVALQVNIDFVCGQGGIDC  357

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
             AI+PGG CF+PN V +HAAYAMNL +Q+ G++ ++CDF +T  +++ +PSY  C +
Sbjct  358  GAIRPGGACFDPNNVQAHAAYAMNLYFQSNGQHAFDCDFGETGVVTTVDPSYASCKF  414



>ref|XP_002312097.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
 gb|EEE89464.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
Length=448

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA +Y  N+I  + S  GTPLMP++   TY+F+L++E LKPG T+ER++
Sbjct  270  GDPNQPMCTVENAVSYNKNMIKVVTSGNGTPLMPKRRFQTYVFSLFNENLKPGSTAERNW  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvt--pspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLFRP+ T  +D G+ +    +  T     KS  WCVPK   +D  LQAN+DYVC QG+D
Sbjct  330  GLFRPEFTPVYDVGIMRNGQSSRPTPPSPTKSKKWCVPKADATDKALQANIDYVCSQGMD  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C  IQ GG CF PN + SHA+Y MN  YQ+ G N +NCDFSQTA L++++PS+  C Y
Sbjct  390  CKPIQAGGACFSPNNIRSHASYIMNSYYQSHGSNDFNCDFSQTAVLTTSDPSHGTCKY  447



>ref|XP_009345986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 118/208 (57%), Gaps = 32/208 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD T+   +++NA +Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKP   SE+++
Sbjct  271  GDPTQSDATVDNAASYNGNLIKHVSSDKGTPLMPNRTFETYVFALFNENLKPS-KSEQNY  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+PD    +D G+ +         S  +G                             
Sbjct  330  GLFKPDFNPVYDVGILRNQRAAAPKSSVAAGPNSGVAAGPKSGVAEGPASGGAQAPSPSA  389

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
               WCVP+   SDA LQ N+D+VC  G+DC  IQ GGPCF+PNTV SHAAY MN  YQ  
Sbjct  390  GKTWCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQAN  449

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYP  303
            G    NCDF  T  +++T+PSYD CTYP
Sbjct  450  GPQDSNCDFKHTGVVTTTDPSYDACTYP  477



>ref|XP_010043555.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW85569.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=501

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 122/196 (62%), Gaps = 16/196 (8%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ +   ++ NA +Y GNL+ H  +  GTPLMP +  +TY+FAL++E LKP  TSER++
Sbjct  269  GDANQPDVNMANAVSYNGNLVRHANAGKGTPLMPNRKFETYVFALFNEDLKPS-TSERNY  327

Query  653  GLFRPDLTMTFDAGLs---------------ktvtptpvtpspkSGAWCVPKEGVSDAQL  519
            GLF+PDLT  +D G+                         P+     WCVP+   SD  L
Sbjct  328  GLFKPDLTPVYDVGILRNEPAGGPTPASPSPTAQPSPTAPPTSSGKKWCVPRSDASDQAL  387

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            QAN+DYVC   +DC  IQ GG CF+PNTV SHAAYAMN  YQ+ G++ ++CDF +T  ++
Sbjct  388  QANIDYVCSAQVDCKPIQTGGACFDPNTVRSHAAYAMNAYYQSMGQHDYDCDFDKTGVVT  447

Query  338  STNPSYDGCTYPSGST  291
            + +PSY+ CTYP G++
Sbjct  448  AVDPSYETCTYPEGAS  463



>ref|XP_009345982.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 118/208 (57%), Gaps = 32/208 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD T+   +++NA +Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKP   SE+++
Sbjct  271  GDPTQSDATVDNAASYNGNLIKHVSSDKGTPLMPNRTFETYVFALFNENLKPS-KSEQNY  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+PD    +D G+ +         S  +G                             
Sbjct  330  GLFKPDFNPVYDVGILRNQRAAAPKSSVAAGPNPGVAAGPKSGVAEGPASGGAQAPSPSA  389

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
               WCVP+   SDA LQ N+D+VC  G+DC  IQ GGPCF+PNTV SHAAY MN  YQ  
Sbjct  390  GKTWCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQAN  449

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYP  303
            G    NCDF  T  +++T+PSYD CTYP
Sbjct  450  GPQDSNCDFKHTGVVTTTDPSYDACTYP  477



>gb|KJB37375.1| hypothetical protein B456_006G202300 [Gossypium raimondii]
Length=509

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 117/192 (61%), Gaps = 16/192 (8%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDST+VG     A  Y GNL  H+ S  GTPLMP ++ +TY+FAL++E LKPGPTSER+F
Sbjct  318  GDSTQVGVDANVASEYNGNLKRHVSSGAGTPLMPNRTFETYIFALFNEDLKPGPTSERNF  377

Query  653  GLFRPDLTMTFDAGLsktvtptp----------------vtpspkSGAWCVPKEGVSDAQ  522
            GLF+PD+T  +D G+ +    +                    S K   WC+PK G  D  
Sbjct  378  GLFQPDMTPVYDIGILRPTARSSIPNNPTPVPRAAPSNPTPRSSKGKQWCLPKTGADDNA  437

Query  521  LQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATL  342
            LQ N+DYVCG G+DC  IQ  G CF PNTV +HAA+AMNL YQ+ G N  +C F QT  +
Sbjct  438  LQRNIDYVCGLGLDCGPIQQHGACFLPNTVRAHAAFAMNLYYQSTGNNDSDCGFDQTGAI  497

Query  341  SSTNPSYDGCTY  306
            ++ +PSY  C Y
Sbjct  498  TNVDPSYGKCQY  509



>tpg|DAA35302.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=450

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  EVG   + A+ Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP SER+F
Sbjct  272  GEDWEVGVGADLARDYNSNAIRHLGSGVGTPLMPNRTFEVSIFSLFDENLKPGPVSERNF  331

Query  653  GLFRPDLTMTFDAGLsktvtptp-vtpspkSGAWCVPKEGVSDAQLQANLDYVCGQ-GID  480
            GLFR D+T  +D G+         V     S  WCVP+    +  LQ N+D+ CGQ G+D
Sbjct  332  GLFRGDMTPVYDVGIFTDPETLEPVRAKVTSRKWCVPEPAADEMVLQENIDFACGQKGVD  391

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C+AI+PGG C+EP+TV +HAAYAMNL +Q  G++ ++CDF QT  +++ +PSY GC +
Sbjct  392  CTAIRPGGVCYEPDTVQAHAAYAMNLYFQANGQHAFDCDFGQTGIVTTADPSYGGCKF  449



>gb|ABK95730.1| unknown [Populus trichocarpa]
Length=448

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ENA +Y  N+I  + S  GTPLMP++   TY+F+L +E LKPG T+ER++
Sbjct  270  GDPNQPMCTVENAVSYNKNMIKVVTSGNGTPLMPKRRFQTYVFSLSNENLKPGSTAERNW  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvt--pspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLFRP+ T  +D G+ +    +  T     KS  WCVPK   +D  LQAN+DYVC QG+D
Sbjct  330  GLFRPEFTPVYDVGIMRNGQSSRPTPPSPTKSKKWCVPKADATDKALQANIDYVCSQGMD  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C  IQ GG CF PN + SHA+Y MN  YQ+ G N +NCDFSQTA L++++PS+  C Y
Sbjct  390  CKPIQAGGACFSPNNIRSHASYIMNSYYQSHGSNDFNCDFSQTAVLTTSDPSHGTCKY  447



>ref|XP_009353665.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 118/208 (57%), Gaps = 32/208 (15%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD T+   +++NA +Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKP   SE+++
Sbjct  271  GDPTQSDATVDNAASYNGNLIKHVSSGKGTPLMPNRTFETYVFALFNENLKPS-KSEQNY  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------------  561
            GLF+PD    +D G+ +         S  +G                             
Sbjct  330  GLFKPDFNPVYDVGILRNQRAAAPKSSVAAGPKSGVAAGPKSGVAEGPASGGAQAPSPSA  389

Query  560  --AWCVPKEGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTA  387
               WCVP+   SDA LQ N+D+VC  G+DC  IQ GGPCF+PNTV SHAAY MN  YQ  
Sbjct  390  GKTWCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQAN  449

Query  386  GKNPWNCDFSQTATLSSTNPSYDGCTYP  303
            G    NCDF  T  +++T+PSYD CTYP
Sbjct  450  GPQDSNCDFKHTGVVTTTDPSYDACTYP  477



>ref|XP_010048931.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW89128.1| hypothetical protein EUGRSUZ_A01445 [Eucalyptus grandis]
Length=476

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 118/194 (61%), Gaps = 19/194 (10%)
 Frame = -3

Query  830  DSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFG  651
            DST+VG   + A  Y  NLI H+ S  GTPLMP+++ +TY+FAL++E LKPGPT ER+FG
Sbjct  281  DSTQVGVDAKTAAEYNSNLIRHVSSGAGTPLMPKRTFETYIFALFNENLKPGPTCERNFG  340

Query  650  LFRPDLTMTFDAGLsktvtptpvtpspkSG-------------------AWCVPKEGVSD  528
            LFRPD+T  +DAG+ +    + V   P                       WC+PK G   
Sbjct  341  LFRPDMTPVYDAGILRPTARSSVPIDPIPAPSSVTPPTSPVSMSPPKGTQWCLPKTGADP  400

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
              LQ N+DYVCG G++C  I+ GG CF PNTV +HAAYAMN  YQ  G N ++CDF  T 
Sbjct  401  DALQRNIDYVCGLGLECRPIEEGGACFLPNTVRAHAAYAMNAYYQAMGGNNYDCDFKGTG  460

Query  347  TLSSTNPSYDGCTY  306
             +++ +PSY  CTY
Sbjct  461  AVTAIDPSYGKCTY  474



>ref|XP_002298356.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE83161.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=457

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 14/191 (7%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TY+F+L++E LKP   SER+F
Sbjct  268  GDPNQPGVSMENAISYNKNLVKHVNSGKGTPLMPNRTFETYVFSLFNENLKPS-VSERNF  326

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----------WCVPKEGVSDAQLQANL  507
            GLF+PDLT  +D G+ +       TP   + A           WCVPK   SD  LQ N+
Sbjct  327  GLFKPDLTPVYDVGILRDDKALAPTPGTAADAPSSSSPGRQRQWCVPKSDASDDALQKNI  386

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DYVC  G+DC  IQ GGPCF P+TV SHA+YAMN  YQ +G++ ++CDFS T  L+S +P
Sbjct  387  DYVCSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDYDCDFSHTGVLTSIDP  446

Query  326  SYDGCTYPSGS  294
            S    ++PS S
Sbjct  447  S--KLSWPSSS  455



>ref|XP_009405069.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 18/194 (9%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
             D+ + G S  +A AY GNLI H+ S  GTPLMP ++++TY+FAL++E LKPGP +ER+F
Sbjct  277  ADNNQFGVSPADALAYNGNLIKHVNSGRGTPLMPNRTIETYIFALFNEDLKPGPLAERNF  336

Query  653  GLFRPDLTMTFDAGLskt-----------------vtptpvtpspkSGAWCVPKEGVSDA  525
            GLF+PDLT  +D+G+ +T                               WCVPK    DA
Sbjct  337  GLFKPDLTPLYDSGVMQTGPGGEAGRSHRKRGRGRGRGRGRAGRGMGNKWCVPKSDAGDA  396

Query  524  QLQANLDYVCGQG-IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
             LQAN++YVC  G +DC  IQ GG CF PN++ SHAAYAMN  Y+ AG++ ++CDFS +A
Sbjct  397  ALQANINYVCSSGRVDCKPIQDGGACFSPNSLHSHAAYAMNAFYKAAGQHEFDCDFSGSA  456

Query  347  TLSSTNPSYDGCTY  306
             +++T+PSY  C Y
Sbjct  457  IITTTDPSYGTCKY  470



>ref|XP_006350772.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=448

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 117/178 (66%), Gaps = 3/178 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  ++G S+ENA +Y  NL+ H+ S VGTPLMP ++ +TY+FAL++E LKP  TSER+F
Sbjct  270  GDPNQLGVSLENAISYNVNLVKHVNSGVGTPLMPNRTFETYVFALFNEDLKPS-TSERNF  328

Query  653  GLFRPDLTMTFDAGLsktvtptp--vtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLFRPD +  +D G+ +    +         S  WCVP    SDA LQ+N+D+VC  GID
Sbjct  329  GLFRPDFSPVYDVGILRNTQASSPPAMAPEVSKKWCVPTTDASDAALQSNIDFVCSSGID  388

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C  I+ GGPC+EPNT+ +HA+YAMN  YQ  G    +C F  T  +++ +PSY+ C Y
Sbjct  389  CQPIKDGGPCYEPNTIRAHASYAMNAYYQANGGKDLDCSFINTGVVTNYDPSYEECRY  446



>ref|XP_012075957.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Jatropha 
curcas]
Length=506

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 122/197 (62%), Gaps = 21/197 (11%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S  GTPLMP ++ +TYLFAL++E LKP   SER+F
Sbjct  268  GDPNQPGVSLENAVSYNANLVKHVNSGKGTPLMPNRTFETYLFALFNENLKPT-ISERNF  326

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA--------WCVPKEGVSDAQLQANLDYV  498
            GLF+PDL+  +D G+ +       T +  + A        WCVPK    D  LQ N+DYV
Sbjct  327  GLFKPDLSPVYDVGVLRNGQAHGPTAATTAAAPSSSLDRRWCVPKSDAGDEALQKNIDYV  386

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS--  324
            C   +DC AIQ GGPCF+PNTV SHA+YAMN  YQT G++ +NCDF+ +  L++ NP+  
Sbjct  387  CSNRVDCRAIQAGGPCFDPNTVRSHASYAMNAYYQTFGRHDYNCDFNGSGVLTTVNPNIL  446

Query  323  ----------YDGCTYP  303
                      Y+ C YP
Sbjct  447  TKKTRWVVAGYEACNYP  463



>ref|XP_010937626.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=450

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 120/185 (65%), Gaps = 7/185 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   S+ENA +Y GNLI ++ S  GTPLMP ++ +TY+FAL++E LKPGPT+ER+F
Sbjct  266  GDPDQPAVSLENAVSYNGNLIRNVNSGKGTPLMPNRTFETYIFALFNEDLKPGPTAERNF  325

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA------WCVPKEGVSDAQLQANLDYVCG  492
            GLF+PDL   +D GL +        P+    +      WCV K   S   LQAN+DY CG
Sbjct  326  GLFKPDLAQVYDVGLMRGGQFAGGGPAAAPSSSGPPEKWCVAKADASAEVLQANIDYSCG  385

Query  491  QG-IDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDG  315
             G +DC  IQ GG C+ P+T+ +HA++AMN  YQ AG++ +NCDF+ T  L++ NPSY  
Sbjct  386  SGLVDCGPIQAGGACYLPDTLVAHASFAMNAYYQAAGRHDFNCDFAHTGVLTTDNPSYQN  445

Query  314  CTYPS  300
            C Y S
Sbjct  446  CKYSS  450



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 121/184 (66%), Gaps = 9/184 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA ++ GNL+ H+ S  GTPLMP ++ +TY+F+L++E LK    SER+F
Sbjct  271  GDPGQPGVSLENALSFNGNLVKHVNSGKGTPLMPNRTFETYIFSLFNENLKES-VSERNF  329

Query  653  GLFRPDLTMTFDAGLsktvtp--------tpvtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            GLF+PDLT  ++ G+ +            T   PS  SG WCVPK   + A LQAN+DYV
Sbjct  330  GLFKPDLTPVYNVGVLRNEQGLGPASAPPTATAPSSGSGKWCVPKSDATVAALQANIDYV  389

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C  G+DC  IQ GG CF PN V SHA+YAMN  YQ  G++ +NCDF+ T  ++ST+PS++
Sbjct  390  CSTGLDCRPIQAGGACFNPNNVRSHASYAMNAYYQANGRHDFNCDFNHTGVITSTDPSHE  449

Query  317  GCTY  306
             C Y
Sbjct  450  ACNY  453



>gb|KFK33989.1| hypothetical protein AALP_AA5G087500 [Arabis alpina]
Length=440

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  + G  ++ AK Y GNLI H+ S  GTPLMP +  +TY+F+L++E LKP   SE++F
Sbjct  271  GEPNQTGVGLDYAKVYNGNLIKHVNSGKGTPLMPNRVFETYIFSLFNENLKPS-VSEQNF  329

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDCS  474
            GLF+PD T  +D G+ KT     +      G WCVP+   SD  LQ N+DYVC  G+DC 
Sbjct  330  GLFKPDFTPVYDVGIMKTDQVMSL------GKWCVPRSEASDEALQRNIDYVCSVGVDCV  383

Query  473  AIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
             I  GGPCF P+TV SHA+Y+MNL Y+T G   ++CD + T  +++ NPSYD C+Y
Sbjct  384  PISYGGPCFSPDTVRSHASYSMNLYYRTFGMFDYDCDLNLTGIITTVNPSYDACSY  439



>ref|NP_001151529.1| LOC100285163 precursor [Zea mays]
 gb|ACG43184.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
Length=450

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  EVG   + A+ Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP SER+F
Sbjct  272  GEDWEVGVGADLARDYNINAIRHLGSGVGTPLMPNRTFEVSIFSLFDENLKPGPVSERNF  331

Query  653  GLFRPDLTMTFDAGLsktvtptp-vtpspkSGAWCVPKEGVSDAQLQANLDYVCGQ-GID  480
            GLFR D+T  +D G+         V     S  WCVP+    +  LQ N+D+ CGQ G+D
Sbjct  332  GLFRGDMTPVYDVGIFTDPETLEPVRAKVTSRKWCVPEPAADEMVLQENIDFACGQKGVD  391

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            C+AI+PGG C+EP+TV +HAAYAMNL +Q  G++ ++CDF QT  +++ +PSY GC +
Sbjct  392  CTAIRPGGVCYEPDTVQAHAAYAMNLYFQANGQHAFDCDFGQTGIVTTADPSYGGCKF  449



>ref|XP_006488330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Citrus 
sinensis]
Length=502

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 118/192 (61%), Gaps = 17/192 (9%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ NA +Y GNL+ H+ S  GTPLMP ++ + Y+FAL++E LKP   SE++F
Sbjct  273  GDPNQPESNLANALSYNGNLVKHVNSGKGTPLMPNRTFEVYIFALFNENLKPS-ISEQNF  331

Query  653  GLFRPDLTMTFDAGLsktvt-----------ptpvtpspkSGA-----WCVPKEGVSDAQ  522
            GLF+PD T  +D G+ +                     P SGA     WCVPK   SDA 
Sbjct  332  GLFKPDFTPVYDVGILRNKQGPAKAPGGRPPTEAPVAKPPSGAVTGRKWCVPKSDASDAA  391

Query  521  LQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATL  342
            LQAN+DYVCG G+DC  IQ GGPCF PN V SHAAYAMN  YQ  G + + CDF++T  L
Sbjct  392  LQANIDYVCGTGVDCKPIQAGGPCFNPNNVRSHAAYAMNAFYQANGLHDYACDFNKTGVL  451

Query  341  SSTNPSYDGCTY  306
            +S +PSY+ C Y
Sbjct  452  TSADPSYEACDY  463



>ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=449

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y  NL+ H+ S VGTPLMP ++ +TY+F+L++E LKP  TSER+F
Sbjct  270  GDPNQPGVSLENAISYNVNLVKHVNSGVGTPLMPNRTFETYVFSLFNEDLKPS-TSERNF  328

Query  653  GLFRPDLTMTFDAGLsktvtptp--vtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGI-  483
            GLFRPD +  +D G+ +              S  WCVPK   SDA LQ+NLD+VC  GI 
Sbjct  329  GLFRPDFSPVYDVGILRNTQALSPPAMAPEVSKKWCVPKTDASDAALQSNLDFVCSSGIV  388

Query  482  DCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            DC  I+ GGPCFEPNTV +HAAYAMN  YQ  G    +C+F  T  +++ +PSY+ C Y
Sbjct  389  DCQPIKDGGPCFEPNTVRAHAAYAMNAYYQANGGKDLDCNFINTGVVTNYDPSYEECKY  447



>ref|XP_010940752.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=462

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 118/187 (63%), Gaps = 9/187 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD+ EVG  +++A+ Y  NL+ H+ S +GTPLMP ++ +TY+F+L++E LKPGP SER+F
Sbjct  276  GDAGEVGVDMDSARDYNKNLMRHVASGMGTPLMPNRTFETYIFSLFNEDLKPGPMSERNF  335

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspk---------SGAWCVPKEGVSDAQLQANLDY  501
            GLF P++   +D G+  T     V P               WCVPK       LQ N++Y
Sbjct  336  GLFHPNMMPVYDIGILTTEVRKQVNPVVTPANIPMPSDVKRWCVPKPNADVMALQENIEY  395

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
             C QGIDC+ IQPGG C+ PNT  +HAAY MN  YQ+ G+N ++CDF +T  +S+ +PSY
Sbjct  396  GCAQGIDCNPIQPGGACYHPNTAQAHAAYVMNEYYQSFGRNSFDCDFGRTGVISTIDPSY  455

Query  320  DGCTYPS  300
              C Y S
Sbjct  456  GNCMYRS  462



>ref|XP_003622030.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES78248.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=448

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 113/176 (64%), Gaps = 10/176 (6%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ NA++Y G LI HL +  GTPLMP +  +T+LFAL++E  KPGP +ER++GLFRPD +
Sbjct  271  SVANAQSYNGELIRHLEAGRGTPLMPNRRFETFLFALFNENQKPGPIAERNWGLFRPDFS  330

Query  629  MTFDAGLsktvtptpvtp----------spkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
              +D+G+ +                    P  G+WCVPK   S+A LQAN++YVC Q +D
Sbjct  331  PVYDSGILRNAQRPVAPVQPRPVTPVQPRPAIGSWCVPKPDASNAALQANINYVCSQKVD  390

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            C  IQPGG CF  N + + A YAMN  YQ  G++P+NCDFS +  + STNPS+D C
Sbjct  391  CRPIQPGGVCFAANNLRALATYAMNAYYQAMGRHPFNCDFSNSGVIVSTNPSHDNC  446



>emb|CDX87130.1| BnaC09g04450D [Brassica napus]
Length=465

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 9/186 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  ++G  +  A  +   ++  + S  GTPLMP ++ +TY+FAL++E LKPGP SER+
Sbjct  275  KGDRDQIGVDVATAAEFNRKVMDRVNSGTGTPLMPNRTFETYIFALFNENLKPGPISERN  334

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---------WCVPKEGVSDAQLQANLD  504
            FGLFR DLT  +D G+ +    T   P     +         WCV K G     LQ N+D
Sbjct  335  FGLFRSDLTPVYDIGILRPTARTSDPPENNRRSPVGGSSGKRWCVTKSGAETEALQRNID  394

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            YVCG G+DC  I  GGPCF PNTV +H+AYAMNL YQT G++ ++CDF +T  ++S +PS
Sbjct  395  YVCGLGLDCEPIIEGGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPS  454

Query  323  YDGCTY  306
            Y  C Y
Sbjct  455  YGDCQY  460



>ref|XP_007039107.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY23608.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=482

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 119/191 (62%), Gaps = 15/191 (8%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GDST+VG   E+A  Y GNL+ H+ S  GTPLMP ++ +TY+FAL++E LKPGPT ER+F
Sbjct  292  GDSTQVGVDAESAAEYNGNLMRHVASGAGTPLMPNRTFETYIFALFNENLKPGPTCERNF  351

Query  653  GLFRPDLTMTFDAGLsktvtptpv---------------tpspkSGAWCVPKEGVSDAQL  519
            GLF+PD+T  +D G+ +    + +               TP  +   WC+PK G  +  L
Sbjct  352  GLFQPDMTPVYDVGILRPTARSSIPNNPTPVPTAAPVNPTPRSEGKQWCLPKTGADENAL  411

Query  518  QANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLS  339
            Q N+DYVCG G+DC  IQ  G CF PNTV +HAA+AMN  YQ+  +  ++C F QT  ++
Sbjct  412  QRNIDYVCGLGLDCGPIQEDGACFLPNTVRAHAAFAMNAYYQSTDRKEYDCAFEQTGAIT  471

Query  338  STNPSYDGCTY  306
              +PSY  C Y
Sbjct  472  DVDPSYGKCQY  482



>ref|XP_006486487.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=449

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  E   +++NA ++  NLI  + S  GTPLMP K  +TY+FAL++E  KPG TSER+F
Sbjct  270  GDPRESSATVDNAASFNWNLIQKVNSGKGTPLMPNKQFETYIFALFNENKKPGATSERNF  329

Query  653  GLFRPDLTMTFDAG--LsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLF+PD T  +DAG  L+     T   P P    +CVP+   +   LQ NLD+VC QGID
Sbjct  330  GLFKPDFTPVYDAGVMLNGAGAKTQPQPQPTDKKFCVPRPNTNPQSLQGNLDWVCSQGID  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN-CDFSQTATLSSTNPSYDGCTY  306
            C+ IQPGG CFEPNT+ SHA YAMN  Y   G+   N CDF QTA L++ NPSY  C Y
Sbjct  390  CAPIQPGGSCFEPNTLWSHAQYAMNAYYALKGRRDDNDCDFKQTALLTTNNPSYGSCVY  448



>ref|XP_006424832.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
 ref|XP_006488329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Citrus 
sinensis]
 gb|ESR38072.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
Length=504

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 118/194 (61%), Gaps = 19/194 (10%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +   ++ NA +Y GNL+ H+ S  GTPLMP ++ + Y+FAL++E LKP   SE++F
Sbjct  273  GDPNQPESNLANALSYNGNLVKHVNSGKGTPLMPNRTFEVYIFALFNENLKPS-ISEQNF  331

Query  653  GLFRPDLTMTFDAGLsktvtpt-------------pvtpspkSGA-----WCVPKEGVSD  528
            GLF+PD T  +D G+ +                       P SGA     WCVPK   SD
Sbjct  332  GLFKPDFTPVYDVGILRNKQAQGPAKAPGGRPPTEAPVAKPPSGAVTGRKWCVPKSDASD  391

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
            A LQAN+DYVCG G+DC  IQ GGPCF PN V SHAAYAMN  YQ  G + + CDF++T 
Sbjct  392  AALQANIDYVCGTGVDCKPIQAGGPCFNPNNVRSHAAYAMNAFYQANGLHDYACDFNKTG  451

Query  347  TLSSTNPSYDGCTY  306
             L+S +PSY+ C Y
Sbjct  452  VLTSADPSYEACDY  465



>ref|XP_006435532.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
 gb|ESR48772.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
Length=449

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  E   +++NA ++  NLI  + S  GTPLMP K  +TY+FAL++E  KPG TSER+F
Sbjct  270  GDPRESSATVDNAASFNWNLIQKVNSGKGTPLMPNKQFETYIFALFNENQKPGATSERNF  329

Query  653  GLFRPDLTMTFDAG--LsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLF+PD T  +DAG  L+     T   P P    +CVP+   +   LQ NLD+VC QGID
Sbjct  330  GLFKPDFTPVYDAGVMLNGAGAKTQPQPQPTDKKFCVPRPNTNPQSLQGNLDWVCSQGID  389

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN-CDFSQTATLSSTNPSYDGCTY  306
            C+ IQPGG CFEPNT+ SHA YAMN  Y   G+   N CDF QTA L++ NPSY  C Y
Sbjct  390  CAPIQPGGSCFEPNTLWSHAQYAMNAYYALKGRRDDNDCDFKQTALLTTNNPSYGSCVY  448



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 114/192 (59%), Gaps = 15/192 (8%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD+ +VG   + A  Y   L+ H+ S VGTPLMP ++ +TY+FAL++E LKPGPT ER+
Sbjct  268  KGDAGQVGVDADTAAEYNRKLMQHVTSGVGTPLMPNRTFETYIFALFNEDLKPGPTCERN  327

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---------------WCVPKEGVSDAQ  522
            FGLF+PD+T  +D G+ +          P   A               WC+PK G  +  
Sbjct  328  FGLFQPDMTPVYDIGILRPTAKANFPSYPTPQAVPVNPSPIPASGAKRWCLPKTGAKEDT  387

Query  521  LQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATL  342
            LQ NLDYVCG G+DC  IQ GG C+ PNTV  HAAYAMN  YQ  G+N + CDF  T  +
Sbjct  388  LQKNLDYVCGLGMDCKPIQEGGACYLPNTVRGHAAYAMNAYYQATGRNDYACDFGGTGAI  447

Query  341  SSTNPSYDGCTY  306
            +  +PSY  C Y
Sbjct  448  TKLDPSYGSCKY  459



>ref|XP_006491986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
 gb|KDO59627.1| hypothetical protein CISIN_1g043079mg [Citrus sinensis]
Length=460

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 12/189 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGDS++VG   ++A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++E LK GPT ER+
Sbjct  272  KGDSSQVGVDSQSAADYNMNLMRHVTSGNGTPLMPNRTFETYIFALFNEDLKQGPTCERN  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS------------GAWCVPKEGVSDAQLQA  513
            FGLF P++T  +D G+ ++   + +  S  +              WCVPK G     LQ 
Sbjct  332  FGLFHPNMTPVYDVGILRSTARSSIPTSNPTPKVETPQRAPEGKRWCVPKTGADIEALQR  391

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            N+DYVCG G +C AIQ GG CF PNTV +HAAYAMN+ YQ  G++ + CDF QT  ++  
Sbjct  392  NIDYVCGMGFNCEAIQEGGSCFLPNTVRAHAAYAMNVYYQAMGRHDYACDFIQTGAVTDL  451

Query  332  NPSYDGCTY  306
            +PSY  C Y
Sbjct  452  DPSYGKCKY  460



>ref|XP_010034118.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW50205.1| hypothetical protein EUGRSUZ_J00013 [Eucalyptus grandis]
Length=451

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 114/187 (61%), Gaps = 11/187 (6%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G   E  P++ NA +Y G L+ H+ S  GTPLMP + ++TY+FAL++E  KPGP +ER+F
Sbjct  264  GGPGEPAPTLANAVSYNGKLLKHVNSRRGTPLMPNRRIETYIFALFNENQKPGPIAERNF  323

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----------WCVPKEGVSDAQLQANL  507
            GLF PD T  +  G+ ++          + G            WCV K+GVSD  +QAN+
Sbjct  324  GLFWPDFTPVYKIGILRSERHRRGRRGGRGGHRRAPRPGGGKRWCVLKQGVSDQAVQANI  383

Query  506  DYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNP  327
            DYVC  G+DC  IQ GG CF+PN V + A+Y MN  YQT G+ P NCDFS +  L+S NP
Sbjct  384  DYVCSTGVDCRPIQSGGACFDPNNVRARASYIMNSYYQTKGRQPSNCDFSGSGVLTSVNP  443

Query  326  SYDGCTY  306
            S+  C Y
Sbjct  444  SHGACIY  450



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  821  EVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFR  642
            + G S+E+A  + GNLI ++ S  GTPLMP +  +TY+FAL++E LKPGP +ER++GLFR
Sbjct  271  QAGVSVEDAATFNGNLIRNVNSGEGTPLMPHRMFETYIFALFNENLKPGPIAERNWGLFR  330

Query  641  PDLTMTFDAGLsktvtptpvtpspkSGA--WCVPKEGVSDAQLQANLDYVCGQGI-DCSA  471
            PDLT  ++ GL KT +      +P      WCVPK   SDA LQAN++Y C  GI DC  
Sbjct  331  PDLTPVYNVGLMKTPSGGGGGATPAPSGRKWCVPKSDASDAALQANINYACSSGIVDCKP  390

Query  470  IQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            IQ GG CF PN++ +HAA+AMN  YQ AG++ +NCDFS +A ++S +PS   C + S
Sbjct  391  IQEGGACFLPNSLRAHAAFAMNAYYQAAGRHNFNCDFSNSAVITSADPSSGSCKFSS  447



>ref|XP_002448791.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
 gb|EES13119.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
Length=464

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 118/189 (62%), Gaps = 13/189 (7%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  EVG   + A+ Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP SER+F
Sbjct  275  GEDWEVGVGADLAREYNKNAIRHLGSGVGTPLMPNRTFEVSIFSLFDENLKPGPVSERNF  334

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA------------WCVPKEGVSDAQLQAN  510
            GLFR D+T  +D G+           +  + A            WCVPK    +  LQ N
Sbjct  335  GLFRGDMTPVYDVGIFTDPETLEPVSAKVTPAPSSPGAAGGRRQWCVPKPAADEMVLQEN  394

Query  509  LDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            +D+ CGQ G+DC+AI+PGG C+EP+TV  HAAYAMNL +Q+ G + ++CDF QT  +++ 
Sbjct  395  IDFACGQEGVDCAAIRPGGVCYEPDTVQGHAAYAMNLYFQSNGHHAYDCDFGQTGVVTTA  454

Query  332  NPSYDGCTY  306
            +PSY GC +
Sbjct  455  DPSYGGCKF  463



>ref|XP_004960035.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Setaria italica]
Length=471

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            G+  EVG   + A+ Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP S+R+F
Sbjct  281  GEDWEVGVGKDLAREYNRNAIRHLGSGVGTPLMPNRTFEVSIFSLFDENLKPGPVSQRNF  340

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-------------WCVPKEGVSDAQLQA  513
            GLFR D+T  +DAG+           +  + A             WCVPK    +  LQ 
Sbjct  341  GLFRGDMTPVYDAGIFTDPEVVEPVSTKVTPAPGQEATPAATGRQWCVPKPAADEMMLQE  400

Query  512  NLDYVCGQ-GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
            N+D+ CGQ GIDC+AI+PGG C EP+TV +HAAYAMNL +Q+ G + +NCDF QT  +++
Sbjct  401  NIDFACGQEGIDCAAIRPGGVCHEPDTVQAHAAYAMNLFFQSNGHHAFNCDFGQTGVVTT  460

Query  335  TNPSYDGCTY  306
             +PSY  C +
Sbjct  461  ADPSYGDCIF  470



>gb|KHF99783.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=510

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 21/196 (11%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LK     ER+F
Sbjct  273  GDPGQPGVSLENALSYNGNLIKHVDSGKGTPLMPNRTFETYIFALFNENLKES-VPERNF  331

Query  653  GLFRPDLTMTFDAGLsktvt--------------------ptpvtpspkSGAWCVPKEGV  534
            GLF+PDL   +D G+ ++                           PS  SG WCV K   
Sbjct  332  GLFKPDLNPVYDVGILRSEQGMGPTSAPTTATAPSAATAPSAGKAPSSGSGKWCVAKSNA  391

Query  533  SDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQ  354
            SDA LQAN+DYVC  G+DC  IQ GG CF PN V SHA+YAMN+ YQ  G++ +NCDF++
Sbjct  392  SDAALQANIDYVCSSGVDCKPIQSGGACFNPNNVRSHASYAMNVYYQANGRHDFNCDFNR  451

Query  353  TATLSSTNPSYDGCTY  306
            T  ++ST+PS+  C Y
Sbjct  452  TGVITSTDPSHAACNY  467



>ref|XP_010685761.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=454

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 115/184 (63%), Gaps = 9/184 (5%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD +E    ++NA +Y  NL+ HL+S  GTPLMP +S DTY+FAL++E LKP  TSE+++
Sbjct  270  GDVSEPYAKLDNAVSYNYNLVKHLKSGKGTPLMPNRSFDTYIFALFNENLKPS-TSEKNY  328

Query  653  GLFRPDLTMTFDAGLsktvtpt--------pvtpspkSGAWCVPKEGVSDAQLQANLDYV  498
            GLFRPD T  +D GL K  T            +PS     WCV K   SD +LQ NLDYV
Sbjct  329  GLFRPDFTAVYDVGLLKEPTQAGGPTTVPVAPSPSDSKQKWCVAKPDASDEKLQGNLDYV  388

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            C  GIDC AIQ GGPCF+PNTV SHA+YAMN  Y   G+    C F  T  + S+NPSY 
Sbjct  389  CSLGIDCKAIQDGGPCFDPNTVRSHASYAMNAYYHINGQLDSACYFDGTGVVVSSNPSYQ  448

Query  317  GCTY  306
             C Y
Sbjct  449  ACEY  452



>ref|XP_009392256.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 119/186 (64%), Gaps = 8/186 (4%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  E+G +++NA+ Y  NL+ H+ S  GTPLMP ++ + Y+F+L++E LKPGP S+R+F
Sbjct  267  GDPRELGINVDNARDYNKNLVQHVSSGTGTPLMPNRTFEAYIFSLFEENLKPGPLSQRNF  326

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkS--------GAWCVPKEGVSDAQLQANLDYV  498
            GLF PDL   +D G+  T      T   ++          WC+PK       LQ N++YV
Sbjct  327  GLFHPDLLPVYDIGVLTTEVGGQATAPVQTLNPTPSDSKRWCIPKPNTDVLLLQQNVEYV  386

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            CGQGIDC+ IQ GG C+ P+TV +HAA+ MN  YQT G+N ++CDF +T  +++ +PSY 
Sbjct  387  CGQGIDCTPIQSGGVCYFPDTVPAHAAFLMNEYYQTFGRNAFDCDFGRTGMITAIDPSYG  446

Query  317  GCTYPS  300
             C Y S
Sbjct  447  SCVYSS  452



>emb|CDY19838.1| BnaA09g04910D [Brassica napus]
Length=467

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 113/186 (61%), Gaps = 9/186 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  ++G  +  A  +   ++  + S  GTPLMP ++ +TY+FAL++E LKPGP SER+
Sbjct  277  KGDKDQIGVDVATAAEFNRKVMDRVNSGTGTPLMPNRTFETYIFALFNENLKPGPVSERN  336

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---------WCVPKEGVSDAQLQANLD  504
            FGLFR DL   +D G+ +        P     +         WCV K G     LQ N+D
Sbjct  337  FGLFRSDLIPVYDIGILRPTVRASDPPENNRRSPVGGSSGKRWCVTKSGAETEALQRNID  396

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            YVCG G+DC  I  GGPCF PNTV +H+AYAMNL YQT G++ ++CDF +T  ++S +PS
Sbjct  397  YVCGLGLDCEPIIEGGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPS  456

Query  323  YDGCTY  306
            Y  C Y
Sbjct  457  YGDCQY  462



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 123/180 (68%), Gaps = 6/180 (3%)
 Frame = -3

Query  821  EVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFR  642
            + G S+E+A  + GNLI ++ S  GTPLMP ++ +TY+FAL++E LKPGP +ER++GLF+
Sbjct  272  QAGVSVEDAATFNGNLIRNVNSGKGTPLMPHRTFETYIFALFNENLKPGPIAERNWGLFQ  331

Query  641  PDLTMTFDAGLsktvt-----ptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGI-D  480
            PDLT  ++ GL+KT +       P      S  WCVPK G S+A LQA+++YVC  GI D
Sbjct  332  PDLTPVYNVGLTKTPSGGRGGAAPAPSVGSSRKWCVPKSGASEAALQADINYVCSSGIVD  391

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTYPS  300
            C  IQ GG CF PNT+ +HAA+AMN  YQ AG++ +NCDFS +A +++ +PS   C   S
Sbjct  392  CKPIQEGGACFLPNTIQAHAAFAMNAYYQAAGRHDFNCDFSNSAVITTADPSLGSCKLSS  451



>ref|XP_009111627.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=470

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 113/186 (61%), Gaps = 9/186 (5%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD  ++G  +  A  +   ++  + S  GTPLMP ++ +TY+FAL++E LKPGP SER+
Sbjct  280  KGDKDQIGVDVATAAEFNRKVMDRVNSGTGTPLMPNRTFETYIFALFNENLKPGPVSERN  339

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---------WCVPKEGVSDAQLQANLD  504
            FGLFR DL   +D G+ +        P     +         WCV K G     LQ N+D
Sbjct  340  FGLFRSDLIPVYDIGILRPTVRASDPPENNRRSPVGGSSGKRWCVTKSGAETEALQRNID  399

Query  503  YVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPS  324
            YVCG G+DC  I  GGPCF PNTV +H+AYAMNL YQT G++ ++CDF +T  ++S +PS
Sbjct  400  YVCGLGLDCEPIIEGGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPS  459

Query  323  YDGCTY  306
            Y  C Y
Sbjct  460  YGDCQY  465



>ref|NP_001275174.1| glucan endo-1,3-beta-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52649.1| beta-1,3-glucanase 14 [Solanum tuberosum]
Length=462

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 125/196 (64%), Gaps = 17/196 (9%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G++ E   ++ENA +Y G L+    S +GTPLMP + ++TY+F+L++E  KPG  +ER+
Sbjct  267  QGETYEPQCTVENAASYNGGLMKKYNSGMGTPLMPHRKIETYIFSLFNENTKPGSIAERN  326

Query  656  FGLFRPDLTMTFDAGLsktvtptpv-----------------tpspkSGAWCVPKEGVSD  528
            FGLFRPD T  +D G+ K     P                      ++  +C+PK G +D
Sbjct  327  FGLFRPDFTPVYDVGVLKAKQAHPTPSLPPPKTGGGGNKGQPKTPAENKKFCMPKVGATD  386

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
            AQLQ+N++YVC QG+DC+ IQ GG CF+PNT+ SHAA+AMN  YQ  G+N +NCDF+ T 
Sbjct  387  AQLQSNINYVCSQGVDCTPIQVGGSCFKPNTIRSHAAFAMNSYYQREGRNNFNCDFAGTG  446

Query  347  TLSSTNPSYDGCTYPS  300
             +++++PSY  C + S
Sbjct  447  VVAASDPSYGTCKFES  462



>gb|KDO69312.1| hypothetical protein CISIN_1g0384522mg, partial [Citrus sinensis]
Length=382

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 114/179 (64%), Gaps = 3/179 (2%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  E   +++NA ++  NLI  + S  GTPLMP K  +TY+FAL++E  KPG TSER+F
Sbjct  203  GDPRESSATVDNAASFNWNLIQKVNSGKGTPLMPNKQFETYIFALFNENKKPGATSERNF  262

Query  653  GLFRPDLTMTFDAG--LsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGID  480
            GLF+ D T  +DAG  L+     T   P P    +CVP+   +   LQ NLD+VC QGID
Sbjct  263  GLFKQDFTPVYDAGVMLNGAGAKTQPQPQPTDKKFCVPRPNTNPQSLQGNLDWVCSQGID  322

Query  479  CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWN-CDFSQTATLSSTNPSYDGCTY  306
            C+ IQPGG CFEPNT+ SHA YAMN  Y   G+   N CDF QTA L++ NPSY  C Y
Sbjct  323  CAPIQPGGSCFEPNTLWSHAQYAMNAYYALKGRRDDNDCDFKQTALLTTNNPSYGSCVY  381



>ref|XP_009593199.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=464

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 19/198 (10%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G+S E   ++ENA +Y G L+    S  GTPLMP + ++TY+F L++E  KPG T+ER+
Sbjct  267  QGESFEPQCTVENAASYNGGLLRKYNSGTGTPLMPHRKIETYIFGLFNENTKPGSTAERN  326

Query  656  FGLFRPDLTMTFDAGLsktvtpt-------------------pvtpspkSGAWCVPKEGV  534
            FGLFRPD T  ++ G+ K                              +S  +C+PK   
Sbjct  327  FGLFRPDFTPVYNIGVLKGEQAQPTPALPAPRNGSGNNGQPTSPVRPAESKKFCMPKAEA  386

Query  533  SDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQ  354
            +DAQLQ+N++YVC QG+DC+ IQ GGPCF PNT+ SHAA+AMN  YQ  G+N +NCDF+ 
Sbjct  387  TDAQLQSNINYVCSQGVDCTPIQAGGPCFNPNTIRSHAAFAMNSYYQREGRNQFNCDFAG  446

Query  353  TATLSSTNPSYDGCTYPS  300
            T  ++S +PSY  C + S
Sbjct  447  TGVVASADPSYGTCKFQS  464



>ref|XP_006441150.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
 gb|ESR54390.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
Length=460

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 118/189 (62%), Gaps = 12/189 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGDS++VG   ++A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++E LK GPT ER+
Sbjct  272  KGDSSQVGVDSQSAADYNMNLMRHVTSCNGTPLMPNRTFETYIFALFNEDLKQGPTCERN  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkS------------GAWCVPKEGVSDAQLQA  513
            FGLF P++T  +D G+ ++   + +  S  +              WCVPK       LQ 
Sbjct  332  FGLFHPNMTPVYDVGILRSTARSSIPTSNPTPKVETPQRAPEGKRWCVPKTRADIEALQR  391

Query  512  NLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSST  333
            N+DYVCG G +C AIQ GG CF PNTV +HAAYAMN+ YQ  G++ + CDF QT  ++  
Sbjct  392  NIDYVCGMGFNCEAIQEGGSCFLPNTVRAHAAYAMNVYYQAMGRHDYACDFIQTGAVTDL  451

Query  332  NPSYDGCTY  306
            +PSY  C Y
Sbjct  452  DPSYGKCKY  460



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 112/193 (58%), Gaps = 17/193 (9%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  +VG + E+A  Y GNL  H+ S VGTPLMP ++ +TY+FAL++E LKPGP  ER+F
Sbjct  266  GDEGQVGVNAESAAEYNGNLREHVMSGVGTPLMPNRTFETYIFALFNENLKPGPLCERNF  325

Query  653  GLFRPDLTMTFDAGLsktvtptp-----------------vtpspkSGAWCVPKEGVSDA  525
            GLF+PDLT  +D G+ +                                WC+P       
Sbjct  326  GLFQPDLTPVYDIGIMRPTARASIPWNPAPAAAPQLGPAPQQHPKGGKQWCLPTSDAHSD  385

Query  524  QLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTAT  345
             LQ N+DYVCG G+DC  IQ GG CF P+TV +HAAYAMN  YQT G + ++CDF QT  
Sbjct  386  ALQKNIDYVCGLGLDCKPIQEGGACFIPDTVRAHAAYAMNAYYQTTGGSEYDCDFEQTGA  445

Query  344  LSSTNPSYDGCTY  306
            L+  +PSY  C Y
Sbjct  446  LTDVDPSYGRCKY  458



>ref|XP_009789910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=463

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 19/198 (10%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G+S E   ++ENA +Y G L+    S  GTPLMP + ++TY+F L++E  KPG  +ER+
Sbjct  266  QGESFEPQCTVENAASYNGGLLRKYNSGTGTPLMPHRKIETYIFGLFNENTKPGSIAERN  325

Query  656  FGLFRPDLTMTFDAGLsktvtpt-------------------pvtpspkSGAWCVPKEGV  534
            FGLFRPD T  ++ G+ K                              +S  +C+PK   
Sbjct  326  FGLFRPDFTPVYNIGVLKGEQAQPTPALPAPRNGSGNKGQPTSPVRPAESKKFCMPKADA  385

Query  533  SDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQ  354
            +DAQLQ+N++YVC QG+DC+ IQ GGPCF PNT+ SHAA+AMN  YQ  G+N +NCDF+ 
Sbjct  386  TDAQLQSNINYVCSQGVDCTPIQAGGPCFNPNTIRSHAAFAMNSYYQREGRNAFNCDFAG  445

Query  353  TATLSSTNPSYDGCTYPS  300
            T  ++ST+PSY  C + S
Sbjct  446  TGVVASTDPSYGTCKFQS  463



>ref|XP_010690550.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 112/197 (57%), Gaps = 25/197 (13%)
 Frame = -3

Query  827  STEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGL  648
             T V P+  +A+ Y   L+    S  GTPLMP +  +TY+FAL+ E  KPGP +ER+FGL
Sbjct  271  QTWVNPA--DAQTYNSRLVMAASSGKGTPLMPGRKFETYIFALFIENQKPGPVAERNFGL  328

Query  647  FRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------AWCVPKEG  537
            FRPD T  +D G+ +        P P  G                        WCVPK  
Sbjct  329  FRPDFTPVYDIGVMRNGPRPQPRPRPVGGRGKGRGTVVPPKSTTPALPGPTKGWCVPKPQ  388

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
             +DAQLQAN++YVC QG+DC  IQPGG CF PN V +HA Y MN  YQT G+ P+ CDFS
Sbjct  389  ATDAQLQANINYVCSQGVDCKPIQPGGACFNPNNVRAHATYVMNTFYQTKGRQPFQCDFS  448

Query  356  QTATLSSTNPSYDGCTY  306
             TA LS+ NPSY  C Y
Sbjct  449  HTAMLSNRNPSYGICRY  465



>dbj|BAF02203.1| hypothetical protein [Arabidopsis thaliana]
Length=251

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 112/185 (61%), Gaps = 8/185 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  ++ A  +  NLI  + S  GTPLMP ++ +TY+FAL++E LK GPTSER+
Sbjct  64   EGDIDQIGVDVDTAAEFNKNLIARVDSGTGTPLMPNRTFETYIFALFNENLKSGPTSERN  123

Query  656  FGLFRPDLTMTFDAGLsktvtptpv--------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            FG+FR DLT  +D G+ +    +               S  WCV K G     LQ N+DY
Sbjct  124  FGIFRSDLTPIYDIGILRPTFRSSDPVYNPRSPVRGSSSKRWCVTKAGAETVALQRNIDY  183

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            VCG G+DC  I  GG C+ PNTV +H+ YAMNL YQT  K+ ++CDF  T  +++ +PSY
Sbjct  184  VCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSY  243

Query  320  DGCTY  306
              C Y
Sbjct  244  GNCEY  248



>ref|XP_011025078.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=491

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 120/188 (64%), Gaps = 11/188 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G+S+++G   E+A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++E LKPGP SER+
Sbjct  304  QGESSQLGVDAESAAHYNRNLMQHVTSGAGTPLMPNRTFETYIFALFNEDLKPGPPSERN  363

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspk----------SGAWCVPKEGVSDAQLQANL  507
            FGLF+PD+T  +D G+ +    + +  +P              WC+PK G     LQ N+
Sbjct  364  FGLFQPDMTPVYDIGILRPKAKSSIPTNPAPVSPGPGGPKEKIWCLPKTGADVEALQRNI  423

Query  506  DYVCGQGID-CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTN  330
            DYVCG   + C  IQ GG CF PNTV +HAA+AMN  YQ  GKN ++CDF QTA +S+ +
Sbjct  424  DYVCGLKAEYCKPIQEGGECFLPNTVKAHAAFAMNAYYQGTGKNGYDCDFEQTAAVSNVD  483

Query  329  PSYDGCTY  306
            PSY  C Y
Sbjct  484  PSYGNCKY  491



>ref|XP_008376760.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Malus domestica]
Length=465

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 119/194 (61%), Gaps = 17/194 (9%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  +VG   ++A+ Y  NLI H+ S  GTPLMP ++ +T++F+L++E LKPGPT ER+
Sbjct  272  QGDPAQVGVDAQSAEDYNRNLIQHVTSGYGTPLMPNRTFETFVFSLFNENLKPGPTPERN  331

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSG-----------------AWCVPKEGVSD  528
            FGLFRPD+T T++ G+ +    +    +   G                  WC+PK+G   
Sbjct  332  FGLFRPDMTPTYNVGVLRHTASSTTPKNSGPGPVPVLAPASPPQSRGGKLWCLPKKGADP  391

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
              LQ N+DYVCG G++C  I+ GG CF PNTV +HAAYAMN+ +Q  G+   +CDF QT 
Sbjct  392  EALQKNIDYVCGLGLNCGPIKQGGLCFMPNTVRAHAAYAMNVYFQAMGRKDSDCDFEQTG  451

Query  347  TLSSTNPSYDGCTY  306
              ++ +PSY  C Y
Sbjct  452  ATTAVDPSYGKCKY  465



>ref|XP_010493578.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Camelina sativa]
Length=457

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 110/177 (62%), Gaps = 0/177 (0%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  +  A  +  N++  + S  GTPLMP +S +TY+FAL++E LK GPTSER+
Sbjct  279  EGDKDQIGVDVSTAAEFNKNVVARVDSGTGTPLMPNRSFETYIFALFNENLKSGPTSERN  338

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FG+ R DLT  +D G+ +    +    +     WCV K G     LQ N+DYVCG G+DC
Sbjct  339  FGILRSDLTPFYDIGILRPKVRSSNPENNPGSLWCVAKSGAETVALQRNIDYVCGLGLDC  398

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
              I  GG C+ PNTV +H+ YAMNL YQT GK  ++CDF  T  +++ +PSY  C Y
Sbjct  399  RPIIEGGLCYLPNTVKAHSEYAMNLFYQTMGKYKFDCDFENTGEITTMDPSYGNCEY  455



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+T    ++ENA +Y G++I  + S  GTPLMP ++ +TY+FAL++E  KPGP  E+ 
Sbjct  262  QGDATSPFATMENAISYNGHVIKEIVSGKGTPLMPNRTFETYMFALFNENQKPGPLVEKY  321

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---WCVPKEGVSDAQLQANLDYVCGQ-  489
            +G+F PDLT  +D GL +     P   +P   +   +CVPK  VS+ QLQ+NLDY CGQ 
Sbjct  322  WGMFNPDLTPIYDVGLLRRGQSAPTPATPAPSSSKNFCVPKVDVSNTQLQSNLDYACGQE  381

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GIDC+ IQPGG C+EPNT+ +HAA+AMN  Y+T G++ ++CDF+ T  +++ +PSY  C 
Sbjct  382  GIDCTPIQPGGACYEPNTLRAHAAFAMNTYYRTKGESYFSCDFAGTGQITTVDPSYPNCR  441

Query  308  Y  306
            +
Sbjct  442  F  442



>ref|XP_002318439.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
 gb|EEE96659.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
Length=460

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 119/188 (63%), Gaps = 11/188 (6%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G+S+++G   E+A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++E LKPGP SER+
Sbjct  273  QGESSQLGVDAESAAQYNRNLMQHVTSGAGTPLMPNRTFETYIFALFNEDLKPGPPSERN  332

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspk----------SGAWCVPKEGVSDAQLQANL  507
            FGLF+PD+T  ++ G+ +    + +  SP              WC+PK G     LQ N+
Sbjct  333  FGLFQPDMTPVYNIGILRPKAKSSIPTSPAPVSPGPGGPKEKIWCLPKPGADVEALQRNI  392

Query  506  DYVCGQGID-CSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTN  330
            DYVCG   + C  IQ GG CF PNTV +HAA+AMN  YQ   KN ++CDF QTA +S+ N
Sbjct  393  DYVCGLEAEYCKPIQEGGECFMPNTVKAHAAFAMNAYYQGTEKNGYDCDFEQTAAISNVN  452

Query  329  PSYDGCTY  306
            PSY  C Y
Sbjct  453  PSYGNCKY  460



>ref|XP_011654592.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Cucumis 
sativus]
 gb|KGN49838.1| hypothetical protein Csa_5G139170 [Cucumis sativus]
Length=493

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 116/190 (61%), Gaps = 13/190 (7%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            KGD T+VG   + A  Y GNL+ H+ S  GTPLMP ++ +TY+FAL++E LKPGP  ER+
Sbjct  303  KGDPTQVGVGPKEAAYYNGNLMRHVVSGKGTPLMPNRTFETYIFALFNENLKPGPIGERN  362

Query  656  FGLFRPDLTMTFDAGLsktvtptpv-------------tpspkSGAWCVPKEGVSDAQLQ  516
            FGLF PDL+  ++ G+ +    +               +   +S  WC+PK   S+  LQ
Sbjct  363  FGLFEPDLSPVYEIGILRPTAQSATPRAHQGQVEGPSPSTVSESKRWCLPKSEASEEGLQ  422

Query  515  ANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSS  336
             N+DYVCG G+DC  I+  G CF PNTV +HAAY MN  +Q    N ++CDF QT TL++
Sbjct  423  RNIDYVCGLGLDCGPIKENGACFAPNTVRAHAAYVMNAYFQATEGNDFDCDFDQTGTLTT  482

Query  335  TNPSYDGCTY  306
             +PSY  C Y
Sbjct  483  VDPSYGKCKY  492



>ref|NP_001234416.1| beta-glucosidase 08 precursor [Solanum lycopersicum]
 gb|ACH56716.1| beta-glucosidase 08 [Solanum lycopersicum]
Length=459

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 124/196 (63%), Gaps = 17/196 (9%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G++ E   ++ENA +Y G L+    S +GTPLMP + ++TY+F+L++E  KPG  +ER+
Sbjct  264  QGEAYEPQCTVENAASYNGGLMKKYNSGIGTPLMPHRKIETYIFSLFNENTKPGSIAERN  323

Query  656  FGLFRPDLTMTFDAGLsktvtptpv-----------------tpspkSGAWCVPKEGVSD  528
            FGLFRPD T  +D G+ K+    P                      ++  +C+PK   +D
Sbjct  324  FGLFRPDFTPVYDVGVLKSNQAHPTPSLPPPKTGGGGNKGQPKTPAENKKFCMPKVEATD  383

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
            AQLQ+N++YVC QG+DC+ IQ GG CF+PNT+ SHAA+AMN  YQ  G+N +NCDF+ T 
Sbjct  384  AQLQSNINYVCSQGVDCTPIQVGGSCFKPNTIRSHAAFAMNSYYQKEGRNNFNCDFAGTG  443

Query  347  TLSSTNPSYDGCTYPS  300
             ++ ++PSY  C + S
Sbjct  444  VVAFSDPSYGTCKFES  459



>ref|XP_008234701.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Prunus mume]
Length=468

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 118/194 (61%), Gaps = 19/194 (10%)
 Frame = -3

Query  830  DSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFG  651
            D  +VG   ++A  Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKPGPT E++FG
Sbjct  275  DPAQVGVDPQSAADYNGNLIRHVTSGNGTPLMPNRTFETYIFALFNENLKPGPTCEKNFG  334

Query  650  LFRPDLTMTFDAGLsktvtptpvtpspkSGA-------------------WCVPKEGVSD  528
            LFRPD+T  ++ G+ +    +    +P  G+                   WC+P+ G   
Sbjct  335  LFRPDMTPVYNVGILRHTASSSTPLNPSPGSGPVPALAPASPSPPHGEKLWCLPRRGADA  394

Query  527  AQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTA  348
              LQ N+DYVCG G++C  I+ GGPCF PNTV +HAAYAMN  +Q  G+N ++C+F  T 
Sbjct  395  EALQRNIDYVCGLGLNCGPIKQGGPCFMPNTVRAHAAYAMNRYFQAMGRNGYDCEFEGTG  454

Query  347  TLSSTNPSYDGCTY  306
              ++ +PSY  C Y
Sbjct  455  ATTAVDPSYGKCKY  468



>ref|XP_002993419.1| hypothetical protein SELMODRAFT_137087, partial [Selaginella 
moellendorffii]
 gb|EFJ05512.1| hypothetical protein SELMODRAFT_137087, partial [Selaginella 
moellendorffii]
Length=461

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 113/183 (62%), Gaps = 8/183 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +G S EVG S++NA+A+   L+ HL S  GTPL PR+ +DTY+FAL++E LKPGP SER+
Sbjct  246  QGGSDEVGASVDNARAFTSGLVAHLASSSGTPLRPRQQLDTYIFALFNEDLKPGPASERN  305

Query  656  FGLFRPDLTMTFDAGLsktv------tptpvtpspkSGAWCVPKEGVSDAQLQANLDYVC  495
            +GLF  D T  +DAGL  T            T      +WCV K  V    L   L+Y C
Sbjct  306  YGLFATDGTPIYDAGLLLTSGTHVGGGTATATTLSSGNSWCVAKTDVDSRALLTALNYAC  365

Query  494  GQG-IDCSAI-QPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            GQG  DC  I  P G CF+PN++ SHA+YA N+ Y   G+ PWNCDF  TATL++T+PS 
Sbjct  366  GQGEADCKEISSPAGSCFQPNSLVSHASYAFNMFYHKYGRKPWNCDFGNTATLTATDPSE  425

Query  320  DGC  312
              C
Sbjct  426  YYC  428



>ref|XP_010421259.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  +  A  +  NL+  + S  GTPLMP +S +TY+FAL++E LK GPTSER+
Sbjct  261  EGDRDQIGVDVSTAAEFNKNLVARVDSGTGTPLMPNRSFETYIFALFNENLKSGPTSERN  320

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FG+ R DLT  +D G+ +    +          WCV K G     LQ N+DYVCG G+DC
Sbjct  321  FGILRSDLTPLYDIGILRPKVRSSNPG----SRWCVAKAGAETVALQRNIDYVCGLGLDC  376

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
              I  GG C+ PNTV +H+ YAMNL YQT GK  ++CDF  T  +++ +PSY  C Y
Sbjct  377  RPIIEGGLCYLPNTVKAHSEYAMNLFYQTMGKYKFDCDFENTGEITTMDPSYGNCEY  433



>gb|KJB83778.1| hypothetical protein B456_013G263800 [Gossypium raimondii]
Length=510

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 118/196 (60%), Gaps = 21/196 (11%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LK     ER+F
Sbjct  273  GDPGQPGVSLENALSYNGNLIKHVDSGKGTPLMPNRTFETYIFALFNENLKES-VPERNF  331

Query  653  GLFRPDLTMTFDAGLsktvt--------------------ptpvtpspkSGAWCVPKEGV  534
            GLF+PDL   +D G+ ++                           PS  SG WCV K   
Sbjct  332  GLFKPDLNPVYDVGILRSEQGMGPTSAPTTATAPSAAMAPSAGKAPSNGSGKWCVAKSNA  391

Query  533  SDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQ  354
            S+A LQAN+DYVC  G+DC  IQ  G CF PN V SHA+YAMN  YQ  G++ +NCDF++
Sbjct  392  SNAALQANIDYVCSSGVDCKPIQSAGACFNPNNVRSHASYAMNAYYQANGRHDFNCDFNR  451

Query  353  TATLSSTNPSYDGCTY  306
            T  ++ST+PS+  C Y
Sbjct  452  TGVITSTDPSHAACNY  467



>ref|XP_010421258.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  +  A  +  NL+  + S  GTPLMP +S +TY+FAL++E LK GPTSER+
Sbjct  279  EGDRDQIGVDVSTAAEFNKNLVARVDSGTGTPLMPNRSFETYIFALFNENLKSGPTSERN  338

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQGIDC  477
            FG+ R DLT  +D G+ +    +          WCV K G     LQ N+DYVCG G+DC
Sbjct  339  FGILRSDLTPLYDIGILRPKVRSSNPG----SRWCVAKAGAETVALQRNIDYVCGLGLDC  394

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
              I  GG C+ PNTV +H+ YAMNL YQT GK  ++CDF  T  +++ +PSY  C Y
Sbjct  395  RPIIEGGLCYLPNTVKAHSEYAMNLFYQTMGKYKFDCDFENTGEITTMDPSYGNCEY  451



>ref|XP_007220925.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
 gb|EMJ22124.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
Length=470

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 117/196 (60%), Gaps = 21/196 (11%)
 Frame = -3

Query  830  DSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFG  651
            D  +VG   ++A  Y GNLI H+ S  GTPLMP ++ +TY+FAL++E LKPGPT ER+FG
Sbjct  275  DPAQVGVDPQSAADYNGNLIRHVTSGNGTPLMPNRTFETYIFALFNENLKPGPTCERNFG  334

Query  650  LFRPDLTMTFDAGLsktvtptpvtpspkSGA---------------------WCVPKEGV  534
            LFRPD+T  ++ G+ +    +    +P  G                      WC+PK G 
Sbjct  335  LFRPDMTPVYNVGILRHTASSSTPLNPGPGPGPVPVPGLAPASPSPPHGEKLWCLPKRGA  394

Query  533  SDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQ  354
                LQ N+DYVCG G++C  I+ GGPCF PNTV +HAAYAMN  +Q  G+N ++C+F  
Sbjct  395  DAEALQRNIDYVCGLGLNCGPIKQGGPCFMPNTVRAHAAYAMNRYFQAMGRNGYDCEFEG  454

Query  353  TATLSSTNPSYDGCTY  306
            T   ++ +PSY  C Y
Sbjct  455  TGATTAVDPSYGKCKY  470



>ref|XP_007009341.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOY18151.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=440

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 117/179 (65%), Gaps = 2/179 (1%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD   +  ++ NA +Y GNL+  + S  GTPLMP +  +TY+FAL++E  KPGP +ER+
Sbjct  261  QGDGGNLVATVGNALSYNGNLVREILSGNGTPLMPNRRFETYIFALFNENQKPGPLAERN  320

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA--WCVPKEGVSDAQLQANLDYVCGQGI  483
            +GLFRPD T  ++ G+ +   P P        +  +CVPK GV+DAQLQ+NLDY C QG 
Sbjct  321  WGLFRPDFTPVYNVGVLRNGQPMPRPAIRAPSSKKFCVPKPGVTDAQLQSNLDYACSQGA  380

Query  482  DCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
            +CS IQPGGPC +P TV S A +AMN  Y+  G+    CDFS TA +++ +PSY  C Y
Sbjct  381  NCSPIQPGGPCAQPGTVRSRATFAMNSYYRNKGQADNACDFSGTAQITTADPSYGNCHY  439



>ref|XP_002874188.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50447.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=443

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 111/185 (60%), Gaps = 8/185 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  +  A  +  N++T + S  GTPLMP ++ +TY+FAL++E LK GPTSER+
Sbjct  257  EGDIDQIGVDVATAAEFNKNVVTRVNSGTGTPLMPNRTFETYIFALFNENLKSGPTSERN  316

Query  656  FGLFRPDLTMTFDAGLsk--------tvtptpvtpspkSGAWCVPKEGVSDAQLQANLDY  501
            FG+FR DLT  +D G+ +                 +     WCV K G     LQ N+DY
Sbjct  317  FGIFRSDLTPIYDIGILRPTFRSSNPENNTATPVRASPEKRWCVTKAGAETVALQRNIDY  376

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            VCG G+DC  I  GG CF PNTV +H+ YAMNL YQT  K+ ++CDF  T  +++ +PSY
Sbjct  377  VCGLGLDCRPINEGGLCFLPNTVKAHSEYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSY  436

Query  320  DGCTY  306
              C Y
Sbjct  437  GNCEY  441



>ref|XP_004516968.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=450

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 11/177 (6%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ NA++Y G L+ HL    GTPLMP +  +TY+FAL++E  KPGP +E+++GLFRPD T
Sbjct  272  SVANAESYNGQLVRHLEEGRGTPLMPNRRFETYIFALFNENQKPGPIAEQNWGLFRPDFT  331

Query  629  MTFDAGLsktvtptpvtpspkSGA-----------WCVPKEGVSDAQLQANLDYVCGQGI  483
              +++G+ +             G            WCVPK   S+  LQAN++YVC QG+
Sbjct  332  PVYNSGILRNGQKPVAPKRGGGGGQSPSPVVGGQKWCVPKAEASNEALQANINYVCSQGV  391

Query  482  DCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            DC  IQPGG C+ PN V + A YAMN  YQ  GK+ +NCDFS +  ++S NPS+D C
Sbjct  392  DCKPIQPGGVCYAPNNVKALATYAMNAYYQANGKHDFNCDFSHSGVVTSINPSHDNC  448



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD+T    ++ENA +Y G++I  + S  GTPLMP ++ +TY+FAL++E  KPGP  E+ 
Sbjct  262  QGDATSPFATMENAISYNGHVIKEIVSGKGTPLMPNRTFETYMFALFNENQKPGPLVEKY  321

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSGA---WCVPKEGVSDAQLQANLDYVCGQ-  489
            +G+F PDLT  +D GL +     P   +P   +   +CVPK  VS+ QLQ+NLDY CGQ 
Sbjct  322  WGMFNPDLTPIYDVGLLRRGQSAPTPATPAPSSSKNFCVPKVDVSNTQLQSNLDYACGQE  381

Query  488  GIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCT  309
            GIDC+ IQPGG C+EPNT+ +HAA+AMN  Y+  G++ ++CDF+ T  +++ +PSY  C 
Sbjct  382  GIDCTPIQPGGACYEPNTLRAHAAFAMNTYYRIKGESYFSCDFAGTGQITTVDPSYPTCR  441

Query  308  Y  306
            +
Sbjct  442  F  442



>ref|XP_003552703.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Glycine max]
Length=454

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 112/180 (62%), Gaps = 14/180 (8%)
 Frame = -3

Query  809  SIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGLFRPDLT  630
            S+ NA+++   L+ HL +  GTPLMP +S +TY+FAL++E  KPGP +ER++GLF+PD T
Sbjct  273  SVANAQSFNRELVKHLATGKGTPLMPNRSFETYIFALFNENQKPGPIAERNWGLFQPDFT  332

Query  629  MTFDAGLsktvtptpvtpspkSGA--------------WCVPKEGVSDAQLQANLDYVCG  492
              +D+G+ +            +                WCVPK   S+  LQAN++YVC 
Sbjct  333  PVYDSGILRNGQAVTPARPTPTRPAAPTKPAPAVGGQKWCVPKADASNQALQANINYVCS  392

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
            QG+DC  IQPGG CF  N V + A YAMN  YQ  G++ +NCDFSQT  +++TNPS+D C
Sbjct  393  QGVDCRPIQPGGDCFAANNVKALATYAMNAYYQANGRHDFNCDFSQTGVITTTNPSHDKC  452



>gb|EMT12982.1| Glucan endo-1,3-beta-glucosidase [Aegilops tauschii]
Length=253

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = -3

Query  839  YKGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSER  660
            + G+  E+G  +++A  Y  N I HL S VGTPLMP ++ +  +F+L+DE LKPGP SE 
Sbjct  71   WAGEDWEIGAGVDHAGDYNRNAIRHLGSGVGTPLMPNRTFEVSIFSLFDENLKPGPMSEH  130

Query  659  SFGLFRPDLTMTFDAGLsktvtptpvtpspkSGAW----CVPKEGVSDAQLQANLDYVCG  492
             FGLF  D+T  +DAG+           +  +       CVP      A LQ N+D+VCG
Sbjct  131  HFGLFHADMTPIYDAGILTAPESVGPVSATVTRGGGRRGCVPTPAADAAVLQENIDFVCG  190

Query  491  QGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGC  312
             G+DC  I+PGG C+EP+TV +HAAYAMNL +++ G++ ++CDF +T  +++ +PS+  C
Sbjct  191  GGMDCGPIRPGGRCYEPDTVQAHAAYAMNLYFRSNGQHAFDCDFGRTGVVTTVDPSFGSC  250

Query  311  TY  306
             +
Sbjct  251  NF  252



>ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93290.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=458

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 112/185 (61%), Gaps = 8/185 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GD  ++G  ++ A  +  NLI  + S  GTPLMP ++ +TY+FAL++E LK GPTSER+
Sbjct  271  EGDIDQIGVDVDTAAEFNKNLIARVDSGTGTPLMPNRTFETYIFALFNENLKSGPTSERN  330

Query  656  FGLFRPDLTMTFDAGLsktvtptpv--------tpspkSGAWCVPKEGVSDAQLQANLDY  501
            FG+FR DLT  +D G+ +    +               S  WCV K G     LQ N+DY
Sbjct  331  FGIFRSDLTPIYDIGILRPTFRSSDPVYNPRSPVRGSSSKRWCVTKAGAETVALQRNIDY  390

Query  500  VCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSY  321
            VCG G+DC  I  GG C+ PNTV +H+ YAMNL YQT  K+ ++CDF  T  +++ +PSY
Sbjct  391  VCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSY  450

Query  320  DGCTY  306
              C Y
Sbjct  451  GNCEY  455



>ref|XP_010690542.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=488

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 111/196 (57%), Gaps = 25/196 (13%)
 Frame = -3

Query  827  STEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSFGL  648
             T V P+  +A+ Y   L+    S  GTPLMP +  +TY+FAL+ E  KPGP +ER+FGL
Sbjct  271  QTWVNPA--DAQTYNSRLVMAASSGKGTPLMPGRKFETYIFALFIENQKPGPVAERNFGL  328

Query  647  FRPDLTMTFDAGLsktvtptpvtpspkSG-----------------------AWCVPKEG  537
            FRPD T  +D G+ +        P P  G                        WCVPK  
Sbjct  329  FRPDFTPVYDIGVMRNGPRPQPRPRPVGGRGKGRGTVVPPKSTTPALPGPTKGWCVPKPQ  388

Query  536  VSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFS  357
             +DAQLQAN++YVC QG+DC  IQPGG CF PN V +HA Y MN  YQT G+ P+ CDFS
Sbjct  389  ATDAQLQANINYVCSQGVDCKPIQPGGACFNPNNVRAHATYVMNTFYQTKGRQPFQCDFS  448

Query  356  QTATLSSTNPSYDGCT  309
             TA LS+ NPS   C+
Sbjct  449  HTAMLSNRNPSKYRCS  464



>ref|XP_007013797.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31416.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
Length=483

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 125/184 (68%), Gaps = 7/184 (4%)
 Frame = -3

Query  836  KGDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERS  657
            +GDS+    +++N+ +Y G++I  + S  GTPLMP +  +TY+FAL++E  KPGP +E+ 
Sbjct  299  QGDSSSPFATMDNSISYNGHVIKEILSGKGTPLMPNRRFETYMFALFNENQKPGPLAEKY  358

Query  656  FGLFRPDLTMTFDAGLsktvtptpvtpspkSG-------AWCVPKEGVSDAQLQANLDYV  498
            +GLF+PDL+  ++ GL +     P   +P          ++CVP++  + AQLQ+NLDY 
Sbjct  359  WGLFKPDLSPIYNVGLLRHGQSVPTPTNPSPSTPAPSGKSYCVPQKEATYAQLQSNLDYA  418

Query  497  CGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYD  318
            CGQGIDC+ IQPGG C+EPNT+ SHAA+AMN  Y+T G++  +CDF+ T  +++ +PSY 
Sbjct  419  CGQGIDCTPIQPGGLCYEPNTIQSHAAFAMNSYYRTKGQSYLSCDFAGTGQITAVDPSYI  478

Query  317  GCTY  306
             C Y
Sbjct  479  NCHY  482



>ref|XP_003607845.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=512

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 122/204 (60%), Gaps = 24/204 (12%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  + G S+ENA +Y GNLI H+ S  GTPLMP ++ +TY+F+L++E LKP   SE+++
Sbjct  269  GDPGQPGVSLENAVSYNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-ISEQNY  327

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGA-----------------------WCVPK  543
            GLF+PDLT  +D G+        + P+    A                       WCVPK
Sbjct  328  GLFKPDLTPVYDVGVLTQKHQQAMGPASGPTAMGPASGPTAMGPSESPESSPSKKWCVPK  387

Query  542  EGVSDAQLQANLDYVCGQGIDCSAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCD  363
               S+  LQAN+DYVC  GIDC  I+ GGPC++P+++ SHAAYAMN  YQ +G +  +CD
Sbjct  388  TNASEKALQANIDYVCSHGIDCGPIKNGGPCYKPDSLRSHAAYAMNAYYQKSGHHDSDCD  447

Query  362  FSQTATLSSTNPSYDGCTYPSGST  291
            F  T  ++ T+PS + C +P  +T
Sbjct  448  FGHTGVITHTDPSSETCKFPYAAT  471



>ref|XP_009384878.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 2/177 (1%)
 Frame = -3

Query  833  GDSTEVGPSIENAKAYVGNLITHLRSLVGTPLMPRKSVDTYLFALYDEGLKPGPTSERSF  654
            GD  ++G S+E+A +Y  NLI  + S  GTP+MP +  +TY+FAL++E LKPGPT+ER F
Sbjct  276  GDPGQLGVSVEDAVSYNANLIRLVNSGKGTPMMPGRRFETYVFALFNENLKPGPTAERHF  335

Query  653  GLFRPDLTMTFDAGLsktvtptpvtpspkSGAWCVPKEGVSDAQLQANLDYVCGQ-GIDC  477
            GLF  DL+ ++D GL +     P         WCV     S A+LQ N+DY CG  G DC
Sbjct  336  GLFNADLSPSYDVGLMRDSDNAPAPSGDSW-RWCVATADASLAELQNNIDYACGSGGADC  394

Query  476  SAIQPGGPCFEPNTVASHAAYAMNLLYQTAGKNPWNCDFSQTATLSSTNPSYDGCTY  306
             AIQ GG CF+PNT+ +HA+YAMN  YQ AG++ +NC F  +  L+ST+PSY  C Y
Sbjct  395  GAIQNGGACFDPNTLLAHASYAMNAYYQAAGRHDFNCYFGGSGVLTSTDPSYGNCRY  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1812563152356