BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4139

Length=882
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            271   2e-82   Solanum tuberosum [potatoes]
emb|CDP10398.1|  unnamed protein product                                261   9e-79   Coffea canephora [robusta coffee]
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    259   2e-78   Nicotiana tomentosiformis
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    258   1e-77   Nicotiana tomentosiformis
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            257   4e-77   Solanum tuberosum [potatoes]
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    256   6e-77   Nicotiana tomentosiformis
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       256   7e-77   Nicotiana sylvestris
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    256   1e-76   Nicotiana tomentosiformis
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       255   2e-76   Nicotiana sylvestris
ref|XP_002524480.1|  oligopeptide transporter, putative                 253   2e-75   Ricinus communis
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       252   2e-75   Sesamum indicum [beniseed]
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       252   3e-75   
ref|XP_011648676.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            250   1e-74   Cucumis sativus [cucumbers]
gb|AFR11354.1|  nitrate transporter                                     250   2e-74   Cucumis sativus [cucumbers]
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    249   4e-74   Citrus sinensis [apfelsine]
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            249   5e-74   Tarenaya hassleriana [spider flower]
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            249   6e-74   Tarenaya hassleriana [spider flower]
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       248   6e-74   Solanum lycopersicum
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    248   8e-74   Citrus sinensis [apfelsine]
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    248   1e-73   Citrus sinensis [apfelsine]
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            248   1e-73   Cucumis melo [Oriental melon]
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             248   2e-73   Citrus clementina [clementine]
gb|KJB07736.1|  hypothetical protein B456_001G041900                    246   6e-73   Gossypium raimondii
gb|KJB64772.1|  hypothetical protein B456_010G064200                    241   2e-72   Gossypium raimondii
gb|KJB64773.1|  hypothetical protein B456_010G064200                    241   9e-72   Gossypium raimondii
gb|KJB64774.1|  hypothetical protein B456_010G064200                    241   2e-71   Gossypium raimondii
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    242   3e-71   Vitis vinifera
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    242   3e-71   Vitis vinifera
gb|KJB64775.1|  hypothetical protein B456_010G064200                    241   6e-71   Gossypium raimondii
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    241   6e-71   
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    241   7e-71   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       236   3e-69   Eucalyptus grandis [rose gum]
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     236   4e-69   Eucalyptus grandis [rose gum]
emb|CAD33927.1|  nitrate transporter                                    225   4e-69   Cicer arietinum [garbanzo]
emb|CDX71495.1|  BnaC04g17300D                                          234   3e-68   
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             233   5e-68   Phaseolus vulgaris [French bean]
ref|XP_012078774.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            232   1e-67   Jatropha curcas
emb|CDY30787.1|  BnaC07g16870D                                          231   3e-67   Brassica napus [oilseed rape]
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            230   8e-67   Brassica rapa
emb|CDY45207.1|  BnaA07g12830D                                          229   1e-66   Brassica napus [oilseed rape]
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    229   2e-66   Arabis alpina [alpine rockcress]
ref|NP_850084.1|  nitrate transporter 1.4                               228   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95302.1|  putative nitrate transporter                            229   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHN34550.1|  Nitrate transporter 1.4                                 220   3e-66   Glycine soja [wild soybean]
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    228   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       228   4e-66   Camelina sativa [gold-of-pleasure]
gb|AAM20651.1|  putative nitrate transporter                            228   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            228   4e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    227   4e-66   Eucalyptus grandis [rose gum]
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             228   5e-66   
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            228   6e-66   Cicer arietinum [garbanzo]
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       227   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    227   1e-65   Eucalyptus grandis [rose gum]
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             225   2e-65   
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       226   3e-65   Cucumis melo [Oriental melon]
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    225   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             225   7e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010093242.1|  Nitrate transporter 1.4                            224   1e-64   
ref|XP_011656291.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       222   6e-64   Cucumis sativus [cucumbers]
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg             222   1e-63   
gb|KHN15097.1|  Nitrate transporter 1.4                                 221   3e-63   Glycine soja [wild soybean]
ref|XP_011458172.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            220   3e-63   Fragaria vesca subsp. vesca
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                219   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like            219   1e-62   Glycine max [soybeans]
ref|XP_002880817.1|  nitrate transporter                                216   8e-62   Arabidopsis lyrata subsp. lyrata
gb|KHN47160.1|  Nitrate transporter 1.4                                 216   1e-61   Glycine soja [wild soybean]
ref|XP_003609313.1|  Nitrate transporter                                216   1e-61   Medicago truncatula
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       215   3e-61   
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       215   3e-61   
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    213   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    213   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       213   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...    209   2e-59   Citrus sinensis [apfelsine]
ref|XP_006450457.1|  hypothetical protein CICLE_v10008198mg             206   6e-59   
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...    209   7e-59   Citrus sinensis [apfelsine]
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                   209   7e-59   Citrus sinensis [apfelsine]
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    202   4e-56   Phoenix dactylifera
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    201   4e-56   
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2    200   9e-56   
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...    199   5e-55   
gb|ERN00369.1|  hypothetical protein AMTR_s00104p00113760               198   7e-55   Amborella trichopoda
ref|XP_006837800.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            198   9e-55   
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       191   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       189   1e-51   Phoenix dactylifera
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       188   2e-51   Elaeis guineensis
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       187   1e-50   
gb|EPS59108.1|  hypothetical protein M569_15702                         185   1e-50   Genlisea aurea
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       184   7e-50   
gb|EMT23542.1|  Nitrate/chlorate transporter                            184   2e-49   
gb|EMS53820.1|  Nitrate transporter 1.4                                 183   2e-49   Triticum urartu
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                   182   5e-49   Gossypium arboreum [tree cotton]
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       182   5e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...    180   3e-48   Setaria italica
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            180   3e-48   Brachypodium distachyon [annual false brome]
dbj|BAJ90833.1|  predicted protein                                      179   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB82816.1|  hypothetical protein B456_013G215400                    179   8e-48   Gossypium raimondii
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       171   5e-45   Zea mays [maize]
ref|NP_001169613.1|  uncharacterized protein LOC100383494               170   1e-44   Zea mays [maize]
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                    170   1e-44   
gb|EAY74514.1|  hypothetical protein OsI_02405                          169   3e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001043326.1|  Os01g0556700                                       169   3e-44   
gb|EAZ12317.1|  hypothetical protein OsJ_02208                          169   3e-44   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD87491.1|  putative dicarboxylate transporter                     169   4e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    166   3e-43   
ref|XP_010093702.1|  Nitrate transporter 1.1                            158   3e-43   
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    166   4e-43   
ref|XP_006645998.1|  PREDICTED: nitrate transporter 1.4-like            166   5e-43   
ref|XP_007155636.1|  hypothetical protein PHAVU_003G218500g             160   9e-42   Phaseolus vulgaris [French bean]
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       161   2e-41   Phoenix dactylifera
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             160   3e-41   Phaseolus vulgaris [French bean]
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       160   5e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   9e-41   Phoenix dactylifera
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002303512.2|  nitrate transporter family protein                 158   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like            157   4e-40   Glycine max [soybeans]
gb|KHN42706.1|  Nitrate transporter 1.1                                 157   5e-40   Glycine soja [wild soybean]
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like            157   5e-40   
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    157   5e-40   
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            157   5e-40   Glycine max [soybeans]
gb|ACR34962.1|  unknown                                                 157   6e-40   Zea mays [maize]
ref|NP_001145735.1|  uncharacterized protein LOC100279242               157   7e-40   Zea mays [maize]
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...    156   8e-40   
ref|XP_011033951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       155   9e-40   Populus euphratica
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    156   9e-40   
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    156   9e-40   Elaeis guineensis
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       156   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       155   1e-39   Sesamum indicum [beniseed]
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       156   1e-39   Brachypodium distachyon [annual false brome]
gb|KHN09796.1|  Nitrate transporter 1.1                                 155   3e-39   Glycine soja [wild soybean]
ref|NP_001275529.1|  nitrate transporter 1.1-like                       154   6e-39   Cucumis sativus [cucumbers]
ref|XP_006440345.1|  hypothetical protein CICLE_v10019412mg             152   7e-39   
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    154   7e-39   
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    154   8e-39   Setaria italica
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       153   1e-38   Cucumis melo [Oriental melon]
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       153   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_003611286.1|  Nitrate transporter                                153   1e-38   Medicago truncatula
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g             153   1e-38   Phaseolus vulgaris [French bean]
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    152   1e-38   
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          153   2e-38   Sorghum bicolor [broomcorn]
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    152   2e-38   Solanum lycopersicum
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       152   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg             152   2e-38   Citrus clementina [clementine]
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                   152   2e-38   Citrus sinensis [apfelsine]
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       152   3e-38   Populus euphratica
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like            152   3e-38   Citrus sinensis [apfelsine]
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       152   3e-38   Elaeis guineensis
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            152   3e-38   Eucalyptus grandis [rose gum]
gb|KHG27943.1|  Uncharacterized protein F383_15837                      150   1e-37   Gossypium arboreum [tree cotton]
emb|CDP09929.1|  unnamed protein product                                150   1e-37   Coffea canephora [robusta coffee]
ref|XP_011463731.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    149   2e-37   Fragaria vesca subsp. vesca
ref|XP_003611284.1|  Nitrate transporter                                149   2e-37   Medicago truncatula
gb|KHG24776.1|  Uncharacterized protein F383_04224                      149   2e-37   Gossypium arboreum [tree cotton]
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       149   2e-37   Sesamum indicum [beniseed]
ref|XP_004298652.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    149   3e-37   Fragaria vesca subsp. vesca
gb|KJB46719.1|  hypothetical protein B456_008G2375002                   149   3e-37   Gossypium raimondii
dbj|BAJ90348.1|  predicted protein                                      149   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB20885.1|  hypothetical protein B456_003G170300                    148   5e-37   Gossypium raimondii
gb|EMT10378.1|  Nitrate/chlorate transporter                            148   7e-37   
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       148   7e-37   Sesamum indicum [beniseed]
gb|KHG03840.1|  Uncharacterized protein F383_26454                      147   9e-37   Gossypium arboreum [tree cotton]
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            147   9e-37   Brassica rapa
dbj|BAG91755.1|  unnamed protein product                                146   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_012087157.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    147   1e-36   Jatropha curcas
ref|XP_012087158.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    147   1e-36   
ref|NP_001061020.1|  Os08g0155400                                       147   2e-36   
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       147   2e-36   Nicotiana tomentosiformis
ref|XP_006366745.1|  PREDICTED: nitrate transporter 1.1-like            147   2e-36   Solanum tuberosum [potatoes]
dbj|BAC99394.1|  putative nitrate transporter                           147   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       146   3e-36   Solanum lycopersicum
gb|KJB20886.1|  hypothetical protein B456_003G170400                    146   4e-36   Gossypium raimondii
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   4e-36   Elaeis guineensis
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   6e-36   Nicotiana sylvestris
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                145   6e-36   Erythranthe guttata [common monkey flower]
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like            145   6e-36   Cicer arietinum [garbanzo]
ref|XP_004242006.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   7e-36   Solanum lycopersicum
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470          145   7e-36   Sorghum bicolor [broomcorn]
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   8e-36   Brachypodium distachyon [annual false brome]
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       144   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like            144   1e-35   Solanum tuberosum [potatoes]
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       144   2e-35   Solanum lycopersicum
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    144   2e-35   Cucumis melo [Oriental melon]
ref|XP_004147617.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       144   2e-35   Cucumis sativus [cucumbers]
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       144   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU24743.1|  hypothetical protein MIMGU_mgv1a003354mg                144   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like            144   2e-35   Solanum tuberosum [potatoes]
gb|EYU18566.1|  hypothetical protein MIMGU_mgv1a020825mg                144   2e-35   Erythranthe guttata [common monkey flower]
emb|CAC00544.1|  putative low-affinity nitrate transporter              143   3e-35   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg             143   3e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       143   3e-35   Brassica rapa
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                    143   3e-35   Arabis alpina [alpine rockcress]
gb|AEA35415.1|  nitrate transporter                                     143   4e-35   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_007013427.1|  Major facilitator superfamily protein, putative    143   4e-35   
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       143   4e-35   Nicotiana tomentosiformis
emb|CAC07206.1|  nitrate transporter                                    143   4e-35   Brassica napus [oilseed rape]
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       143   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1                 143   4e-35   Glycine max [soybeans]
gb|AAA80582.1|  RCH2 protein                                            143   4e-35   Brassica napus [oilseed rape]
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like            142   5e-35   Oryza brachyantha
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       142   5e-35   Nicotiana sylvestris
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       142   6e-35   Tarenaya hassleriana [spider flower]
ref|XP_007039889.1|  Nitrate transporter 1.1 isoform 2                  142   6e-35   
ref|XP_007039888.1|  Nitrate transporter 1.1 isoform 1                  142   6e-35   
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    142   6e-35   Elaeis guineensis
gb|EYU27205.1|  hypothetical protein MIMGU_mgv1a025825mg                138   7e-35   Erythranthe guttata [common monkey flower]
ref|XP_002529778.1|  oligopeptide transporter, putative                 142   8e-35   Ricinus communis
dbj|BAJ98569.1|  predicted protein                                      142   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI28188.3|  unnamed protein product                                142   1e-34   Vitis vinifera
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            142   1e-34   
ref|XP_006307075.1|  hypothetical protein CARUB_v10008661mg             141   1e-34   Capsella rubella
ref|XP_006650950.1|  PREDICTED: nitrate transporter 1.1-like            141   2e-34   
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       141   2e-34   Zea mays [maize]
emb|CAD32549.1|  dicarboxylate transporter                              141   2e-34   Alnus glutinosa
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       141   2e-34   Nelumbo nucifera [Indian lotus]
dbj|BAC56915.1|  nitrate transporter                                    141   2e-34   Nicotiana tabacum [American tobacco]
ref|XP_009763469.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       141   2e-34   Nicotiana sylvestris
gb|KHN34951.1|  Nitrate transporter 1.1                                 141   2e-34   Glycine soja [wild soybean]
gb|EYU29794.1|  hypothetical protein MIMGU_mgv1a003534mg                140   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       141   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_009598780.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       140   4e-34   Nicotiana tomentosiformis
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       140   4e-34   
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            140   4e-34   Camelina sativa [gold-of-pleasure]
dbj|BAC56916.1|  nitrate transporter                                    140   4e-34   Nicotiana tabacum [American tobacco]
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       140   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009800593.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    140   4e-34   Nicotiana sylvestris
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       140   5e-34   Brachypodium distachyon [annual false brome]
gb|KHG00259.1|  Uncharacterized protein F383_18798                      139   7e-34   Gossypium arboreum [tree cotton]
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like            139   8e-34   Setaria italica
gb|EMT27347.1|  Nitrate/chlorate transporter                            139   9e-34   
ref|XP_002889915.1|  NRT1.1                                             139   9e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_008367434.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    139   1e-33   
emb|CAN71417.1|  hypothetical protein VITISV_004658                     139   1e-33   Vitis vinifera
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            138   2e-33   Vitis vinifera
ref|XP_009333673.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       138   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090          138   2e-33   Sorghum bicolor [broomcorn]
gb|KJB25600.1|  hypothetical protein B456_004G199600                    136   2e-33   Gossypium raimondii
emb|CAC00545.1|  putative low-affinity nitrate transporter              138   2e-33   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            137   3e-33   
ref|XP_009333599.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       137   3e-33   Pyrus x bretschneideri [bai li]
gb|KJB25603.1|  hypothetical protein B456_004G199600                    137   4e-33   Gossypium raimondii
gb|ERN02841.1|  hypothetical protein AMTR_s00086p00160300               137   4e-33   Amborella trichopoda
emb|CCN27450.1|  low affiniy nitrate transporter                        132   4e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006841166.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            137   5e-33   Amborella trichopoda
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like            137   5e-33   Setaria italica
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       137   5e-33   Phoenix dactylifera
gb|AAM47310.1|AF377946_12  putative peptide transporter protein         135   6e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KJB25604.1|  hypothetical protein B456_004G199600                    136   6e-33   Gossypium raimondii
gb|KJB25599.1|  hypothetical protein B456_004G199600                    136   7e-33   Gossypium raimondii
ref|XP_003608752.1|  Nitrate transporter                                136   8e-33   Medicago truncatula
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       135   2e-32   Zea mays [maize]
dbj|BAK05363.1|  predicted protein                                      135   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF86161.1|  unknown                                                 135   2e-32   Zea mays [maize]
gb|EMT09323.1|  Nitrate/chlorate transporter                            137   2e-32   
ref|NP_001065341.2|  Os10g0554200                                       134   2e-32   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373             135   2e-32   
gb|EAZ16929.1|  hypothetical protein OsJ_32411                          135   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                  135   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed       135   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ACG29230.1|  peptide transporter PTR2                                135   3e-32   Zea mays [maize]
ref|XP_009376056.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       135   3e-32   Pyrus x bretschneideri [bai li]
ref|NP_001281186.1|  peptide transporter PTR2                           135   3e-32   Zea mays [maize]
ref|XP_008381222.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       131   3e-32   
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter         134   5e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EEE59822.1|  hypothetical protein OsJ_12376                          134   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            134   5e-32   Brachypodium distachyon [annual false brome]
ref|NP_001051098.1|  Os03g0719900                                       134   5e-32   
emb|CCN27382.1|  low affinity nitrate transporter                       127   5e-32   Triticum aestivum [Canadian hard winter wheat]
ref|NP_563899.1|  nitrate transporter 1.1                               134   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       134   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106             134   6e-32   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260          134   6e-32   
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    134   7e-32   Brachypodium distachyon [annual false brome]
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    134   7e-32   Brachypodium distachyon [annual false brome]
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    133   9e-32   
ref|NP_001136757.1|  hypothetical protein                               132   9e-32   Zea mays [maize]
gb|ACU17848.1|  unknown                                                 129   9e-32   Glycine max [soybeans]
gb|EMT12147.1|  Nitrate/chlorate transporter                            130   1e-31   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           133   1e-31   
ref|XP_008238567.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            133   1e-31   Prunus mume [ume]
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       133   1e-31   Elaeis guineensis
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    133   1e-31   
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    133   1e-31   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    132   1e-31   
gb|EMS61581.1|  Nitrate transporter 1.3                                 132   1e-31   
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    132   2e-31   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    132   2e-31   
ref|XP_002992556.1|  hypothetical protein SELMODRAFT_135528             132   2e-31   
ref|XP_007210870.1|  hypothetical protein PRUPE_ppa003177mg             132   2e-31   
dbj|BAC81420.1|  nitrate transporter                                    132   2e-31   
dbj|BAD22820.1|  nitrate transporter                                    132   2e-31   
ref|XP_002972498.1|  hypothetical protein SELMODRAFT_97655              132   2e-31   
ref|XP_002972328.1|  hypothetical protein SELMODRAFT_97590              132   3e-31   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    132   3e-31   
gb|EMT22500.1|  hypothetical protein F775_42780                         129   3e-31   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         132   3e-31   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824             132   4e-31   
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814             132   4e-31   
gb|ACG41138.1|  peptide transporter PTR2                                131   4e-31   
gb|EEC73483.1|  hypothetical protein OsI_07814                          132   5e-31   
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           131   5e-31   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       131   5e-31   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       131   5e-31   
ref|NP_001047240.1|  Os02g0580900                                       131   5e-31   
ref|XP_008358135.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       131   6e-31   
ref|XP_004952902.1|  PREDICTED: nitrate transporter 1.3-like            131   7e-31   
ref|XP_002984329.1|  hypothetical protein SELMODRAFT_119835             131   7e-31   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812              130   8e-31   
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           131   8e-31   
gb|EMT07614.1|  Peptide transporter PTR2                                127   9e-31   
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like            130   9e-31   
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...    130   1e-30   
gb|EMS68423.1|  Peptide transporter PTR2                                130   1e-30   
dbj|BAJ97468.1|  predicted protein                                      129   1e-30   
gb|AFK33709.1|  unknown                                                 129   1e-30   
gb|ABR32183.1|  peptide transporter                                     130   1e-30   
dbj|BAJ97409.1|  predicted protein                                      130   2e-30   
dbj|BAJ95092.1|  predicted protein                                      129   2e-30   
ref|XP_010276259.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    129   2e-30   
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          129   2e-30   
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    129   3e-30   
dbj|BAJ86417.1|  predicted protein                                      129   3e-30   
dbj|BAJ85008.1|  predicted protein                                      129   3e-30   
gb|EAZ41557.1|  hypothetical protein OsJ_26080                          129   4e-30   
ref|XP_008649786.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       129   4e-30   
gb|EMS66305.1|  Peptide transporter PTR2                                130   4e-30   
ref|XP_011624726.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2 isof...    128   4e-30   
ref|XP_006848107.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            129   4e-30   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            129   5e-30   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       130   5e-30   
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like            129   5e-30   
ref|XP_002468692.1|  hypothetical protein SORBIDRAFT_01g050410          129   5e-30   
ref|XP_003519455.1|  PREDICTED: nitrate transporter 1.3                 128   6e-30   
ref|XP_003545571.1|  PREDICTED: nitrate transporter 1.3-like            128   6e-30   
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg             127   6e-30   
gb|EAY94439.1|  hypothetical protein OsI_16210                          127   7e-30   
ref|XP_006848110.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    128   8e-30   
ref|XP_001771110.1|  predicted protein                                  128   8e-30   
gb|ACJ85754.1|  unknown                                                 124   9e-30   
gb|ERN09691.1|  hypothetical protein AMTR_s00029p00215100               128   1e-29   
ref|XP_002970258.1|  hypothetical protein SELMODRAFT_231570             127   1e-29   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       128   1e-29   
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like           127   1e-29   
gb|KHN38482.1|  Nitrate transporter 1.3                                 127   1e-29   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             127   1e-29   
gb|KHM99092.1|  Nitrate transporter 1.3                                 128   1e-29   
ref|XP_002969419.1|  hypothetical protein SELMODRAFT_91962              127   1e-29   
ref|XP_006648788.1|  PREDICTED: nitrate transporter 1.3-like            126   2e-29   
gb|EPS69660.1|  hypothetical protein M569_05105                         127   2e-29   
ref|XP_004149470.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       127   2e-29   
ref|NP_178313.1|  peptide transporter PTR2                              127   2e-29   
emb|CAA54634.1|  oligopeptide transporter 1-1                           127   2e-29   
gb|ACN26865.1|  unknown                                                 126   3e-29   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like            126   3e-29   
gb|EAY94442.1|  hypothetical protein OsI_16213                          125   3e-29   
emb|CCN27376.1|  low affinity nitrate transporter                       119   3e-29   
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg                126   4e-29   
ref|NP_001173970.1|  Os04g0464400                                       126   4e-29   
ref|XP_010913451.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            126   4e-29   
ref|NP_001131161.1|  uncharacterized protein LOC100192469               126   4e-29   
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    125   4e-29   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like           125   4e-29   
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       126   5e-29   
ref|XP_002521890.1|  peptide transporter, putative                      126   5e-29   
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            125   5e-29   
ref|XP_010502212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       125   5e-29   
emb|CDY03084.1|  BnaC07g21430D                                          125   5e-29   
gb|EYU35700.1|  hypothetical protein MIMGU_mgv1a0209461mg               121   6e-29   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg             125   6e-29   
emb|CDY31242.1|  BnaC08g15370D                                          125   6e-29   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    125   7e-29   
ref|XP_002970753.1|  hypothetical protein SELMODRAFT_94418              125   7e-29   
emb|CDY21035.1|  BnaA08g24900D                                          125   7e-29   
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    125   7e-29   
ref|XP_002875108.1|  ATPTR2-B                                           125   7e-29   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             125   8e-29   
ref|XP_007134767.1|  hypothetical protein PHAVU_010G0742001g            124   8e-29   
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              125   8e-29   
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       125   8e-29   
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890          125   8e-29   
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            125   9e-29   
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536             125   1e-28   
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            124   1e-28   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       125   1e-28   
gb|KCW46954.1|  hypothetical protein EUGRSUZ_K00766                     124   1e-28   
ref|XP_002978416.1|  hypothetical protein SELMODRAFT_418286             124   1e-28   
ref|XP_012087906.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       124   1e-28   
dbj|BAF00365.1|  oligopeptide transporter - like protein                124   1e-28   
gb|AAO64143.1|  putative oligopeptide transporter protein               124   1e-28   
emb|CDM81075.1|  unnamed protein product                                124   1e-28   
ref|XP_002970902.1|  hypothetical protein SELMODRAFT_94322              125   1e-28   
gb|EMT07615.1|  Peptide transporter PTR2                                124   2e-28   
ref|XP_009101283.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            124   2e-28   
gb|ACF22756.1|  nitrate transporter                                     124   2e-28   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       124   2e-28   
gb|KFK43704.1|  hypothetical protein AALP_AA1G162300                    124   2e-28   
ref|XP_006391918.1|  hypothetical protein EUTSA_v10023384mg             124   2e-28   
gb|EMT02211.1|  Peptide transporter PTR1                                124   2e-28   
ref|XP_002969637.1|  hypothetical protein SELMODRAFT_91845              124   2e-28   
ref|XP_010035531.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            124   2e-28   
ref|NP_195738.1|  peptide transporter PTR5                              124   2e-28   
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          124   3e-28   
emb|CDY17619.1|  BnaA06g34380D                                          124   3e-28   
emb|CDP05420.1|  unnamed protein product                                124   3e-28   
gb|EAY88182.1|  hypothetical protein OsI_09629                          124   3e-28   
gb|ADQ43190.1|  peptide transporter                                     124   3e-28   
ref|XP_004987224.1|  PREDICTED: nitrate transporter 1.1-like            119   3e-28   
ref|XP_003616931.1|  Nitrate transporter                                124   3e-28   
gb|KDP46550.1|  hypothetical protein JCGZ_08522                         122   3e-28   
gb|KFK39483.1|  hypothetical protein AALP_AA3G250100                    123   3e-28   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            123   3e-28   
ref|XP_010548886.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            123   4e-28   
ref|XP_008647800.1|  PREDICTED: peptide transporter PTR2 isoform X1     122   4e-28   
gb|EMT07041.1|  Peptide transporter PTR2                                125   4e-28   
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       123   4e-28   
ref|XP_002973408.1|  hypothetical protein SELMODRAFT_232069             123   4e-28   
gb|ACL52560.1|  unknown                                                 122   4e-28   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       123   4e-28   
dbj|BAJ91595.1|  predicted protein                                      122   4e-28   
ref|XP_002441094.1|  hypothetical protein SORBIDRAFT_09g020300          123   4e-28   
ref|XP_008375317.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       123   4e-28   
ref|XP_009361962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       123   5e-28   
ref|XP_011466488.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       122   5e-28   
ref|XP_012080632.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            123   5e-28   
ref|NP_001146682.1|  hypothetical protein                               123   5e-28   
gb|ACL52627.1|  unknown                                                 123   5e-28   
gb|KFK33424.1|  hypothetical protein AALP_AA5G011300                    123   6e-28   
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       122   6e-28   
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285             123   6e-28   
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg             122   6e-28   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       122   6e-28   
emb|CDP11323.1|  unnamed protein product                                124   7e-28   
ref|XP_012068926.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       121   7e-28   
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              122   8e-28   
ref|XP_008347002.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       121   8e-28   
ref|XP_006649696.1|  PREDICTED: peptide transporter PTR2-like           122   8e-28   
gb|EMS66306.1|  Peptide transporter PTR2                                122   8e-28   
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like           122   8e-28   
gb|ACF84825.1|  unknown                                                 121   8e-28   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       122   1e-27   
ref|XP_004297798.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       122   1e-27   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             122   1e-27   
ref|XP_009344865.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       115   1e-27   
gb|EMT28633.1|  Peptide transporter PTR5                                121   1e-27   
ref|XP_012068939.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   1e-27   
ref|XP_010256203.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      122   1e-27   
ref|NP_001147810.1|  peptide transporter PTR2                           122   1e-27   
ref|XP_006849517.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            122   1e-27   
ref|XP_012088023.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       122   1e-27   
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g             122   1e-27   
ref|XP_007141630.1|  hypothetical protein PHAVU_008G212300g             122   1e-27   
ref|XP_006287367.1|  hypothetical protein CARUB_v10000567mg             122   1e-27   
emb|CDY15967.1|  BnaC08g41560D                                          122   1e-27   
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       121   1e-27   
ref|XP_006346661.1|  PREDICTED: peptide transporter PTR2-like           123   1e-27   
ref|XP_006292510.1|  hypothetical protein CARUB_v10018740mg             121   2e-27   
dbj|BAJ95903.1|  predicted protein                                      121   2e-27   
emb|CDY26539.1|  BnaA09g47380D                                          121   2e-27   
gb|AAC32034.1|  peptide transporter                                     121   2e-27   
ref|XP_008340555.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       119   2e-27   
gb|KJB46720.1|  hypothetical protein B456_008G2375002                   120   2e-27   
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           121   2e-27   
gb|KJB46721.1|  hypothetical protein B456_008G2375002                   120   2e-27   
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             122   2e-27   
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           121   2e-27   
gb|KDP32502.1|  hypothetical protein JCGZ_14705                         117   2e-27   
ref|NP_001142266.1|  uncharacterized protein LOC100274435               121   2e-27   
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                121   2e-27   
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       121   2e-27   
ref|XP_008446297.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    121   2e-27   
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    120   2e-27   
ref|XP_008798046.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    121   2e-27   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       121   2e-27   
ref|XP_009362004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       121   2e-27   
ref|NP_001041994.1|  Os01g0142800                                       121   2e-27   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            121   2e-27   
dbj|BAG91734.1|  unnamed protein product                                121   2e-27   
gb|KJB55777.1|  hypothetical protein B456_009G093900                    120   2e-27   
ref|XP_009788955.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    120   2e-27   
ref|XP_007045396.1|  Peptide transporter 2 isoform 2                    120   3e-27   
dbj|BAK03852.1|  predicted protein                                      121   3e-27   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           121   3e-27   
gb|ABK24723.1|  unknown                                                 121   3e-27   
ref|XP_012068201.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   3e-27   
ref|XP_012068161.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   3e-27   
ref|XP_012072405.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       121   3e-27   
ref|XP_009391232.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            121   3e-27   
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606    123   3e-27   
ref|XP_002870939.1|  proton-dependent oligopeptide transport fami...    120   3e-27   
ref|XP_011466487.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   3e-27   
ref|XP_002302005.2|  hypothetical protein POPTR_0002s03070g             120   3e-27   
gb|EMS66817.1|  Peptide transporter PTR5                                119   3e-27   
ref|XP_006297285.1|  hypothetical protein CARUB_v10013300mg             120   3e-27   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      120   3e-27   
ref|XP_010466420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       120   3e-27   
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   4e-27   
ref|XP_008787879.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       120   4e-27   
ref|XP_012072525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       120   4e-27   
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       120   4e-27   
dbj|BAJ86984.1|  predicted protein                                      120   4e-27   
ref|XP_002976499.1|  hypothetical protein SELMODRAFT_105638             120   4e-27   
gb|KJB55776.1|  hypothetical protein B456_009G093900                    120   4e-27   



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLALYDRI+MPLWKKWKG PGFTNLQRIA+GLVLS +GMA +AL E+KRL  A 
Sbjct  377  VAAILITLALYDRIIMPLWKKWKGKPGFTNLQRIAIGLVLSVIGMAAAALAEQKRLTVAK  436

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  437  SVGRNTSTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLVSV+ K T ++   Q WLADNINYGRLD FYWLLA LGVINF +YL C+ W+
Sbjct  497  GFFISSFLVSVINKTTKSNATAQGWLADNINYGRLDFFYWLLAALGVINFAIYLNCATWY  556

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            KPRK KSA+ MET+ NG G E+KC
Sbjct  557  KPRKPKSAIPMETLHNGYGAEDKC  580



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 172/204 (84%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MP WKKWKG PGFT+LQRIA+GLVLST+GMA +AL+E KRL+ A 
Sbjct  376  VAAILITLAVYDRLIMPFWKKWKGKPGFTSLQRIAIGLVLSTIGMAAAALVEMKRLSVAK  435

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  436  SAGRTTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  495

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+VK  T  SH G+ WLAD INYGRLDLFY LLA LGVINFVVY IC++W+
Sbjct  496  GFFFSSMLVSIVKGATR-SHRGEGWLADKINYGRLDLFYALLAVLGVINFVVYSICAVWY  554

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            KP+K   AVEM  V NG G EEKC
Sbjct  555  KPKKPNPAVEMGNVANGAGAEEKC  578



>ref|XP_009608738.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=533

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR +MPLW+K+KG PGFT+LQ+IA+GLVLST+GMA++AL++ KRL+ A 
Sbjct  331  VSAILITLAIYDRFIMPLWQKFKGKPGFTSLQKIAIGLVLSTMGMAIAALVDLKRLSVAK  390

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  391  SVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  450

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SSFLVS++KKVT  S+GG  WLADNINY RLD FY LLA LGVINF +YLIC+IWF
Sbjct  451  GFFFSSFLVSIIKKVTR-SNGGDGWLADNINYARLDCFYGLLAILGVINFALYLICAIWF  509

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KPRK+KSA++METV NGN  ++KC
Sbjct  510  KPRKSKSAIQMETVKNGNAADDKC  533



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR +MPLW+K+KG PGFT+LQ+IA+GLVLST+GMA++AL++ KRL+ A 
Sbjct  376  VSAILITLAIYDRFIMPLWQKFKGKPGFTSLQKIAIGLVLSTMGMAIAALVDLKRLSVAK  435

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  436  SVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  495

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SSFLVS++KKVT  S+GG  WLADNINY RLD FY LLA LGVINF +YLIC+IWF
Sbjct  496  GFFFSSFLVSIIKKVTR-SNGGDGWLADNINYARLDCFYGLLAILGVINFALYLICAIWF  554

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KPRK+KSA++METV NGN  ++KC
Sbjct  555  KPRKSKSAIQMETVKNGNAADDKC  578



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITL +YDR +MPLW+K KG PGFT+LQ+IA+GLVLST+GM ++AL+E KRL+ A 
Sbjct  373  VSAILITLIIYDRFIMPLWQKLKGKPGFTSLQKIAIGLVLSTMGMGIAALVEMKRLSVAK  432

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  433  STGRNISTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTM-STGLFLTTLA  491

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + S+GG DWLADNINYGRLD FY LLA LGVINFV+YL C+ WF
Sbjct  492  LGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLLAILGVINFVLYLFCATWF  551

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KPRK KSA+ MET+ NGN  E+KC
Sbjct  552  KPRKAKSAINMETINNGNVVEDKC  575



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDRI+MPLWKKWKG PGF++LQRI++GLV S +GMA +AL EKKRL  A 
Sbjct  371  VAAILITLAVYDRIIMPLWKKWKGKPGFSSLQRISIGLVFSIIGMAAAALAEKKRLTVAK  430

Query  700  SEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            S GRHNS+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  431  SMGRHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  490

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYWLLA LGVIN V+YLIC+ 
Sbjct  491  SLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINIVIYLICAT  550

Query  346  WFKPRKNKSAVEMETVMNGN-GEEKC  272
            W+KPRK KSA++ME     N  EEKC
Sbjct  551  WYKPRKPKSAIQMENPHTKNAAEEKC  576



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 3/206 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDRI+MPLWKKWKG PGF++LQ+I++GLVLS +GMA +AL EKKRL  A 
Sbjct  382  VAAILITLAVYDRIIMPLWKKWKGKPGFSSLQKISIGLVLSIIGMAAAALAEKKRLTVAK  441

Query  700  SEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            S GRH+S+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  442  SVGRHSSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  501

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYWLLA LGVINFV+YLIC+ 
Sbjct  502  SLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINFVIYLICAT  561

Query  346  WFKPRKNKSAVEMETVMNGN-GEEKC  272
            W+KPRK KSA++ME     N  EEKC
Sbjct  562  WYKPRKAKSAIQMENPHTKNAAEEKC  587



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDRI+MPLWKKWKG PGF++LQRI++GLV S +GMA +AL EKKRL  A 
Sbjct  378  VAAILITLAVYDRIIMPLWKKWKGKPGFSSLQRISIGLVFSIIGMAAAALAEKKRLTVAK  437

Query  700  SEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            S GRHNS+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  438  SMGRHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  497

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYWLLA LGVIN V+YLIC+ 
Sbjct  498  SLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINIVIYLICAT  557

Query  346  WFKPRKNKSAVEMETVMNGN-GEEKC  272
            W+KPRK KSA++ME     N  EEKC
Sbjct  558  WYKPRKPKSAIQMENPHTKNAAEEKC  583



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILI+LA+YDR +MPLW+K KG PGFT+LQ+IA+GLVLST+GMA++AL++ KRL+ A 
Sbjct  374  VSAILISLAIYDRFIMPLWQKLKGKPGFTSLQKIAIGLVLSTIGMAIAALVDLKRLSVAK  433

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  434  SVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  492

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + S+GG  WLADNINY RLD FY LLA LGVINF +YLI +IWF
Sbjct  493  LGFFFSSFLVSIIKKVTGSNGGDGWLADNINYARLDCFYGLLAILGVINFALYLIAAIWF  552

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KPRK+KSAV+METV NGN  ++KC
Sbjct  553  KPRKSKSAVQMETVKNGNAADDKC  576



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 177/206 (86%), Gaps = 3/206 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILI+LA YDRI+MPLWK WKG PGFTNLQRI++GLVLST+GMA +AL+E+KRL+ A 
Sbjct  376  VAAILISLAAYDRIIMPLWKTWKGKPGFTNLQRISIGLVLSTLGMAAAALVERKRLSVAK  435

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G    TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  436  AVGGDTLTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  495

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLV VVK+VT ++ GGQ WLADNINYGRLD FY LLA LGV+NFVVYLIC++W+
Sbjct  496  GFFVSSFLVMVVKRVTGSNGGGQGWLADNINYGRLDCFYGLLAVLGVVNFVVYLICALWY  555

Query  340  KPRKN--KSAVEMETVMNGN-GEEKC  272
            KPR +   +A++ME V NG+  EEKC
Sbjct  556  KPRNSAKSAALQMENVGNGSLAEEKC  581



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 158/206 (77%), Gaps = 4/206 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKKWKG PGF++LQRIA+GLVLSTVGM V+ L E KRL+ A 
Sbjct  379  VAAILITLAVYDRLIMPLWKKWKGKPGFSSLQRIAIGLVLSTVGMGVATLAEMKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  R +S L +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  SVSRSSSNLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  ++S+GGQ WLADNINYGRLD FY LLA LG+IN V+YLIC++W+
Sbjct  498  LGFFVSSFLVSVIKKVTSSNGGQGWLADNINYGRLDCFYGLLAVLGIINLVIYLICAVWY  557

Query  340  KPR---KNKSAVEMETVMNGNGEEKC  272
            KP    K + A++ME   NG+GEE+C
Sbjct  558  KPDQKPKPQPALQMEAKFNGSGEERC  583



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 169/204 (83%), Gaps = 6/204 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLALYDRI+MPLWKKWKG PGFTNLQRIA+GLVLS +GMA +AL E+KRL  A 
Sbjct  371  VAAILITLALYDRIIMPLWKKWKGKPGFTNLQRIAIGLVLSVIGMAAAALAEQKRLTVAK  430

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVF LIPQFF VG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  431  SAGRNTSTLPISVFLLIPQFFFVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  490

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLVSV+KK T  +   Q WLADNINYGRLDLFYWLLA LGVINF +YL  + W+
Sbjct  491  GFFISSFLVSVIKKATKTNATAQGWLADNINYGRLDLFYWLLAALGVINFAIYLNSATWY  550

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            KPRK KS +      NG G ++KC
Sbjct  551  KPRKPKSPIP-----NGYGAQDKC  569



>ref|XP_011648676.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis sativus]
 gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MPLWKKWKG PGFTNLQRIA+GL+LST GMA +AL+E KRL+ A 
Sbjct  379  VAAILITLAFYDRLIMPLWKKWKGQPGFTNLQRIAIGLILSTFGMAAAALVEMKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  AVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNINY RLD FY LL  L  INFV +L+C+IW+
Sbjct  498  LGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSTINFVAFLVCAIWY  557

Query  340  KPRKNKSAVEMETVMN-GNGEEKC  272
            KP+K K  +EMET  N G+G EKC
Sbjct  558  KPQKPKQLLEMETSTNGGSGAEKC  581



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MPLWKKWKG PGFTNLQRIA+GL+LST GMA +AL+E KRL+ A 
Sbjct  379  VAAILITLAFYDRLIMPLWKKWKGQPGFTNLQRIAIGLILSTFGMAAAALVEIKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  AVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNINY RLD FY LL  L  INFV +L+C+IW+
Sbjct  498  LGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSAINFVAFLVCAIWY  557

Query  340  KPRKNKSAVEMETVMN-GNGEEKC  272
            KP+K K  +EMET  N G+G EKC
Sbjct  558  KPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR++MPLWKKWKG PGFTNLQR+A+GLVLS VGMA +AL+E+KRL+ A 
Sbjct  358  VSAILITLAVYDRLIMPLWKKWKGKPGFTNLQRMAIGLVLSIVGMAAAALVERKRLSVAR  417

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM +     T   
Sbjct  418  AVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM-STGLFLTTLS  476

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S GG  WLADNIN GRLDLFY LLA L +IN V+YLIC++W+
Sbjct  477  LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWY  536

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KP+K K+ ++MET + G + EEKC
Sbjct  537  KPKKPKAGIQMETYVKGSSAEEKC  560



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MPLWKKWKG PGF+NLQR+A+GLVLST+GMA +AL E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPLWKKWKGKPGFSNLQRMAIGLVLSTLGMAAAALAEQKRLSVAK  438

Query  700  S-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            S    H+ TL +SVF+L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLS
Sbjct  439  SVTTAHSKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLS  498

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFFVSSFLVSVVKKVT +S  GQ WLADNIN+GRLD FYWLLA L  IN VVY+IC+ W
Sbjct  499  LGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDRFYWLLAVLSGINIVVYMICAFW  558

Query  343  FKPRKNKSAVEMETVMNGNGEEKC  272
            FKPRK K AVEM +    + EE C
Sbjct  559  FKPRKGKGAVEMASGKGFSVEENC  582



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAIL+TLA+YDR +MPLWKKWKG PGF+NLQR+A+GLV+STVGMA +AL E+KRL+ A 
Sbjct  379  VAAILVTLAVYDRAIMPLWKKWKGKPGFSNLQRMAIGLVMSTVGMAAAALAEQKRLSVAK  438

Query  700  S-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            S    +N TL +SVF+L+PQFFLVGSGEAF+YTGQLDFFLTQSPK MKTMSTGLFLTTLS
Sbjct  439  SVTHNYNKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFLTQSPKGMKTMSTGLFLTTLS  498

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFFVSSFLVSVVKKVT +S  GQ WLADNIN+GRLD FYWLLA L  INFVVY++C++W
Sbjct  499  LGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDCFYWLLAVLSGINFVVYMVCALW  558

Query  343  FKPRKNKSAVEMETVMNGNGEEKC  272
            FKPRK K A+EM      + E+ C
Sbjct  559  FKPRKGKGALEMADGKGFSVEDNC  582



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 158/204 (77%), Gaps = 5/204 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITL +YDR +MPLW+K KG PGFT+LQ+IA+GLVLST+GM ++AL+E KRL+ A 
Sbjct  375  VSAILITLIIYDRFIMPLWQKLKGKPGFTSLQKIAIGLVLSTMGMGIAALVEMKRLSVAK  434

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  435  STGRNLSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTM-STGLFLTTLA  493

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + S+GG DWLADNINYGRLD FY LLA LGVINFV+Y+IC+ WF
Sbjct  494  LGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLLAILGVINFVLYIICATWF  553

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KPRK+K    MET+ NGN  E+KC
Sbjct  554  KPRKDK---YMETINNGNVVEDKC  574



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR++MPLWKKWKG PGFTNLQR+A+GLVLS VGMA +AL+E+KRL+ A 
Sbjct  363  VSAILITLAVYDRLIMPLWKKWKGKPGFTNLQRMAIGLVLSIVGMAAAALVERKRLSVAR  422

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM +     T   
Sbjct  423  AVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM-STGLFLTTLS  481

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S GG  WLADNIN GRLDLFY LLA L +IN V+YLIC++W+
Sbjct  482  LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWY  541

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KP+K K+ ++MET + G + EEKC
Sbjct  542  KPKKPKAGIQMETYVKGSSAEEKC  565



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR++MPLWKKWKG PGFTNLQR+A+GLVLS VGMA +AL+E+KRL+ A 
Sbjct  373  VSAILITLAVYDRLIMPLWKKWKGKPGFTNLQRMAIGLVLSIVGMAAAALVERKRLSVAR  432

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM +     T   
Sbjct  433  AVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM-STGLFLTTLS  491

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S GG  WLADNIN GRLDLFY LLA L +IN V+YLIC++W+
Sbjct  492  LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWY  551

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KP+K K+ ++MET + G + EEKC
Sbjct  552  KPKKPKAGIQMETYVKGSSAEEKC  575



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MPLWKKWKG PGFTNLQRIA+GL+LST GMA +AL+E KRL+ A 
Sbjct  379  VAAILITLAFYDRLIMPLWKKWKGQPGFTNLQRIAIGLILSTFGMAAAALVEMKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  AVGISTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNINY RLD FY LLA L  INFV +L+C++W+
Sbjct  498  LGFFVSSFLVAVVKRVTGSMDGQGWLADNINYARLDCFYGLLAILSAINFVAFLVCAVWY  557

Query  340  KPRKNKSAVEMETVMN-GNGEEKC  272
            KP+K K  +EMET  N G+G EKC
Sbjct  558  KPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR++MPLWKKWKG PGFTNLQR+A+GLVLS VGMA +AL+E+KRL+ A 
Sbjct  373  VSAILITLAVYDRLIMPLWKKWKGKPGFTNLQRMAIGLVLSIVGMAAAALVERKRLSVAR  432

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM +     T   
Sbjct  433  AVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM-STGLFLTTLS  491

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S GG  WLADNIN GRLDLFY LLA L +IN V+YLIC++W+
Sbjct  492  LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWY  551

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KP+K K+ ++MET + G + EEKC
Sbjct  552  KPKKPKAGIQMETYVKGSSAEEKC  575



>gb|KJB07736.1| hypothetical protein B456_001G041900 [Gossypium raimondii]
Length=581

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKK KG  GFTNLQRIA+GLVLST+GMAV+AL EKKRLA A 
Sbjct  379  VAAILITLAVYDRLIMPLWKKLKGKRGFTNLQRIAIGLVLSTLGMAVAALAEKKRLAVAR  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  TVGATTTTLPISVFMLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S+ GQ WLADNIN+GRLD FY LLA LGVINFV+YL+ ++W+
Sbjct  498  LGFFVSSFLVSVVKKVTGSNDGQGWLADNINHGRLDCFYGLLAVLGVINFVLYLVFAVWY  557

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KP+  K A++MET++NG + E KC
Sbjct  558  KPKNPKPALQMETIVNGSSAENKC  581



>gb|KJB64772.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=446

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR+VMPLWKKWKG PGF++LQRIALGL LST+GMA +A+ E KRL  A 
Sbjct  239  VAAILITLAVYDRLVMPLWKKWKGKPGFSSLQRIALGLALSTMGMASAAVAEVKRLEVAR  298

Query  700  SEGRHNS--TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            + G   +  TL ++VF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  299  ATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  358

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY LLA LGVINF +Y++ ++
Sbjct  359  SLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYGLLAVLGVINFALYIVSAV  418

Query  346  WFKPRKNKSA-VEMETVMNGN--GEEKC  272
            WFKPRK+K A ++M+T++NG+   E KC
Sbjct  419  WFKPRKSKPATLQMDTIVNGSSTAENKC  446



>gb|KJB64773.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=517

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR+VMPLWKKWKG PGF++LQRIALGL LST+GMA +A+ E KRL  A 
Sbjct  310  VAAILITLAVYDRLVMPLWKKWKGKPGFSSLQRIALGLALSTMGMASAAVAEVKRLEVAR  369

Query  700  SEGRHNS--TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            + G   +  TL ++VF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  370  ATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  429

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY LLA LGVINF +Y++ ++
Sbjct  430  SLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYGLLAVLGVINFALYIVSAV  489

Query  346  WFKPRKNKSA-VEMETVMNGN--GEEKC  272
            WFKPRK+K A ++M+T++NG+   E KC
Sbjct  490  WFKPRKSKPATLQMDTIVNGSSTAENKC  517



>gb|KJB64774.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=541

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR+VMPLWKKWKG PGF++LQRIALGL LST+GMA +A+ E KRL  A 
Sbjct  334  VAAILITLAVYDRLVMPLWKKWKGKPGFSSLQRIALGLALSTMGMASAAVAEVKRLEVAR  393

Query  700  SEGRHNS--TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            + G   +  TL ++VF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  394  ATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  453

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY LLA LGVINF +Y++ ++
Sbjct  454  SLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYGLLAVLGVINFALYIVSAV  513

Query  346  WFKPRKNKSA-VEMETVMNGN--GEEKC  272
            WFKPRK+K A ++M+T++NG+   E KC
Sbjct  514  WFKPRKSKPATLQMDTIVNGSSTAENKC  541



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP+WKKW+G PGF++LQRIALGL+LS VGM  +AL E++RL+ A 
Sbjct  374  VAAILITLAVYDRFIMPMWKKWRGKPGFSSLQRIALGLILSIVGMTAAALAERRRLSVAK  433

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G + +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     +   
Sbjct  434  AVGDNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLSTLS  492

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNINYGRLD FY LLA L  INF V+L+C++W+
Sbjct  493  LGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCAVWY  552

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KP+K    ++MET+ NG+  EEKC
Sbjct  553  KPQKPNDGMQMETMANGSCPEEKC  576



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP+WKKW+G PGF++LQRIALGL+LS VGM  +AL E++RL+ A 
Sbjct  378  VAAILITLAVYDRFIMPMWKKWRGKPGFSSLQRIALGLILSIVGMTAAALAERRRLSVAK  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G + +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     +   
Sbjct  438  AVGDNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLSTLS  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNINYGRLD FY LLA L  INF V+L+C++W+
Sbjct  497  LGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCAVWY  556

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
            KP+K    ++MET+ NG+  EEKC
Sbjct  557  KPQKPNDGMQMETMANGSCPEEKC  580



>gb|KJB64775.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=586

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR+VMPLWKKWKG PGF++LQRIALGL LST+GMA +A+ E KRL  A 
Sbjct  379  VAAILITLAVYDRLVMPLWKKWKGKPGFSSLQRIALGLALSTMGMASAAVAEVKRLEVAR  438

Query  700  SEGRHNS--TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            + G   +  TL ++VF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTL
Sbjct  439  ATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  498

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY LLA LGVINF +Y++ ++
Sbjct  499  SLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYGLLAVLGVINFALYIVSAV  558

Query  346  WFKPRKNKSA-VEMETVMNGN--GEEKC  272
            WFKPRK+K A ++M+T++NG+   E KC
Sbjct  559  WFKPRKSKPATLQMDTIVNGSSTAENKC  586



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MP WKKWKG PGFTNLQRIA+GLVLS  GMA +AL EKKRLA A 
Sbjct  389  VAAILITLAVYDRVIMPFWKKWKGKPGFTNLQRIAIGLVLSIFGMAAAALAEKKRLAVAR  448

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  449  AAGATTATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  507

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S+ GQ WLADNIN+GRLD FY L+A L +INFVVYL+C+ W 
Sbjct  508  LGFFVSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAAWH  567

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KPRK K A++MET++NG + E+KC
Sbjct  568  KPRKPKPALQMETIVNGSSAEDKC  591



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MP WKKWKG PGFTNLQRIA+GLVLS  GMA +AL EKKRLA A 
Sbjct  379  VAAILITLAVYDRVIMPFWKKWKGKPGFTNLQRIAIGLVLSIFGMAAAALAEKKRLAVAR  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  AAGATTATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S+ GQ WLADNIN+GRLD FY L+A L +INFVVYL+C+ W 
Sbjct  498  LGFFVSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAAWH  557

Query  340  KPRKNKSAVEMETVMNG-NGEEKC  272
            KPRK K A++MET++NG + E+KC
Sbjct  558  KPRKPKPALQMETIVNGSSAEDKC  581



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAI+ITLA+YDR +MP WKKWKG PGF+NLQRIA+GLVLST+GMA +A+ E+KRL+ A 
Sbjct  378  VAAIMITLAVYDRFIMPFWKKWKGKPGFSNLQRIAIGLVLSTLGMAAAAITERKRLSVAA  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  438  SVGRTTTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + +  GQ WLADNINYGRLD FY LL  L ++NFV YL+C+ W 
Sbjct  497  LGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCAAWC  556

Query  340  KPRKNKSAVEMETVMNGNGEEK  275
            KP+K K  ++ E + NG+  E+
Sbjct  557  KPQKLKPTMQKEKIGNGSSMEE  578



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAI+ITLA+YDR +MP WKKWKG PGF+NLQRIA+GLVLST+GMA +A+ E+KRL+ A 
Sbjct  374  VAAIMITLAVYDRFIMPFWKKWKGKPGFSNLQRIAIGLVLSTLGMAAAAITERKRLSVAA  433

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  434  SVGRTTTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  492

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + +  GQ WLADNINYGRLD FY LL  L ++NFV YL+C+ W 
Sbjct  493  LGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCAAWC  552

Query  340  KPRKNKSAVEMETVMNGNGEEK  275
            KP+K K  ++ E + NG+  E+
Sbjct  553  KPQKLKPTMQKEKIGNGSSMEE  574



>emb|CAD33927.1| nitrate transporter [Cicer arietinum]
Length=201

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANSE  695
            AILITLA+ DRI+MPLWKK KG PGFTNLQRIA+GL+LST GMA ++L E KRL+ A S 
Sbjct  1    AILITLAVNDRIIMPLWKKMKGKPGFTNLQRIAIGLLLSTFGMAAASLCEVKRLSVAKSV  60

Query  694  GRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslgf  515
              + +T+ +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T     
Sbjct  61   KGNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLG  119

Query  514  fvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKP  335
            F  S  +  V K  + +  GQ WLADNIN GRLDLF+ LL  L  INFV +L+C+ W+KP
Sbjct  120  FFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCAFWYKP  179

Query  334  RKNKSAVEMETVMNGNG-EEKC  272
            +K K +++M  + NG+  EEKC
Sbjct  180  KKAKPSMQMGAINNGSSVEEKC  201



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MP WKKWKG PGF++LQR+A+GLVLSTVGMA +A++E+KRL+ A 
Sbjct  402  VAAILITLAFYDRVIMPFWKKWKGKPGFSSLQRMAIGLVLSTVGMAAAAIVEQKRLSVAK  461

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  462  SSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  519

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL  L  INFVVYLIC++WF
Sbjct  520  GFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLLVILSGINFVVYLICALWF  578

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KP K K + EME    G   E C
Sbjct  579  KPTKGKDSEEMEK-GKGFSVEDC  600



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILI+LA+YDR+VMPLWKKWKG PGFT+LQRIA+GLV S  GMAV++L E+KRL+ A 
Sbjct  379  VAAILISLAVYDRLVMPLWKKWKGKPGFTDLQRIAIGLVFSIFGMAVASLCERKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S   +N+TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM +     T   
Sbjct  439  SVTGNNATLPISVFLLIPQFFLVGTGEAFIYTGQLDFFITRSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + +  GQ WLADNIN GRLDLFY LL  L  +NFV +L+C++WF
Sbjct  498  LGFFVSSFLVSVVKKVTGTRDGQGWLADNINQGRLDLFYGLLTILSFVNFVAFLVCAVWF  557

Query  340  KPRKNKS-AVEMETVMNGNGEEKC  272
            KP+K K  A++M  +     EEKC
Sbjct  558  KPKKPKQPAMQMGAINGSTAEEKC  581



>ref|XP_012078774.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Jatropha curcas]
 gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 8/211 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YD ++MPLWKK+KG PGF++LQRI +GLVLST+GMA +AL E+KRL+ A 
Sbjct  376  VAAILITLAVYDVLIMPLWKKFKGKPGFSSLQRIGIGLVLSTLGMAAAALAERKRLSVAK  435

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S     STL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  436  SADGKTSTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  495

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SSFLV VVKKVT ++  GQ WL DNIN GRLD FY LLA L VINF+VYL+C++W+
Sbjct  496  GFFFSSFLVIVVKKVTGSNGTGQGWLGDNINNGRLDCFYGLLATLCVINFLVYLVCALWY  555

Query  340  KPRK------NKSA-VEMETVMNGN-GEEKC  272
            KPRK      +KSA ++ME + NG+  EEKC
Sbjct  556  KPRKKNTNNDHKSAGLQMENMGNGSLAEEKC  586



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MP WKKWKG PGF++LQR+A+GLVLSTVGMA +A++E+KRL  A 
Sbjct  403  VAAILITLAFYDRVIMPFWKKWKGKPGFSSLQRMAIGLVLSTVGMAAAAIVEQKRLLVAK  462

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +    L +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  463  SSTQK--ILPISVFQLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  520

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLLA L  INFVVY+IC++WF
Sbjct  521  GFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLLAILSGINFVVYVICALWF  579

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KP K K + EME    G   E C
Sbjct  580  KPTKGKDSEEMEK-GKGFSVEDC  601



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MP WKKWKG PGF++LQ +A+GLVLST+GMA +A++E+KRL+ A 
Sbjct  379  VAAILITLAFYDRVIMPFWKKWKGKPGFSSLQLMAIGLVLSTIGMAAAAIVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL  L  INFVVY+IC++WF
Sbjct  497  GFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLLVILSGINFVVYVICALWF  555

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KP K+K + EME    G   E C
Sbjct  556  KPTKSKDSEEMEK-GKGFSVEDC  577



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA YDR++MP WKKWKG PGF++LQ +A+GLVLST+GMA +A++E+KRL+ A 
Sbjct  389  VAAILITLAFYDRVIMPFWKKWKGKPGFSSLQLMAIGLVLSTIGMAAAAIVEQKRLSVAK  448

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  449  SSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  506

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL  L  INFVVY+IC++WF
Sbjct  507  GFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLLVILSGINFVVYVICALWF  565

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KP K+K + EME    G   E C
Sbjct  566  KPTKSKDSEEMEK-GKGFSVEDC  587



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEGKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S    + TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  ST--THKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLD FYWLL  L  +NFVVY+IC++WF
Sbjct  497  GFFVSSFLVSIVKKVTATSTDG-GWLADNINHGRLDCFYWLLVILSGVNFVVYIICALWF  555

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KP K K + E ET  N    E C
Sbjct  556  KPTKGKDSAEKET-SNSFSVEDC  577



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 167/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  497  GFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K +VE E   NG G   E C
Sbjct  556  KPTKGKDSVEKE---NGKGFSVEDC  577



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 167/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  388  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  447

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  448  SSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  505

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  506  GFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWF  564

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K +VE E   NG G   E C
Sbjct  565  KPTKGKDSVEKE---NGKGFSVEDC  586



>gb|KHN34550.1| Nitrate transporter 1.4, partial [Glycine soja]
Length=272

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 147/208 (71%), Gaps = 6/208 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKKW G PGFT+LQRIA+GLV S  GMA +++ E+KRL+ A 
Sbjct  66   VAAILITLAVYDRLIMPLWKKWNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSVAK  125

Query  700  SEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     T
Sbjct  126  SVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTM-STGLFLT  184

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
                 F  S  +  V K  + +  GQ WLAD+IN GRLDLFY LL  L  +NFV + +C+
Sbjct  185  TLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYALLTILSFVNFVAFAVCA  244

Query  349  IWFKPRKNK--SAVEMETVMNGNGEEKC  272
            +WFKP+K K  +A++M  V     EEKC
Sbjct  245  VWFKPKKPKQPAAMQMGPVNGSTAEEKC  272



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL  L  INFVVY IC++WF
Sbjct  497  GFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFVVYFICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E +   NG G   E C
Sbjct  556  KPTKGKDSAEKD---NGKGFSAEDC  577



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL  L  INF VY IC++WF
Sbjct  497  GFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E E   NG G   E C
Sbjct  556  KPTKGKDSAEKE---NGKGFAAEDC  577



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL  A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLCVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  497  GFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K +VE E   NG G   E C
Sbjct  556  KPTKGKDSVEKE---NGKGFSVEDC  577



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 157/210 (75%), Gaps = 9/210 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILI+LA+YDR+++PLWKKWKG PGF +LQRIA+GL+LST+GMA +A+ EKKRL  A 
Sbjct  382  VAAILISLAVYDRVIVPLWKKWKGKPGFNSLQRIAIGLILSTLGMAAAAMAEKKRLNVAI  441

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + GR   TL +SV++LIPQFFLVG+GEAF+YTGQLDFF+TQSPKSMKTM +     T   
Sbjct  442  AVGRDTQTLPISVYFLIPQFFLVGAGEAFIYTGQLDFFITQSPKSMKTM-STGLFLTTLS  500

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  +A    + WLAD+INYG+LD FYWLL  L +INFV +++C+IWF
Sbjct  501  LGFFLSSFLVSLIKSVTAKRNTEGWLADDINYGKLDYFYWLLTLLSLINFVAFMVCAIWF  560

Query  340  K-PRKNKSAVEMETVMNGNG------EEKC  272
            K P+KN +++ M+ V NGNG      EEKC
Sbjct  561  KPPKKNNNSISMK-VSNGNGASYGGAEEKC  589



>ref|XP_010050000.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW82844.1| hypothetical protein EUGRSUZ_C04215 [Eucalyptus grandis]
Length=535

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 1/201 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI+ITLA+ DR +MPLWKKW G PGF++LQRIA+GL LST+GM  +A+ E+KRL+ A 
Sbjct  333  VVAIMITLAVNDRFIMPLWKKWTGKPGFSSLQRIAIGLALSTLGMLAAAITERKRLSVAA  392

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  393  SVGRATTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  451

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  V K  + S G Q WLAD+INYGRLD F+ LL  L ++NFVVYL+C+ W+
Sbjct  452  LGFFLSSLLVSVVKKATGSGGRQGWLADHINYGRLDWFFGLLTILSLVNFVVYLVCAAWY  511

Query  340  KPRKNKSAVEMETVMNGNGEE  278
            KP+K K  ++ME + NG+  E
Sbjct  512  KPQKPKPTLQMEKIGNGSAME  532



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +A++E+KRL+ A 
Sbjct  372  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAAIVEQKRLSVAK  431

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  432  SSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  489

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSVVKKVTS S  G  WLADNIN+GRLD FYWLL  L  INFV Y IC++WF
Sbjct  490  GFFVSSFLVSVVKKVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFVAYFICALWF  548

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E E   NG G   E C
Sbjct  549  KPTKGKDSAEKE---NGKGFTAEDC  570



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+ DRI+MPLWKK KG PGFTNLQRIA+GL+LST GMA ++L E KRL+ A 
Sbjct  379  VAAILITLAVNDRIIMPLWKKMKGKPGFTNLQRIAIGLLLSTFGMAAASLCEVKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S   + +T+ +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  SVKGNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + +  GQ WLADNIN GRLDLF+ LL  L  INFV +L+C+ W+
Sbjct  498  LGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCAFWY  557

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            KP+K K +++M  + NG+  EEKC
Sbjct  558  KPKKAKPSMQMGAINNGSSVEEKC  581



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSV+KKVTS+S  G  WLADNIN+GRLD FYWLL  L  INF VY IC++WF
Sbjct  497  GFFVSSFLVSVIKKVTSSSTDG-GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E E   NG G   E C
Sbjct  556  KPTKGKDSAEKE---NGKGFSAEDC  577



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 1/201 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI+ITLA+ DR +MPLWKKW G PGF++LQRIA+GL LST+GM  +A+ E+KRL+ A 
Sbjct  378  VVAIMITLAVNDRFIMPLWKKWTGKPGFSSLQRIAIGLALSTLGMLAAAITERKRLSVAA  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  438  SVGRATTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  V K  + S G Q WLAD+INYGRLD F+ LL  L ++NFVVYL+C+ W+
Sbjct  497  LGFFLSSLLVSVVKKATGSGGRQGWLADHINYGRLDWFFGLLTILSLVNFVVYLVCAAWY  556

Query  340  KPRKNKSAVEMETVMNGNGEE  278
            KP+K K  ++ME + NG+  E
Sbjct  557  KPQKPKPTLQMEKIGNGSAME  577



>ref|XP_006408723.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 gb|ESQ50176.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=533

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILI+LA+YDR +MPLWKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  334  VAAILISLAVYDRAIMPLWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  393

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S    + T+ +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  394  SS--THKTMPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  451

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSVVK+VT+ S  G  WLADNIN GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  452  GFFVSSFLVSVVKRVTATSMDG-GWLADNINQGRLDRFYWLLVILSGINFVVYVICALWF  510

Query  340  KPRKNK-SAVEMETVMNGNGEEKC  272
            KP K K  +VEME    G   E C
Sbjct  511  KPTKGKEDSVEMEK-GKGFSVEDC  533



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 144/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL +YDR++MPLWKKWKG  GFTN+QR+A+GLVLS +GMA +AL E+KRLA A 
Sbjct  380  VAAILITLGVYDRLIMPLWKKWKGKQGFTNIQRMAIGLVLSILGMAAAALAERKRLAVAK  439

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM     L   +L
Sbjct  440  AVGGDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM--STGLFLTTL  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
                      V        + G+ WLADNINYGRLD FY LL  L +INFV +L+C IW+
Sbjct  498  SLGFFISSFLVSVVKRVTGNDGEGWLADNINYGRLDCFYGLLTILSIINFVAFLVCVIWY  557

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
             P+K K   +   ++NGN  EEKC
Sbjct  558  MPQKRKD-FQKNGIVNGNLAEEKC  580



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL  L  INF VY IC++WF
Sbjct  497  GFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E +   NG G   E C
Sbjct  556  KPTKGKDSAEKD---NGKGFSAEDC  577



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILI+LA+YDR +MPLWKKWKG PGF++LQRIA+GLVLST GMA +AL+E+KRL+ A 
Sbjct  379  VAAILISLAVYDRAIMPLWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S    + T+ +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SS--THKTMPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVSVVK+VT+ S  G  WLADNIN GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  497  GFFVSSFLVSVVKRVTATSMDG-GWLADNINQGRLDRFYWLLVILSGINFVVYVICALWF  555

Query  340  KPRKNK-SAVEMETVMNGNGEEKC  272
            KP K K  +VEME    G   E C
Sbjct  556  KPTKGKEDSVEMEK-GKGFSVEDC  578



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 143/206 (69%), Gaps = 4/206 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI+IT+  YDR++MPLWKKWKG  GFTNLQR+A+GLVLS  GMA +AL E KRL  A 
Sbjct  377  VVAIMITIVFYDRVIMPLWKKWKGEQGFTNLQRMAIGLVLSIFGMAAAALSEMKRLLVAK  436

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  437  SAAPTTQTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  495

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + S  GQ WLADNIN GRLD FY LL  LGVINF  Y++C+ W+
Sbjct  496  LGFFVSSFLVSVVKKVTGSRDGQGWLADNINEGRLDCFYGLLTVLGVINFAAYIVCAKWY  555

Query  340  KPRKNKSAVEMETV-MNGNGE--EKC  272
            KP+K K AV+M  +  NGN +  ++C
Sbjct  556  KPKKAKPAVQMSGINANGNNDNYDRC  581



>ref|XP_011656291.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis sativus]
 gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL +YDR++MPLWKKWKG  GFTN+QR+A+GLVLS +GMA +AL E KRL  A 
Sbjct  380  VAAILITLGVYDRLIMPLWKKWKGKQGFTNIQRMAIGLVLSILGMAAAALAESKRLGVAK  439

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTM     L   +L
Sbjct  440  AVGGDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTM--STGLFLSTL  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
                      V        + G+ WLADN+NYGRLD FY LL  L +INFV +L+C IW+
Sbjct  498  SLGFFISSFLVSVVKRVTGNDGEGWLADNVNYGRLDCFYGLLTILSIINFVAFLVCVIWY  557

Query  340  KPRKNKSAVEMETVMNGN-GEEKC  272
             P+K K   +   ++NGN  EEKC
Sbjct  558  MPQKRKD-FQKNGIVNGNLAEEKC  580



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 147/208 (71%), Gaps = 6/208 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI+ITLA YDR++MPLWKKW G PGFTNLQR+A+GLVLST+GMAV+AL E+KRL+ A 
Sbjct  379  VLAIMITLAFYDRLIMPLWKKWNGQPGFTNLQRMAIGLVLSTIGMAVAALSERKRLSVAR  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G    TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     +   
Sbjct  439  AVGGTTKTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTM-STGLFLSTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  + K  + S   Q WL DNINYGRLD FY LL  L VINFVVYL+C+ W+
Sbjct  498  LGFFVSSFLVSIVKAVTGSKDEQGWLTDNINYGRLDCFYGLLTVLSVINFVVYLVCARWY  557

Query  340  KPRK-NKSAVEM-ETVMNGNG---EEKC  272
            K  + +  A++M  T    NG   E++C
Sbjct  558  KTHEPHPPALQMTSTTAKANGSSAEDRC  585



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 147/208 (71%), Gaps = 6/208 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKKW G PGFT+LQRIA+GLV S  GMA +++ E+KRL+ A 
Sbjct  375  VAAILITLAVYDRLIMPLWKKWNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSVAK  434

Query  700  SEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     T
Sbjct  435  SVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTM-STGLFLT  493

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
                 F  S  +  V K  + +  GQ WLAD+IN GRLDLFY LL  L  +NFV + +C+
Sbjct  494  TLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYALLTILSFVNFVAFAVCA  553

Query  349  IWFKPRKNK--SAVEMETVMNGNGEEKC  272
            +WFKP+K K  +A++M  V     EEKC
Sbjct  554  VWFKPKKPKQPAAMQMGPVNGSTAEEKC  581



>ref|XP_011458172.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 142/204 (70%), Gaps = 7/204 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA+ DRI+MP+WKKWKG PGFTNLQRIA+GLVLST+GMA +AL EKKRL  A 
Sbjct  382  VLAILITLAVNDRIIMPVWKKWKGQPGFTNLQRIAIGLVLSTLGMAAAALTEKKRLLVAK  441

Query  700  S-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
              +      L +SV++LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     +  
Sbjct  442  GMKTMSTGALPISVYWLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLSTI  500

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
               F  S  +  + +  + S  GQ WLADNINYGRLD FY LL+ L VINFV YL+C+ W
Sbjct  501  ALGFFVSSFLVSIVRRFTGSKDGQGWLADNINYGRLDCFYGLLSVLSVINFVAYLVCARW  560

Query  343  FKPRKNKSAVEMETVMNGNGEEKC  272
            +KPRK             + E+KC
Sbjct  561  YKPRKPTKPSN-----GSSAEDKC  579



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 142/189 (75%), Gaps = 4/189 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA-  704
            VAAILITLA+YDRI+MPLW KWKG  GF++LQ+IA+GLVLST+GMAV+AL+E KRL+ A 
Sbjct  377  VAAILITLAVYDRIIMPLWNKWKGKTGFSSLQKIAIGLVLSTLGMAVAALVEMKRLSVAK  436

Query  703  --NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
              N+    +  + +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T
Sbjct  437  SVNNNTTADDHVPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLT  495

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
                 F  S  +  V K  + S+GGQ WLADNIN+GRLD FY LLA LG +N ++YLIC+
Sbjct  496  TLSLGFFVSSFLVSVVKKVTTSNGGQGWLADNINHGRLDCFYGLLAVLGFVNLIIYLICA  555

Query  349  IWFKPRKNK  323
             W+KP K K
Sbjct  556  AWYKPHKPK  564



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKKW G PGFT+LQRIA+GLV S  GMA +++ E+KRL+ A 
Sbjct  379  VAAILITLAVYDRLIMPLWKKWNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSVAK  438

Query  700  SEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     T
Sbjct  439  SVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTM-STGLFLT  497

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
                 F  S  +  V K  + +  GQ WLAD+IN GRLDLFY LL  L  +NF  + +C+
Sbjct  498  TLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYALLTILSFVNFAAFAVCA  557

Query  349  IWFKPRKNK--SAVEMETVMNGNGEEKC  272
            +WFKP+K K  +A++M  V     EEKC
Sbjct  558  VWFKPKKPKQPAAMQMGPVNGSTAEEKC  585



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR +MP WKKWKG PGF++LQRIA+GLVLST GMA +A+ E+KRL+ A 
Sbjct  379  VAAILITLAVYDRAIMPFWKKWKGKPGFSSLQRIAIGLVLSTAGMAAAAIAEQKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  439  SSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSSFLVS+VK+VTS S  G  WLADNIN+GRLD FYWLL  L  INFVVY+IC++WF
Sbjct  497  GFFVSSFLVSIVKRVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFVVYIICALWF  555

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP K K + E E   NG G   E C
Sbjct  556  KPTKGKDSAEKE---NGKGFSVEDC  577



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITLA+YDR++MPLWKKW G PGFT+LQRIA+GLV S  GMA +++ E+KRL+AA 
Sbjct  379  VAAILITLAVYDRLIMPLWKKWNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSAAK  438

Query  700  --SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
              S G   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     T 
Sbjct  439  SVSGGNQATTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTM-STGLFLTT  497

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
                F  S  +  V K  + +  GQ WLADNIN GRLDLFY LL  L  INFV + +C++
Sbjct  498  LSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFYALLTILSFINFVAFAVCAL  557

Query  346  WFKPRKNK  323
            WFKP+K K
Sbjct  558  WFKPKKPK  565



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 147/205 (72%), Gaps = 7/205 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AIL+TLA+ DRI+MPLWKK  G PGF+NLQRIA+GL+LST+GMA ++LIE KRL+ A 
Sbjct  378  VVAILLTLAVNDRIIMPLWKKLNGKPGFSNLQRIAIGLLLSTIGMAAASLIEVKRLSVAK  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
                + +TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  438  GVKGNQTTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLS  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S  +  V K  + +  GQ WLAD+IN GRLDLFY LL  L  INFV +L+C+ W+
Sbjct  497  LGFFVSSFLVSVVKKVTGTRDGQGWLADHINKGRLDLFYALLTILSFINFVAFLVCAFWY  556

Query  340  KPRKNKSAVEMETVMNGNG--EEKC  272
            KP+K K +++    +NG+   EEKC
Sbjct  557  KPKKPKPSMQ----INGSSSVEEKC  577



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 2/199 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI ITLA  DR++MPLWKKW G PGFTNLQRIA+GLVLST+GMA +AL E+KRL+ A 
Sbjct  384  VLAIXITLAFNDRVIMPLWKKWNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKRLSVAK  443

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     +   
Sbjct  444  SARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTM-STGLFLSTLS  502

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  +    + +  GQ WLA+NINYGRLD FY LL  L VINFV YL+C+ W+
Sbjct  503  LGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLLTVLSVINFVAYLVCARWY  562

Query  340  KPRKNKSAVEMETVMNGNG  284
                 + A  ++T  + NG
Sbjct  563  HKTHKQHAFVLQTA-SANG  580



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 2/199 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI ITLA  DR++MPLWKKW G PGFTNLQRIA+GLVLST+GMA +AL E+KRL+ A 
Sbjct  384  VLAIXITLAFNDRVIMPLWKKWNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKRLSXAK  443

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     +   
Sbjct  444  SARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTM-STGLFLSTLS  502

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  +    + +  GQ WLA+NINYGRLD FY LL  L VINFV YL+C+ W+
Sbjct  503  LGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLLTVLSVINFVAYLVCARWY  562

Query  340  KPRKNKSAVEMETVMNGNG  284
                 + A  ++T  + NG
Sbjct  563  HKTHKQHAFVLQTA-SANG  580



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 148/205 (72%), Gaps = 3/205 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA+YD +++ LWKKWKG PGFT+LQRIA+GLVLSTVGM  ++L E KRL+ A 
Sbjct  375  VGAILITLAVYDCLIIRLWKKWKGKPGFTSLQRIAIGLVLSTVGMTAASLAEVKRLSVAK  434

Query  700  SEGRHNS-TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
              G   S TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     +  
Sbjct  435  DVGGTTSTTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLSTL  493

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
               F  S L+  V K  + S+ GQ WLADNIN GRLD FY LLA    INF+++L+C++W
Sbjct  494  SLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCTVW  553

Query  343  FKPRKNKSAVEMETVMNG-NGEEKC  272
            +K +K + ++++E   NG + EE C
Sbjct  554  YKKQKPQRSLQIEIAANGSSAEEIC  578



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 148/205 (72%), Gaps = 3/205 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA+YD +++ LWKKWKG PGFT+LQRIA+GLVLSTVGM  ++L E KRL+ A 
Sbjct  379  VGAILITLAVYDCLIIRLWKKWKGKPGFTSLQRIAIGLVLSTVGMTAASLAEVKRLSVAK  438

Query  700  SEGRHNS-TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
              G   S TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     +  
Sbjct  439  DVGGTTSTTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLSTL  497

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
               F  S L+  V K  + S+ GQ WLADNIN GRLD FY LLA    INF+++L+C++W
Sbjct  498  SLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCTVW  557

Query  343  FKPRKNKSAVEMETVMNG-NGEEKC  272
            +K +K + ++++E   NG + EE C
Sbjct  558  YKKQKPQRSLQIEIAANGSSAEEIC  582



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 137/198 (69%), Gaps = 2/198 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI+ITLA  DR++MPLWKKW G PGFTNLQRIA+GLVLST+GMA +AL E+KRL+ A 
Sbjct  379  VLAIMITLAFNDRVIMPLWKKWNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+SPK MKTM +     +   
Sbjct  439  SARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTM-STGLFLSTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW-  344
              F  S L+  + K  + +  GQ WLADNINYGRLD FY LL  L VINFV YL+C+ W 
Sbjct  498  LGFFVSSLLVSIVKSVTGNEDGQGWLADNINYGRLDCFYGLLTVLSVINFVAYLVCARWS  557

Query  343  FKPRKNKSAVEMETVMNG  290
             K  K  + V      NG
Sbjct  558  HKTHKQHAFVLQMASANG  575



>ref|XP_006483349.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
Length=536

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL  YDR+++PL KK KG PGF+NLQ IA+GL LS +GMA ++++E KRLA A 
Sbjct  334  VAAILITLGAYDRLIIPLLKKRKGKPGFSNLQLIAIGLFLSALGMASASVVEVKRLAVAK  393

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQSPK MKTM +     T   
Sbjct  394  ANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTM-STGLFLTTLS  452

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S+G   W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  453  LGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWY  512

Query  340  KPRKNKSAVEMETVMNGNGEEK  275
            K +K K   EME ++ G+  E+
Sbjct  513  KRKKAKQVPEMEIIVKGSSVEE  534



>ref|XP_006450457.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
 gb|ESR63697.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
Length=467

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 2/203 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL  YDR+++PL KK KG PGF+NLQ IA+GL LS +GMA ++++E  RLA A 
Sbjct  265  VAAILITLGAYDRLIIPLLKKRKGKPGFSNLQLIAIGLFLSALGMASASVVEVNRLAVAK  324

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQSPK MKTM +     T   
Sbjct  325  ANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTM-STGLFLTTLS  383

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S+G   W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  384  LGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWY  443

Query  340  KPRKNKSAVEMETVMNGNG-EEK  275
            K +K K   EME ++ G+  EEK
Sbjct  444  KRKKAKQVPEMEIIVKGSSVEEK  466



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL  YDR+++PL KK KG PGF+NLQ IA+GL LS +GMA ++++E KRLA A 
Sbjct  379  VAAILITLGAYDRLIIPLLKKRKGKPGFSNLQLIAIGLFLSALGMASASVVEVKRLAVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  ANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S+G   W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  498  LGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWY  557

Query  340  KPRKNKSAVEMETVMNGNGEEK  275
            K +K K   EME ++ G+  E+
Sbjct  558  KRKKAKQVPEMEIIVKGSSVEE  579



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILITL  YDR+++PL KK KG PGF+NLQ IA+GL LS +GMA ++++E KRLA A 
Sbjct  379  VAAILITLGAYDRLIIPLLKKRKGKPGFSNLQLIAIGLFLSALGMASASVVEVKRLAVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQSPK MKTM +     T   
Sbjct  439  ANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTM-STGLFLTTLS  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S+G   W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  498  LGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWY  557

Query  340  KPRKNKSAVEMETVMNGNGEEK  275
            K +K K   EME ++ G+  E+
Sbjct  558  KRKKAKQVPEMEIIVKGSSVEE  579



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 157/207 (76%), Gaps = 7/207 (3%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANSE  695
            AILITLA+YDR++MPL KKWKG  GF+NLQRI +GL LS +GMA +A+ E KRL+ A   
Sbjct  384  AILITLAVYDRMIMPLLKKWKGKQGFSNLQRIGIGLALSVIGMAAAAVAEVKRLSVARGA  443

Query  694  G-----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            G        +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTT
Sbjct  444  GPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDFFITRSPKGMKTMSTGLFLTT  503

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFF+SSFLVSVVK +T   H G  WLADNINYGRLD FY LLA L  IN   +L+C+
Sbjct  504  LSLGFFLSSFLVSVVKSLTGGKH-GNGWLADNINYGRLDCFYGLLAVLSAINLGAFLVCA  562

Query  349  IWFKPRKNKSAVEMET-VMNGNGEEKC  272
             W KP+  K  ++ E+ V + + +++C
Sbjct  563  AWSKPQAAKPGLQTESAVKSSSADDEC  589



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 157/207 (76%), Gaps = 7/207 (3%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANSE  695
            AILITLA+YDR++MPL KKWKG  GF+NLQRI +GL LS +GMA +A+ E KRL+ A   
Sbjct  380  AILITLAVYDRMIMPLLKKWKGKQGFSNLQRIGIGLALSVIGMAAAAVAEVKRLSVARGA  439

Query  694  G-----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            G        +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTT
Sbjct  440  GPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDFFITRSPKGMKTMSTGLFLTT  499

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFF+SSFLVSVVK +T   H G  WLADNINYGRLD FY LLA L  IN   +L+C+
Sbjct  500  LSLGFFLSSFLVSVVKSLTGGKH-GNGWLADNINYGRLDCFYGLLAVLSAINLGAFLVCA  558

Query  349  IWFKPRKNKSAVEMET-VMNGNGEEKC  272
             W KP+  K  ++ E+ V + + +++C
Sbjct  559  AWSKPQAAKPGLQTESAVKSSSADDEC  585



>ref|XP_007011887.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29506.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=553

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA+YDR+VMPLWKKWKG PGFTNLQRIA+GL LS VGMA +A+ E KRL+ A 
Sbjct  352  VGAILITLAVYDRLVMPLWKKWKGKPGFTNLQRIAIGLFLSAVGMAAAAVAEVKRLSVAK  411

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
             +    +TL ++VF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  412  -QSSETTTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLA  469

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S G Q W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  470  LGFFLSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAAWY  529

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            + +  K   E+E +   +  EEKC
Sbjct  530  RKKTVKRDPELEIIAKESTIEEKC  553



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA+YDR+VMPLWKKWKG PGFTNLQRIA+GL LS VGMA +A+ E KRL+ A 
Sbjct  467  VGAILITLAVYDRLVMPLWKKWKGKPGFTNLQRIAIGLFLSAVGMAAAAVAEVKRLSVAK  526

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
             +    +TL ++VF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +     T   
Sbjct  527  -QSSETTTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STGLFLTTLA  584

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + S G Q W+ +NIN GRLD FY LLA L  INF ++L+C+ W+
Sbjct  585  LGFFLSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAAWY  644

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            + +  K   E+E +   +  EEKC
Sbjct  645  RKKTVKRDPELEIIAKESTIEEKC  668



>gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT--PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAA  707
            V  ILITLA+YDR+V PL++++  +  P  +NLQRI LGL LS + MA +ALIE KRL  
Sbjct  372  VGTILITLAVYDRLVNPLYRRFSDSRQPPLSNLQRIGLGLFLSIISMASAALIEAKRLNI  431

Query  706  ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            A      +  L MSVFYL+PQFFLVGSGEAF+YTGQLDFF+TQSP  MKTMSTGLFLTTL
Sbjct  432  AKDLHDEHGPLPMSVFYLVPQFFLVGSGEAFIYTGQLDFFITQSPAGMKTMSTGLFLTTL  491

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVS+V ++T  S G   WLAD+IN GRLD FYWLL+GL ++NF VYL C+ 
Sbjct  492  SLGFFVSSMLVSMVDRITGGS-GKGGWLADDINKGRLDCFYWLLSGLSLVNFAVYLWCAA  550

Query  346  WFKPRKNKSAVEMETVMNGN  287
            WFKPR     +EME    GN
Sbjct  551  WFKPRPPPQDMEMEVADKGN  570



>ref|XP_006837800.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Amborella trichopoda]
Length=584

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT--PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAA  707
            V  ILITLA+YDR+V PL++++  +  P  +NLQRI LGL LS + MA +ALIE KRL  
Sbjct  380  VGTILITLAVYDRLVNPLYRRFSDSRQPPLSNLQRIGLGLFLSIISMASAALIEAKRLNI  439

Query  706  ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            A      +  L MSVFYL+PQFFLVGSGEAF+YTGQLDFF+TQSP  MKTMSTGLFLTTL
Sbjct  440  AKDLHDEHGPLPMSVFYLVPQFFLVGSGEAFIYTGQLDFFITQSPAGMKTMSTGLFLTTL  499

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LVS+V ++T  S G   WLAD+IN GRLD FYWLL+GL ++NF VYL C+ 
Sbjct  500  SLGFFVSSMLVSMVDRITGGS-GKGGWLADDINKGRLDCFYWLLSGLSLVNFAVYLWCAA  558

Query  346  WFKPRKNKSAVEMETVMNGN  287
            WFKPR     +EME    GN
Sbjct  559  WFKPRPPPQDMEMEVADKGN  578



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            VAAILIT A+YDR++MPL KKWKG  GFT+LQRI +GL  S +GMA +AL E KRL+ A 
Sbjct  380  VAAILITCAVYDRVIMPLMKKWKGKQGFTSLQRIGIGLSFSIMGMAAAALTEVKRLSVAR  439

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
                  +TL +SVF LIPQF  VG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  440  EAASGTTTLPISVFTLIPQFLFVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  499

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLVS VK VT     GQ WLADNINYGRLD FY LLAGL  +N   +L+C+ W 
Sbjct  500  GFFLSSFLVSFVKGVTGGKG-GQGWLADNINYGRLDCFYGLLAGLSTMNLGAFLVCAGWS  558

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            KPR            +  GE+KC
Sbjct  559  KPRVESPE------KDSCGEDKC  575



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 130/197 (66%), Gaps = 5/197 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V  ILITLA+YDR++MPL K WKG  GFTN+Q+I +GL LS +GM  +AL E KRL+ A 
Sbjct  381  VGGILITLAVYDRMIMPLLKNWKGKQGFTNIQKIGIGLTLSMIGMVAAALAEVKRLSVAR  440

Query  700  SEG----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
              G    R  +TL +SVF LIPQFFLVG+ E F+YTGQLDFF+T+SPK MKTM +     
Sbjct  441  EVGPAAARRGTTLPVSVFTLIPQFFLVGAAEGFVYTGQLDFFITRSPKGMKTM-STGLFL  499

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T     F  S  +  + K  +A   G  WLADNINYGRLD FY LLA L  +N   +L+C
Sbjct  500  TTLSLGFFVSSFLVSIVKSLTAGREGNGWLADNINYGRLDCFYGLLAVLSAVNLGAFLLC  559

Query  352  SIWFKPRKNKSAVEMET  302
            +   KP+  K+ V+ME+
Sbjct  560  AARTKPQTPKAGVQMES  576



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 155/208 (75%), Gaps = 11/208 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAA--  707
            V AILITLA+YDR++MPL KKWKG  GFTNLQRI +GL LS +GM  +A+ E KRL+   
Sbjct  381  VGAILITLAVYDRMIMPLLKKWKGKQGFTNLQRIGIGLALSVLGMVAAAVAEAKRLSVAR  440

Query  706  ---ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfl  536
               A +  R  +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFL
Sbjct  441  GAGAAAAHRGGTTLPISVFTLIPQFFLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFL  500

Query  535  ttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TTLSLGFF+SSFLVS+VK +T   H G  WLAD+IN+GRLD FYWLLA L  IN   +++
Sbjct  501  TTLSLGFFLSSFLVSIVKTLTGGKH-GNGWLADDINHGRLDCFYWLLAVLSAINLGAFIV  559

Query  355  CSIWFKPRKNKSAVEMETVMNGNGEEKC  272
             + W KP+  KS  +  +V     +++C
Sbjct  560  SAAWTKPQAAKSVAKSYSV-----DDQC  582



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLA---  710
            V AILITLA+YDR++MP+ K+WKG  GFTNLQ+I +GL LS +GM  +AL E KRL+   
Sbjct  380  VGAILITLAIYDRMIMPVLKRWKGKQGFTNLQKIGIGLTLSVIGMVAAALAEVKRLSVAR  439

Query  709  --AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfl  536
               A +  R  +TL +SVF LIPQFFLVG+GE F+YTGQLDFF+T+SPK MKTMSTGLFL
Sbjct  440  RVGAAAASRGGTTLPVSVFTLIPQFFLVGAGEGFVYTGQLDFFITRSPKGMKTMSTGLFL  499

Query  535  ttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TTLSLGFFVSS LVS+V  +T   H G  WLADNIN GRLD FY LLA LG +N   +L+
Sbjct  500  TTLSLGFFVSSLLVSIVNSLTGGKH-GNGWLADNINNGRLDCFYGLLAVLGAVNLGAFLL  558

Query  355  CSIWFKPRKNKSAVEMET  302
            C+   KP+  ++ ++ME+
Sbjct  559  CAARTKPQTPQAGLQMES  576



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 152/194 (78%), Gaps = 9/194 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILITLA  DRI+MPLW + KG  GF++LQR+ +GLVLST+GM  +AL+E KRL A+ 
Sbjct  337  VLAILITLAFNDRIIMPLWTRIKGQQGFSSLQRMGIGLVLSTIGMVAAALVETKRLKAS-  395

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
                 +S+  +SVF LIPQFFL+GSGEAF+YTGQLDFF+TQSPK MKTMST LFLTTL+L
Sbjct  396  -----SSSRNLSVFLLIPQFFLLGSGEAFIYTGQLDFFITQSPKGMKTMSTALFLTTLAL  450

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLV+VVK++T++S  G  WLA NI+ GRLD FY LLA LG +NF VYL+C+  +
Sbjct  451  GFFLSSFLVTVVKQITASSSRG-GWLAGNIDRGRLDCFYGLLAALGGLNFAVYLVCAAKY  509

Query  340  KPRKNK--SAVEME  305
            K +K K    VE+E
Sbjct  510  KYQKPKHEQVVELE  523



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 7/209 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TL +YDR +MPL KKWKG  GFTNLQRI +GL  S +GMA +A+ E KRL+ A 
Sbjct  376  VGAIMVTLGIYDRAIMPLMKKWKGKQGFTNLQRIGIGLAFSIIGMAAAAVAEAKRLSVAR  435

Query  700  SEGR----HNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
              G       +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLT
Sbjct  436  RAGEGAALRGATLPISVFTLIPQFFLVGAGEAFLYTGQLDFFITRSPKGMKTMSTGLFLT  495

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLS GFF+SSF+VSVV+ VT   + GQ WLADNINYGRLD FY LLA L  +N   +L+C
Sbjct  496  TLSFGFFLSSFMVSVVRDVTGGKN-GQGWLADNINYGRLDYFYGLLAALSTLNMGAFLVC  554

Query  352  SIWFKPRKNKSAVEMET--VMNGNGEEKC  272
            ++W K       ++M +  + + + E+ C
Sbjct  555  AMWIKQENPNQGLQMGSAALKSSSMEDTC  583



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 10/203 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G PGFTNL++I +GLVLS +GM  +A+ EKKRL  A 
Sbjct  438  VGAIMLTLAVYDRVFIPLCRNLTGRPGFTNLEKIGIGLVLSIIGMVAAAICEKKRLTVA-  496

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S   + + L +SVF LIPQF LVG+GEAF+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSL
Sbjct  497  STATNGTALPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKSMKTMSTGLFLTTLSL  556

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SS LVS+V        G   WL D IN+ RLD FYWLLA LG IN   YL+C++W 
Sbjct  557  GFFLSSALVSLV-------RGATTWLGDTINHSRLDYFYWLLAVLGAINLAAYLLCAMWA  609

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
             P  +  A +         +EKC
Sbjct  610  TPAASSKAEQPHHA--AAADEKC  630



>gb|EMS53820.1| Nitrate transporter 1.4 [Triticum urartu]
Length=542

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 10/203 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G PGFTNL++I +GLVLS +GM  +A+ EKKRL  A 
Sbjct  350  VGAIMLTLAVYDRVFIPLCRNLTGRPGFTNLEKIGIGLVLSIIGMVAAAICEKKRLTVA-  408

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S   + +TL +SVF LIPQF LVG+GEAF+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSL
Sbjct  409  STATNGTTLPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKSMKTMSTGLFLTTLSL  468

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SS LVS+V        G   WL D IN+ RL+ FYWLLA LG +N   YL+C++W 
Sbjct  469  GFFLSSALVSLV-------RGATTWLGDTINHSRLNYFYWLLAVLGTLNLAAYLLCAMWA  521

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
             P  +  A +         +EKC
Sbjct  522  TPAASSKAEQPHPAT--AADEKC  542



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILI+LA+YDR ++PL KKW+G PGFTNLQ I +GL LS +GMA +A++E KRL+ A 
Sbjct  378  VGAILISLAVYDRFIIPLCKKWRGEPGFTNLQLIGIGLFLSAMGMAAAAVVEVKRLSVAK  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
             +    +TL ++VFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  438  -KYNETTTLPITVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+VK  T +S   Q WL ++IN GRLD FY LLA L  +NF ++L+ ++WF
Sbjct  497  GFFFSSLLVSIVKATTGSSD-KQGWLGEHINKGRLDCFYGLLAALSFLNFGLFLLSAVWF  555

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            + +  K A +ME V+  +  EEKC
Sbjct  556  RKKTVKQAPKMEIVVKESTIEEKC  579



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 133/208 (64%), Gaps = 6/208 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILITLA+YDR++MP  KKWKG  GFTNLQRI LGL LS + MA +AL E KRL+ A 
Sbjct  377  VSAILITLAIYDRVIMPAMKKWKGKQGFTNLQRIGLGLTLSIMAMASAALTEVKRLSVAR  436

Query  700  SEGR----HNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
              G+      + L +SVF L+PQFFLVGSGEA +YTGQLDFF+T+SPK MKTM +     
Sbjct  437  EAGKAAAPRGAALPISVFTLVPQFFLVGSGEALIYTGQLDFFITRSPKGMKTM-STGLFL  495

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T     F  S  +  + K  +    GQ WLADNIN+GRLD FY LLA L  +N   +L C
Sbjct  496  TTLSLGFFLSSFIVSIVKSVTGGESGQGWLADNINHGRLDYFYGLLAALSALNLAAFLYC  555

Query  352  SIWFKPRKNKSAVEMETVM-NGNGEEKC  272
            + W KP      +EM +   N   E+KC
Sbjct  556  ATWIKPENAGDGLEMASAAKNSPAEDKC  583



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLA-A  707
            V AI++TLA+YDR+ +PL +    G  G TNL++I +GLVLS  GMA +A+ EKKRLA A
Sbjct  396  VGAIMLTLAVYDRVFVPLCRSLMTGRQGLTNLEKIGMGLVLSIAGMAAAAICEKKRLAVA  455

Query  706  ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            A + G+H S L +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTL
Sbjct  456  ATAAGQHES-LPISVFMLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTL  514

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SS LVS+V        G   WL D IN+ RLD FYWLLA L V+N V YL+C++
Sbjct  515  SLGFFLSSALVSLV-------KGCTTWLGDTINHSRLDYFYWLLAVLSVVNLVAYLVCAM  567

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W  P  +  A + +  M  +  EKC
Sbjct  568  WTTPPASSQAEQPQIAMTAD--EKC  590



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 138/203 (68%), Gaps = 10/203 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLALYDRI +PL +   G  GFT+L++I +GL LS  GMA +A+ EKKRLA A 
Sbjct  435  VGAIMLTLALYDRIFIPLCRILTGRQGFTSLEKIGIGLALSIAGMAAAAVCEKKRLAVAA  494

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +     + L +SVF LIPQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFL TLSL
Sbjct  495  AASTDTAVLPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLATLSL  554

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SS LVS+V        G   WL D IN+ RLD FYWLLA LG +N   YL+C++W 
Sbjct  555  GFFLSSALVSLV-------KGATTWLGDTINHSRLDYFYWLLAVLGAVNLAAYLLCAMWA  607

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
             P    S  +         +EKC
Sbjct  608  TPAAGSSKADPAAT---AADEKC  627



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 142/204 (70%), Gaps = 13/204 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G PGFTNL++I +GLVLS  GM  +A+ EKKRL  A+
Sbjct  383  VGAIMLTLAVYDRVFIPLCRNLTGRPGFTNLEKIGIGLVLSIAGMVAAAVTEKKRLTVAS  442

Query  700  SEGRHNST-LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +    N T L ++VF LIPQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLS
Sbjct  443  TATTMNGTALPITVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLS  502

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF+SS LVS+V        G   WL D IN+ RLD FYWLLA LG +N   YL+C++W
Sbjct  503  LGFFLSSALVSLV-------RGATTWLGDTINHSRLDYFYWLLAVLGALNLAAYLLCAMW  555

Query  343  FKPRKNKSAVEMETVMNGNGEEKC  272
              P     A +       + +EKC
Sbjct  556  ATPAAGSKAEQQP-----HPDEKC  574



>gb|KJB82816.1| hypothetical protein B456_013G215400 [Gossypium raimondii]
Length=579

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AILI+LA+YDR ++PL KKW+G PGFTNLQ I +GL LS +GMA +A++E KRL+ A 
Sbjct  378  VGAILISLAVYDRFIIPLCKKWRGEPGFTNLQLIGIGLFLSAMGMAAAAVVEVKRLSVAK  437

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
             +    +TL ++VFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSL
Sbjct  438  -KYNETTTLPITVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSL  496

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+VK  T +S   Q WL ++IN GRLD FY LLA L   NF ++L+ + WF
Sbjct  497  GFFFSSLLVSIVKATTGSSD-KQGWLGEHINKGRLDCFYGLLAALSFFNFGLFLLSAAWF  555

Query  340  KPRKNKSAVEMETVMNGNG-EEKC  272
            + +  K A E E ++  +  EEKC
Sbjct  556  RKKTVKQAPETEIIVKESTIEEKC  579



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AI++TLA YDR+ +PL +    G  G TNL++I +GLVLS VGMA +A+ EKKRLA A
Sbjct  396  VGAIMLTLAFYDRVFVPLCRSLMTGRQGLTNLEKIGIGLVLSIVGMAAAAISEKKRLAVA  455

Query  703  NSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             + G   + +L +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPKSMKTMSTGLFLTTL
Sbjct  456  ATSGVAGHGSLPISVFMLTPQFLLVGAGEAFIYTGQLDFFITRSPKSMKTMSTGLFLTTL  515

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SS LVS+VK  T        WL D IN+ RLD FYWLLA L V+N V YL+C++
Sbjct  516  SLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWLLAVLSVVNLVAYLVCAM  568

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W     +  A + +  M  +  EKC
Sbjct  569  WATAPTSSQAEQPQPAMVAD--EKC  591



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLA-A  707
            V AI++TLA YDR+ +PL +    G  GFTNL++I +GLVLST GMA +A+ EKKRLA A
Sbjct  396  VGAIMLTLAFYDRVFVPLCRSLMTGRQGFTNLEKIGIGLVLSTFGMAAAAICEKKRLAVA  455

Query  706  ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            A S    + +L +SVF L PQF LVGSGEAF+YTGQLDFF+ +SPKSMKTMSTGLFLTTL
Sbjct  456  ATSVAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRSPKSMKTMSTGLFLTTL  515

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SS LVS+VK  T        WL D IN+ RLD FYWLLA LGV+N V Y++ ++
Sbjct  516  SLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWLLAVLGVVNLVAYIVYAM  568

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W     +  A + +  M  +  EKC
Sbjct  569  WAAAPASSQAEQPQHAMAAD--EKC  591



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLA-A  707
            V AI++TLA YDR+ +PL +    G  GFTNL++I +GLVLST GMA +A+ EKKRLA A
Sbjct  392  VGAIMLTLAFYDRVFVPLCRSLMTGRQGFTNLEKIGIGLVLSTFGMAAAAICEKKRLAVA  451

Query  706  ANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
            A S    + +L +SVF L PQF LVGSGEAF+YTGQLDFF+ +SPKSMKTMSTGLFLTTL
Sbjct  452  ATSVAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRSPKSMKTMSTGLFLTTL  511

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFF+SS LVS+VK  T        WL D IN+ RLD FYWLLA LGV+N V Y++ ++
Sbjct  512  SLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWLLAVLGVVNLVAYIVYAM  564

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W     +  A + +  M  +  EKC
Sbjct  565  WAAAPASSQAEQPQHAMAAD--EKC  587



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G  GFTNL++I +GL LS +GMA +AL EKKRLA A 
Sbjct  371  VGAIMLTLAVYDRVFIPLCRVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKRLAVAV  430

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  431  AATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  489

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+V        G   WL D I+  RLD FYWLLA L V+N   YL+C+ W 
Sbjct  490  GFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWA  542

Query  340  KPRKNKSAVEMET-VMNGNGEEKC  272
                  S  + +      + +EKC
Sbjct  543  ATAAATSREQQQQHTAVADADEKC  566



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G  GFTNL++I +GL LS +GMA +AL EKKRLA A 
Sbjct  371  VGAIMLTLAVYDRVFIPLCRVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKRLAVAV  430

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  431  AATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  489

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+V        G   WL D I+  RLD FYWLLA L V+N   YL+C+ W 
Sbjct  490  GFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWA  542

Query  340  KPRKNKSAVEMET-VMNGNGEEKC  272
                  S  + +      + +EKC
Sbjct  543  ATAAATSREQQQQHTAVADADEKC  566



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G  GFTNL++I +GL LS +GMA +AL EKKRLA A 
Sbjct  371  VGAIMLTLAVYDRVFIPLCRVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKRLAVAV  430

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  431  AATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  489

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+V        G   WL D I+  RLD FYWLLA L V+N   YL+C+ W 
Sbjct  490  GFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWA  542

Query  340  KPRKNKSAVEMET-VMNGNGEEKC  272
                  S  + +      + +EKC
Sbjct  543  ATAAATSREQQQQHTAVADADEKC  566



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +PL +   G  GFTNL++I +GL LS +GMA +AL EKKRLA A 
Sbjct  392  VGAIMLTLAVYDRVFIPLCRVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKRLAVAV  451

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  452  AATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  510

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF SS LVS+V        G   WL D I+  RLD FYWLLA L V+N   YL+C+ W 
Sbjct  511  GFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWA  563

Query  340  KPRKNKSAVEMET-VMNGNGEEKC  272
                  S  + +      + +EKC
Sbjct  564  ATAAATSREQQQQHTAVADADEKC  587



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V A+LITLA+YDRIV+PLWKK KG  G +NLQR+ LGL+LS +GMAV+A+IE KR + A 
Sbjct  375  VLAVLITLAVYDRIVIPLWKKRKGKAGLSNLQRMGLGLLLSALGMAVAAIIELKRRSVAR  434

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +     S L +SVF LIPQF LVG+GEAF YTGQLDFF+T+SP+ MK +STGLFL T+SL
Sbjct  435  ATSEM-SVLPISVFLLIPQFLLVGAGEAFTYTGQLDFFITESPRGMKGLSTGLFLVTISL  493

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLV +V+KVT  S GG  W+ DNIN GRLD FY LL+ L  INF +YL+ + W+
Sbjct  494  GFFISSFLVLIVQKVTL-SFGGDGWIGDNINKGRLDCFYGLLSILSFINFGLYLVSARWY  552

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            K +         T   G+ EE+C
Sbjct  553  KRQMPAKPTLQVTCGKGSPEEEC  575



>ref|XP_010093702.1| Nitrate transporter 1.1 [Morus notabilis]
 gb|EXB54482.1| Nitrate transporter 1.1 [Morus notabilis]
Length=222

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 138/201 (69%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +     P G T LQRI +GLV S   M  +AL E KRL  A
Sbjct  20   VGSILLTVPVYDRIILPITRNLLNNPQGLTPLQRIGIGLVFSIFAMIAAALTEIKRLHVA  79

Query  703  NSEGRHNST---LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +S    + MSVF+L+PQFFLVGSGEAF+Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  80   RSHGLTDSATAEIPMSVFWLVPQFFLVGSGEAFIYIGQLDFFLRECPKGMKTMSTGLFLS  139

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FYWLLA L  +NFV+YL+C
Sbjct  140  TLSLGFFVSSLLVTIVHK---VTWNTKPWLPDNLNQGRLYDFYWLLAALSALNFVIYLVC  196

Query  352  SIWF---KPRKNKSAVEMETV  299
            + W+     R   + +E+E V
Sbjct  197  AKWYVYKDKRLADAGIELEEV  217



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V A+LITLA+YDRIV+PLWKK KG  G +NLQR+ LGL+LS +GMAV+A+IE KR + A 
Sbjct  399  VLAVLITLAVYDRIVIPLWKKRKGKAGLSNLQRMGLGLLLSALGMAVAAIIELKRRSVAR  458

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +     S L +SVF LIPQF LVG+GEAF YTGQLDFF+T+SP+ MK +STGLFL T+SL
Sbjct  459  ATSEM-SVLPISVFLLIPQFLLVGAGEAFTYTGQLDFFITESPRGMKGLSTGLFLVTISL  517

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFF+SSFLV +V+KVT  S GG  W+ DNIN GRLD FY LL+ L  INF +YL+ + W+
Sbjct  518  GFFISSFLVLIVQKVTL-SFGGDGWIGDNINKGRLDCFYGLLSILSFINFGLYLVSARWY  576

Query  340  KPRKNKSAVEMETVMNGNGEEKC  272
            K +         T   G+ EE+C
Sbjct  577  KRQMPAKPTLQVTCGKGSPEEEC  599



>ref|XP_006645998.1| PREDICTED: nitrate transporter 1.4-like [Oryza brachyantha]
Length=593

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 132/179 (74%), Gaps = 11/179 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V AI++TLA+YDR+ +P+ +   G  GFTNL++I +GL LS VGMA +AL EKKRL+AA 
Sbjct  392  VGAIMVTLAVYDRVFIPVCRTLTGKQGFTNLEKIGIGLALSVVGMAAAALCEKKRLSAAA  451

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +     + + +SVF L PQF LVG+GEAF+YTGQLDFF+T+SPK MKTMSTGLFLTTLSL
Sbjct  452  AA----TPVPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSL  507

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            GFF+SS LVS+V        G   WLAD I+  RLD FYWLLA L  +N   YL+C++W
Sbjct  508  GFFLSSALVSLV-------KGATAWLADTIDRSRLDYFYWLLAVLSALNLAAYLVCAMW  559



>ref|XP_007155636.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
 gb|ESW27630.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
Length=450

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR++ P+ KK    P G T LQRI +GLVLS   M  +AL E KRL  A
Sbjct  247  VASILLTVPIYDRVIAPIAKKVTKNPQGLTPLQRIGVGLVLSIFAMVAAALTEIKRLRVA  306

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  307  RAHGLTHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  366

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V K   A+   + WLADN+N G+L  FYWLLA L  +N VVYL C
Sbjct  367  TLSLGFFLSSMLVTLVHK---ATRHSEPWLADNLNEGKLHHFYWLLAVLSGVNLVVYLFC  423

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++   R  ++ +E+E
Sbjct  424  AKGYVYKDKRLAEAGIELE  442



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 147/199 (74%), Gaps = 7/199 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +++ G P G T LQRI +GLVLS + MA +AL+E KRL  A
Sbjct  394  VGSILLTVPVYDRIIVPISRRFNGNPHGLTPLQRIGVGLVLSILAMAAAALVEIKRLNVA  453

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S     +  +T+ +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  454  RSNPVTMQKGATVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  513

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  FYWLLA L ++N  VYL+
Sbjct  514  TLSLGFFVSSALVTIVHKVTGESGHGA--WLADNLNRGKLYNFYWLLAVLCLVNLGVYLV  571

Query  355  CSIWFKPRKNKSAVEMETV  299
             + W+  +  ++A E E++
Sbjct  572  AARWYVYKDGRAAAEDESM  590



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR++ P+ KK    P G T LQRI +GLVLS   M  +AL E KRL  A
Sbjct  417  VASILLTVPIYDRVIAPIAKKVTKNPQGLTPLQRIGVGLVLSIFAMVAAALTEIKRLRVA  476

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  477  RAHGLTHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  536

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V K   A+   + WLADN+N G+L  FYWLLA L  +N VVYL C
Sbjct  537  TLSLGFFLSSMLVTLVHK---ATRHSEPWLADNLNEGKLHHFYWLLAVLSGVNLVVYLFC  593

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++   R  ++ +E+E
Sbjct  594  AKGYVYKDKRLAEAGIELE  612



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 141/203 (69%), Gaps = 7/203 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKW-KGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +ILIT+ +YDR+V+P+  +      G T LQRIA+GLV S + M  +AL+E +RL  A
Sbjct  396  VGSILITVPIYDRVVVPIASRLLHNRQGLTPLQRIAVGLVFSIISMVSAALVEIRRLKVA  455

Query  703  NSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G  N+    + +SVF+LIPQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFLT
Sbjct  456  KDAGLVNNPYEVVPISVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLT  515

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV  +T   H    W+ADN+N GRLD FYWLLAGL V+NF+VYL+ 
Sbjct  516  TLSLGFFVSSALVTVVHNITGDKH---PWIADNLNQGRLDYFYWLLAGLSVVNFLVYLVF  572

Query  352  SIWFKPRKNKSAVEMETVMNGNG  284
            + W+  ++ + A E   V   +G
Sbjct  573  AKWYIYKETRLAEEGYEVEEDDG  595



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 133/202 (66%), Gaps = 8/202 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+A YDRI++P+ +++ G P G T L+RI +GLVLS + MA +AL E KRL  A
Sbjct  395  VGSILLTIAFYDRIIVPITRRFTGHPHGLTPLRRIGVGLVLSVLAMAAAALTEIKRLKVA  454

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl-fl  536
             S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGL   
Sbjct  455  QSSPLAVEKGATVPLSVFFLVPQFFLVGAGEAFTYVGQLDFFLRECPKGMKTMSTGLFLS  514

Query  535  ttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            T     F  S  +  V K      HG   WL D++N G+L  FYWLLA L ++NF VYL+
Sbjct  515  TLSLGFFVSSVLVTIVHKVTGEGGHGA--WLTDDLNRGKLYNFYWLLAVLSLVNFGVYLV  572

Query  355  CSIWFKPRKNK-SAVEMETVMN  293
             + W+ P++ + +A E+E+++ 
Sbjct  573  SAWWYVPKEGQAAAAEVESMVG  594



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 7/198 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRI  GLVLS + M+ +AL E KRL  A
Sbjct  391  VGSILLTVPVYDRVVVPVSRRLTGNPHGLTPLQRIGAGLVLSILAMSAAALTEIKRLGVA  450

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S      + +T+ MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  451  RSTPAALENGATVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  510

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVSS LV+VV KVT  S HG   WLADN+N G+L  FYWLLA L ++N V YL+
Sbjct  511  TLSLGFFVSSALVTVVHKVTGESGHGA--WLADNLNRGKLYNFYWLLAVLCLVNLVAYLV  568

Query  355  CSIWFKPRKNKSAVEMET  302
             + W+  ++ ++AV+ ++
Sbjct  569  VARWYAYKEQRAAVDDDS  586



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 139/194 (72%), Gaps = 8/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ ++    P G T L+RI +GLVLS V M  +AL EKKRL AA
Sbjct  381  VGSILLTVPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLSIVAMIAAALTEKKRLRAA  440

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G  N   + + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  RLHGLANDPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWLLA L  +NFV+YLIC
Sbjct  501  TLSLGFFVSSSLVTIVHKVTI----NKPWLADNLNQGRLHDFYWLLAILSALNFVIYLIC  556

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  557  ARWYVYKDKRLADE  570



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 140/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V ++L+T+ +YDR++ P+ KK    P G T LQRI +GLV S + M  +ALIE KRL  A
Sbjct  391  VGSVLLTVPVYDRVITPIAKKLSHNPQGLTPLQRIGVGLVFSILAMVSAALIEIKRLRMA  450

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  451  RANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  510

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V K   A+   + WLADN+N+G+L  FYWLLA L  +N V YL C
Sbjct  511  TLSLGFFLSSLLVTLVHK---ATRHREPWLADNLNHGKLHYFYWLLALLSGVNLVAYLFC  567

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++   R  ++ +E+E
Sbjct  568  AKGYVYKDKRLAEAGIELE  586



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 139/194 (72%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR ++P+ KK    P GFT LQRI +GLVLS + M V ALIE KRL  A
Sbjct  370  IGTILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVISMVVGALIEIKRLRYA  429

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G   +  + + M+VF+LIPQ F+VG+GEAFMY GQL+FFL + PK MKTMSTGLFL+
Sbjct  430  QSHGLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLS  489

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L  IN V+YL+C
Sbjct  490  TLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAILSAINVVLYLVC  546

Query  352  SIWFKPRKNKSAVE  311
            + W+  ++ + A E
Sbjct  547  AKWYVYKEKRLADE  560



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 129/207 (62%), Gaps = 7/207 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            V+AILI+LA YDR+++P  KKW    GFT+LQ+I +GL LS +GM V+++IE KRL+ A 
Sbjct  381  VSAILISLATYDRLIVPFVKKWTTKSGFTSLQKIGIGLFLSCLGMGVASIIEVKRLSIAK  440

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            +    ++ L +SVF LIPQFFLVG+G  FMYTGQLD F+TQSPK MKTM +     T   
Sbjct  441  ANEETSNNLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQSPKGMKTM-STGLFLTTMA  499

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
              F  S L+  + K  + ++    W+ ++IN  RLD FY LLA L  I+F  Y++C+ W+
Sbjct  500  LGFFFSSLLISIVKKVTTTNINNGWVGESINKSRLDCFYGLLAILIFIDFGFYVLCASWY  559

Query  340  ------KPRKNKSAVEMETVMNGNGEE  278
                   P  +K  + + + + G   E
Sbjct  560  FWLKIVAPGNSKPDLIINSQLRGREPE  586



>ref|XP_010906610.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ +++ G P G T LQRI +GLVLS + MA +AL E KRL  A
Sbjct  330  VGSILLTVPIYDRIVVPVSRRFTGNPHGLTPLQRIGVGLVLSILAMAAAALTEIKRLHVA  389

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  390  RSNPNTIHKGATVPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  449

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  FYWLLA L ++N  +YL+
Sbjct  450  TLSLGFFVSSALVTIVHKVTGKSGHGA--WLADNLNRGKLYNFYWLLAVLCLVNLGLYLV  507

Query  355  CSIWFKPRKNKSAVEMETV  299
             + W+  ++ ++A E +++
Sbjct  508  AAKWYVYKEGRTAAEDDSM  526



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 139/194 (72%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR ++P+ KK    P GFT LQRI +GLVLS + M V ALIE KRL  A
Sbjct  381  IGTILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVISMVVGALIEIKRLRYA  440

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G   +  + + M+VF+LIPQ F+VG+GEAFMY GQL+FFL + PK MKTMSTGLFL+
Sbjct  441  QSHGLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L  IN V+YL+C
Sbjct  501  TLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAILSAINVVLYLVC  557

Query  352  SIWFKPRKNKSAVE  311
            + W+  ++ + A E
Sbjct  558  AKWYVYKEKRLADE  571



>gb|ACR34962.1| unknown [Zea mays]
Length=568

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRIA+GL LS V MA +AL E +RL  A
Sbjct  364  VGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEVRRLRVA  423

Query  703  --NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
              +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+T
Sbjct  424  RDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  483

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYWLLA + + N +VYL+ +
Sbjct  484  LSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYWLLAAVCLANLLVYLVAA  540

Query  349  IWFKPRKNKSAVE  311
             W+K +  +   +
Sbjct  541  RWYKYKAGRPGAD  553



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRIA+GL LS V MA +AL E +RL  A
Sbjct  404  VGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEVRRLRVA  463

Query  703  --NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
              +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+T
Sbjct  464  RDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  523

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYWLLA + + N +VYL+ +
Sbjct  524  LSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYWLLAAVCLANLLVYLVAA  580

Query  349  IWFKPRKNKSAVE  311
             W+K +  +   +
Sbjct  581  RWYKYKAGRPGAD  593



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 142/201 (71%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+ LYDR++ P+ K   K + GFT LQRI +GLVLS + M  +ALIE KRL  A
Sbjct  389  IGTILLTVPLYDRLIRPVAKNILKNSNGFTPLQRIGVGLVLSVLSMVAAALIEIKRLKFA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+L+PQFF VGSGEAFMY GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  KSHGFVNDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V  VT  +   + W+A+N+N GRL  FYWLLA L  IN V+YL C
Sbjct  509  TLSLGFFFSSLLVTIVNNVTGPN---KPWIANNLNQGRLYDFYWLLAMLSAINVVIYLAC  565

Query  352  SIWFKPRKNKSA---VEMETV  299
            + W+  ++N+ A   +E+E +
Sbjct  566  AKWYVYKENRLAEEGIELEEI  586



>ref|XP_011033951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like, partial [Populus 
euphratica]
Length=505

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 139/194 (72%), Gaps = 8/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ ++    P G T L+RI +GLVLS VGM  +AL EKKR +AA
Sbjct  303  VGSILLTVPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLSIVGMIAAALTEKKRRSAA  362

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G      + + ++VF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  363  ILHGLATDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  422

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWL+A L  +NFV+YLIC
Sbjct  423  TLSLGFFVSSSLVAIVHKVTL----NKPWLADNLNQGRLHDFYWLVAILSALNFVIYLIC  478

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  479  ARWYVSKDERLAAE  492



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRIA+GL LS V MA +AL E +RL  A
Sbjct  404  VGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEVRRLRVA  463

Query  703  --NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
              +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+T
Sbjct  464  RDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  523

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYWLLA + + N +VYL+ +
Sbjct  524  LSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYWLLAAVCLANLLVYLVAA  580

Query  349  IWFKPRKNKSAVE  311
             W+K +  +   +
Sbjct  581  RWYKYKAGRPGAD  593



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ +++ G P G T LQRI +GLVLS + MA +AL E KRL  A
Sbjct  394  VGSILLTVPIYDRIVVPVSRRFTGNPHGLTPLQRIGVGLVLSILAMAAAALTEIKRLHVA  453

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  454  RSNPNTIHKGATVPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  513

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  FYWLLA L ++N  +YL+
Sbjct  514  TLSLGFFVSSALVTIVHKVTGKSGHGA--WLADNLNRGKLYNFYWLLAVLCLVNLGLYLV  571

Query  355  CSIWFKPRKNKSAVEMETV  299
             + W+  ++ ++A E +++
Sbjct  572  AAKWYVYKEGRTAAEDDSM  590



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 150/209 (72%), Gaps = 8/209 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ +++ G P G T+LQR+ +GLV+S + M  +ALIE KRL  A
Sbjct  396  VGSILLTVPVYDRVVVPVTRRFTGNPHGLTSLQRMGVGLVMSILAMVAAALIEIKRLRVA  455

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             +        +T+ +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  456  RANAASMEKGATVPVSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  515

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVSS LVSVV KVT  S HGG  WL DN+N G+L  FYWL+A L  +N V+YL+
Sbjct  516  TLSLGFFVSSVLVSVVHKVTGESGHGG--WLTDNLNRGKLYNFYWLVAVLSSVNLVLYLV  573

Query  355  CSIWFKPRKNKSAVEMETVMNGN-GEEKC  272
             + W+  ++ ++ V+ +++      EE C
Sbjct  574  AAKWYVYKEQRAVVDDDSMAGVELTEEAC  602



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            + AIL+TLA++DR+++PL KK KGT G T+ Q++ LGL +S + M V+A++E +RL  A 
Sbjct  382  IGAILLTLAIHDRLIVPLLKKKKGTLGLTSTQKMGLGLFISIITMVVAAIVETRRLKVAK  441

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S    NSTL +S F L PQF L G+ E  +YTGQLDFFL++SPK MK +ST LFLTT+SL
Sbjct  442  STSSTNSTLPISAFLLAPQFVLAGAAEGLVYTGQLDFFLSESPKGMKAVSTSLFLTTISL  501

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
            GFFVSS LV+++++    + G Q+WL  N+N+GRLDLFY L+A L  IN   YL+ + WF
Sbjct  502  GFFVSSALVAIIRR---VTEGRQNWLPANLNHGRLDLFYGLIALLSAINLGFYLLSAKWF  558

Query  340  KPRKNKSAVE  311
              +K +   +
Sbjct  559  LCKKTQRQTQ  568



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ ++  G P G T LQRI +GLVLS + MA +AL E +RL  A
Sbjct  397  VGSILLTVPIYDRIVVPISRRLSGNPHGLTPLQRIGVGLVLSILAMAAAALTEVRRLRIA  456

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
                  +  + M+VF+LIPQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+TLS
Sbjct  457  RENPTSDGVVPMTVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  516

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFFVSS LVS V K+T+     + W+AD++N G L  FYWLLAGL + N VVYL  + W
Sbjct  517  LGFFVSSALVSAVHKLTAHR---RPWIADDLNQGELHKFYWLLAGLCLANLVVYLFAARW  573

Query  343  FKPRKNKSAVEMETVMNGNGEEKC  272
            +K +  +   +       N  E C
Sbjct  574  YKYKAGRPGADGSV----NDAEPC  593



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 139/199 (70%), Gaps = 11/199 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V ++L+T+ +YDR++ P+ KK    P G T LQRI +GLV S + M  +ALIE KRL  A
Sbjct  391  VGSVLLTVPVYDRVITPIAKKLSHNPQGLTPLQRIGVGLVFSILAMVSAALIEIKRLRMA  450

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  451  RANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  510

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V K T      + WLADN+N+G+L  FYWLLA L  +N V YL C
Sbjct  511  TLSLGFFLSSLLVTLVHKATRR----EPWLADNLNHGKLHYFYWLLALLSGVNLVAYLFC  566

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++   R  ++ +E+E
Sbjct  567  AKGYVYKDKRLAEAGIELE  585



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ +K    P G T LQRI +GLVLS   M  +AL E KRL  A
Sbjct  392  VGSILLTVPIYDRLIVPIARKILKNPQGLTPLQRIGVGLVLSIFAMVAAALAELKRLRVA  451

Query  703  NSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
             S    N T  L +SVF+LIPQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+T
Sbjct  452  TSHHMVNETTELPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  511

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFF SSFLV++V K+T    G + WLADN+N G+L  FYWLLA L  +NF +YL+C+
Sbjct  512  LSLGFFFSSFLVTIVHKIT----GNKPWLADNLNQGKLYDFYWLLAILSALNFGIYLVCA  567

Query  349  IWFKPRKNKSA  317
             W+  +  + A
Sbjct  568  KWYVYKDKRLA  578



>ref|XP_006440345.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53585.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=448

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 136/192 (71%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K   TP G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  246  VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  305

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  306  RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  365

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYWLLA L  +NFV+YL  
Sbjct  366  TLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAF  422

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  423  ARWYVYKDKRLA  434



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ ++  G P G T LQRI +GLVLS + MA +A  E +RL  A
Sbjct  383  VGSILLTVPIYDRIVVPVARRLNGNPHGLTPLQRIGVGLVLSVIAMAGAAATEIRRLRVA  442

Query  703  NSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
                      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  443  RDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  502

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWLLA + ++N +VYL+ + 
Sbjct  503  SLGFFVSSALVTCVHKVTGDRHA---WIADDLNKGRLDNFYWLLAVICLVNLLVYLVAAR  559

Query  346  WFKPRKNKSAVE  311
            W+K +  +   +
Sbjct  560  WYKYKAGRPGAD  571



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ ++  G P G T LQRI +GLVLS + MA +A  E +RL  A
Sbjct  396  VGSILLTVPIYDRIVVPVARRLNGNPHGLTPLQRIGVGLVLSVIAMAGAAATEIRRLRVA  455

Query  703  NSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
                      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  456  RDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  515

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWLLA + ++N +VYL+ + 
Sbjct  516  SLGFFVSSALVTCVHKVTGDRHA---WIADDLNKGRLDNFYWLLAVICLVNLLVYLVAAR  572

Query  346  WFKPRKNKSAVE  311
            W+K +  +   +
Sbjct  573  WYKYKAGRPGAD  584



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K    P G T LQRI +GLV+S + M  +AL E KRL  A
Sbjct  392  VGSILLTVPIYDRIIVPIARKILKNPQGLTPLQRIGVGLVMSILAMVAAALTELKRLRVA  451

Query  703  NSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
             S    N T  + +SVF+LIPQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+T
Sbjct  452  TSHHLINGTTEVPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  511

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            LSLGFF+SSFLV++V K+T    G + WLADN+N G+L  FYWLLA L  +NF +YL+C+
Sbjct  512  LSLGFFLSSFLVTIVHKIT----GNKPWLADNLNQGKLYNFYWLLAILSTLNFGIYLVCA  567

Query  349  IWFKPRKNKSA  317
             W+  +  + A
Sbjct  568  KWYVYKDKRLA  578



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 141/199 (71%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ ++    P G T LQRI +GLV+S + M  +AL E KRL AA
Sbjct  390  VGSILLTVIVYDRVIVPVTRRLFNNPRGLTPLQRIGIGLVMSALAMVAAALTELKRLRAA  449

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +   + + +SVF LIPQFFLVG GEAF Y GQLDFFL + PK MKT+STGLFL+
Sbjct  450  RSNGLTDNPTAEIPLSVFCLIPQFFLVGCGEAFTYIGQLDFFLRECPKGMKTISTGLFLS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T+SLG F SSFLVS+V K+   +  G+ WL+DN+N G+L  FYWLLAGL ++NF +YL+C
Sbjct  510  TISLGLFFSSFLVSLVHKL---TGNGRPWLSDNLNQGKLYNFYWLLAGLSLLNFGLYLVC  566

Query  352  SIWF---KPRKNKSAVEME  305
            + W+     R  +  +E+E
Sbjct  567  ARWYVYKDTRLAQEGIELE  585



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 135/201 (67%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR + P+ KK    + GFT LQRI +GLVLS + M  +ALIE KRL  A
Sbjct  387  IGTILLTVPFYDRFIRPVAKKVLNNSHGFTPLQRIGVGLVLSVISMVAAALIEMKRLKFA  446

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G      + + +SVF+L+PQFF VGSGEAFMY GQLDFFL + PK MKTMSTGLFL+
Sbjct  447  RSHGFVDDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFLRECPKGMKTMSTGLFLS  506

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLS+GFF SS LV++V      +   + W+ADN++ GRL  FYWLLA L  IN V+YL C
Sbjct  507  TLSIGFFFSSLLVTLVNN---VTGPNKPWIADNLDQGRLYDFYWLLAMLSAINVVIYLAC  563

Query  352  SIWF---KPRKNKSAVEMETV  299
            + W+     R  ++ +E+E +
Sbjct  564  AKWYVYKDKRLAEAGIELEEI  584



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 136/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR ++P+ +K    P GFT LQRI +GLVLS   M   ALIE KRL  A
Sbjct  381  IGTILLTVPFYDRFIVPVARKVLKNPHGFTPLQRIGVGLVLSVFSMVAGALIEIKRLRYA  440

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G   +  + + M+VF+LIPQ F VG+GEAFMY GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  QSHGLVDKPEAKIPMTVFWLIPQNFFVGAGEAFMYMGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF S+ LVSVV K+   +HG + WLADN+N GRL  FYWLLA L  IN ++YL+C
Sbjct  501  TLSLGFFFSTLLVSVVNKM--TAHG-RPWLADNLNKGRLYDFYWLLAILSAINVMLYLVC  557

Query  352  SIWFKPRKNKSAVE  311
            + W+  ++ + A E
Sbjct  558  AKWYVYKEKRLAEE  571



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT-PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V+AILI+LA YDR+++P  K W     G T+LQ+I +GL LS +GM V+++IE KRL+ A
Sbjct  359  VSAILISLATYDRLILPFLKIWTAKKSGLTSLQKIGIGLFLSCLGMGVASIIEVKRLSIA  418

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
                   +TL +SVF LIPQFFLVG+G  FMYTGQLD F+TQSPK MKTMSTGLFLTT++
Sbjct  419  KENEETPNTLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQSPKGMKTMSTGLFLTTMA  478

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS L+S+VKKVT+A +    W+ ++IN GRLD FY LLA L  I+F  Y++C+ W
Sbjct  479  LGFFFSSLLISIVKKVTTA-NINNGWVGESINKGRLDCFYGLLAILIFIDFGFYVLCASW  537

Query  343  F  341
            +
Sbjct  538  Y  538



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 134/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ ++  G P G T LQRI +GL LS + MA +AL E KRL  A
Sbjct  398  VGSILLTVPVYDRIVVPVARRVSGNPHGLTPLQRIGVGLALSVIAMAGAALTEIKRLHVA  457

Query  703  NSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
                      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  458  RDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  517

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWLLA + + N +VYL+ + 
Sbjct  518  SLGFFVSSALVAAVHKVTGDRH---PWIADDLNKGRLDNFYWLLAVICLANLLVYLVAAR  574

Query  346  WFKPRKNKSAVE  311
            W+K +  +   +
Sbjct  575  WYKYKAGRPGAD  586



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT-PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V+AILI+LA YDR+++P  K W     G T+LQ+I +GL LS +GM V+++IE KRL+ A
Sbjct  379  VSAILISLATYDRLILPFLKIWTAKKSGLTSLQKIGIGLFLSCLGMGVASIIEVKRLSIA  438

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
                   +TL +SVF LIPQFFLVG+G  FMYTGQLD F+TQSPK MKTMSTGLFLTT++
Sbjct  439  KENEETPNTLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQSPKGMKTMSTGLFLTTMA  498

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS L+S+VKKVT+A+     W+ ++IN GRLD FY LLA L  I+F  Y++C+ W
Sbjct  499  LGFFFSSLLISIVKKVTTANI-NNGWVGESINKGRLDCFYGLLAILIFIDFGFYVLCASW  557

Query  343  F  341
            +
Sbjct  558  Y  558



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +ILIT+ +YDR+++P+ K+  G P GFT LQRI +GL LS + MA +AL E KRL  A
Sbjct  399  VGSILITVPIYDRVIVPVAKRLTGNPHGFTPLQRIGIGLGLSALAMASAALTEIKRLRVA  458

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S+       +T+ +SVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  459  RSDPAALEMGATVPLSVFWLIPQFFLVGAGEAFTYVGQLDFFLRECPKGMKTMSTGLFLS  518

Query  532  tlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLI  356
            TLSLGFFVS+ LV+ V  +T  S HG   WLADN+N+G+L+ FYWLLA L ++N +VYL+
Sbjct  519  TLSLGFFVSTALVAAVDSITGQSGHGA--WLADNLNHGKLNNFYWLLAALCLVNLMVYLV  576

Query  355  CSIWFKPRKNKSAVEMETV  299
             + W+  +  + AV+ ++V
Sbjct  577  AAKWYVYKDQRPAVDDDSV  595



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 136/192 (71%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K   TP G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  389  VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYWLLA L  +NFV+YL  
Sbjct  509  TLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAF  565

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  566  ARWYVYKDKRLA  577



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 136/192 (71%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K   TP G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  389  VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYWLLA L  +NFV+YL  
Sbjct  509  TLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAF  565

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  566  ARWYVYKDKRLA  577



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 136/194 (70%), Gaps = 8/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ ++    P G T L+RI +GLVLS VGM  +AL EKKR   A
Sbjct  381  VGSILLTVPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLSIVGMIAAALTEKKRRRVA  440

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G      + + ++VF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  RLHGLATDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWL+A L  +NFV+YLIC
Sbjct  501  TLSLGFFVSSSLVTIVHKVTR----NKPWLADNLNQGRLHDFYWLVAILSALNFVIYLIC  556

Query  352  SIWFKPRKNKSAVE  311
            + W+  +    A E
Sbjct  557  ARWYVYKDKMLAAE  570



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 137/192 (71%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K   TP G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  389  VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V KVT      + WLADN+N GRL  FYWLLA L  +NFV+YL  
Sbjct  509  TLSLGFFVSSLLVSLVHKVTGVK---KPWLADNLNQGRLYDFYWLLAILSALNFVIYLAF  565

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  566  ARWYVYKDKRLA  577



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 135/181 (75%), Gaps = 6/181 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +++ G P G T LQRI +GL+LS + M  +ALIE KRL AA
Sbjct  383  VGSILVTVPIYDRIIIPITRRFTGNPYGITPLQRIGVGLILSMLAMVAAALIEIKRLKAA  442

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             S     +T+ + VF+L+PQFFLVGSG AF Y GQLDFFL + PK MKTMSTGLFL+TL+
Sbjct  443  RS-----TTVPLRVFWLVPQFFLVGSGVAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLA  497

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFFVSS LV++V  VT  S G   WLA+++N G+L  FYWLLA L ++NF VY++ + W
Sbjct  498  LGFFVSSGLVAIVHLVTGESGGHGAWLANDLNRGKLYNFYWLLAVLSLVNFGVYVLSARW  557

Query  343  F  341
            +
Sbjct  558  Y  558



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+PL ++    P G T LQRI +GLVLS + M  +AL E KRL AA
Sbjct  390  VGSILLTVPVYDRVVVPLTRRLLKNPHGLTPLQRIGVGLVLSILAMVAAALTEIKRLRAA  449

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G     N+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  450  RHYGLTNDPNAVIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV+VV K    +   + WLA+N+N G+L  FYWLLA L  +NF+++L+C
Sbjct  510  TLSLGFFFSSLLVTVVHK---VTGNKKPWLANNLNQGKLHDFYWLLAILSALNFLIFLVC  566

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  567  AKWYVYKDKRLADE  580



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 136/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YD+I+ P+ +K    P G T LQRI +GLVLS + M  +AL E KRL +A
Sbjct  384  VGSILLTVPIYDKIIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRSA  443

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G  N   + + MSVF+LIPQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  444  SSHGLTNDPSAQIPMSVFWLIPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  503

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FYWLLA L  +N V+YL+ 
Sbjct  504  TLSLGFFVSSVLVTIVHKVTGTKH---PWLPDNLNQGRLYDFYWLLAILSCLNLVIYLVF  560

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  561  ARWYVYKDKRLADE  574



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 139/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V + L+T+ +YDRI+MP+ K+    P G T LQRI +GL LS VGM  +A +E KRL  A
Sbjct  382  VGSTLLTVVIYDRIIMPICKRLLKNPYGLTPLQRIGIGLFLSIVGMVAAAAVEIKRLHVA  441

Query  703  NSEGRHNSTLT---MSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N+ +T   M+VF+LIPQF +VG+GEAF+Y GQLDFFL + PK MKT+STGLFL+
Sbjct  442  KSHGLANNPVTPVPMTVFWLIPQFAIVGAGEAFIYVGQLDFFLRECPKGMKTISTGLFLS  501

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K    +   + WLADN+N G+L+ FYWLL  L  +N + +LIC
Sbjct  502  TLSLGFFFSSVLVTIVHK---VTGNRKPWLADNLNQGKLNDFYWLLGILSALNLMFFLIC  558

Query  352  SIWFKPRKNKSA---VEME  305
            + W+  ++ + A   +E+E
Sbjct  559  AKWYVYKERRLADVGIELE  577



>ref|XP_011463731.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=530

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 7/184 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ +K    P G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  328  VGSILLTVPVYDRVIVPVARKLLKNPQGLTPLQRIGVGLVLSIFAMVAAALTELKRLRAA  387

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G      + + +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  388  RSHGLTDNPTAEIPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  447

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K    +   + WLADN+N G+L  FYWLLA L  +N ++YL C
Sbjct  448  TLSLGFFFSSLLVTIVHK---VTGDRKPWLADNLNQGKLYDFYWLLAILSALNLLIYLAC  504

Query  352  SIWF  341
            + W+
Sbjct  505  AKWY  508



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+ +  YDR++ P+ +K    P G T LQ   +GLVLS + M  +AL+E+KRL  A
Sbjct  389  IGTILLNVPFYDRVICPIARKVLKNPQGLTPLQHTGVGLVLSILSMVAAALVEEKRLIFA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+LIPQFF+VGSGE+FMY GQLDFFL + P  MKTMS GLFL+
Sbjct  449  QSHGLVNDPTAKIPLSVFWLIPQFFIVGSGESFMYMGQLDFFLRECPDGMKTMSMGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            + SLGFF SS LVS V K+T  S   + W+ADN+N GRL+ +YWLLA L  IN ++YL C
Sbjct  509  SRSLGFFFSSLLVSTVNKITGPS---KPWIADNLNQGRLNYYYWLLAMLSAINLMIYLAC  565

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  K A E
Sbjct  566  AKWYVYKDKKVAEE  579



>gb|KHG24776.1| Uncharacterized protein F383_04224 [Gossypium arboreum]
Length=585

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 136/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ +K    P G T LQRIA+GLVLS + M  +AL E KRL AA
Sbjct  383  VGSILLTVPIYDRLIVPIARKLLKNPQGLTPLQRIAVGLVLSIIAMVAAALTEIKRLRAA  442

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G  N   + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  443  TTNGLANNPSAQIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  502

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  503  TLSLGFFVSSLLVTIVHKVTGNKH---PWLPDNLNQGRLYDFYWLLAILSCLNLAIYLVF  559

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  560  AKWYVYKDKRLADE  573



>ref|XP_011070105.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 130/181 (72%), Gaps = 7/181 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ ++    P G + LQRIA+GLVLS V M  +AL E KRL  A
Sbjct  391  VGSILLTVPIYDRIIVPIARRVLKNPHGLSPLQRIAVGLVLSIVAMVAAALTEIKRLNVA  450

Query  703  NSEG-RHNSTLT--MSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  HN T T  MSVF+L+PQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  451  RSHGLTHNETATVPMSVFWLVPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  510

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V KVT   H    WLADN+N G+L  FYWLL  L + N +++L C
Sbjct  511  TLSLGFFFSSILVTIVHKVTGHQH---PWLADNLNEGKLYDFYWLLTVLSIFNLMIFLFC  567

Query  352  S  350
            +
Sbjct  568  A  568



>ref|XP_004298652.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=591

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ +K    P G T LQRI +GLVLS   M  +AL E KRL AA
Sbjct  389  VGSILLTVPVYDRVIVPVARKLLKNPQGLTPLQRIGVGLVLSIFAMVAAALTELKRLRAA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G      + + +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTDNPTAEIPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K    +   + WLADN+N G+L  FYWLLA L  +N ++YL C
Sbjct  509  TLSLGFFFSSLLVTIVHK---VTGDRKPWLADNLNQGKLYDFYWLLAILSALNLLIYLAC  565

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  566  AKWYVYKDKRLA  577



>gb|KJB46719.1| hypothetical protein B456_008G2375002, partial [Gossypium raimondii]
Length=548

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 136/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI+ P+ +K    P G T LQRI +GLVLS + M  +AL E KRL +A
Sbjct  346  VGSILLTVPIYDRIIAPIARKVLKNPQGLTPLQRIGVGLVLSIITMIAAALTEIKRLRSA  405

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G  N   + + MSVF+LIPQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  406  SSHGLTNDPSAQIPMSVFWLIPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  465

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FYWLLA L  +N V++L+ 
Sbjct  466  TLSLGFFVSSVLVTIVHKVTGTKH---LWLPDNLNQGRLYDFYWLLAILSCLNLVIFLVF  522

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  523  AKWYVYKDKRLADE  536



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ +++ G P G T LQRI +GLVLS + M  +AL+E KRL  A
Sbjct  399  VGSILLTVPIYDRIVVPVARRFNGNPHGLTPLQRIGIGLVLSILAMTSAALVEIKRLRVA  458

Query  703  NSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
                    + + M+VF+LIPQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  459  RESAVPEGAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  518

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+VV K+   +   + W+AD++N G L  FYWLLAG+ + N VVYL  + 
Sbjct  519  SLGFFVSSALVTVVHKI---TGDRRPWIADDLNKGELYKFYWLLAGVCLANLVVYLFAAR  575

Query  346  WFKPRKNKSAVE  311
            W+K +  +   +
Sbjct  576  WYKYKAGRPGAD  587



>gb|KJB20885.1| hypothetical protein B456_003G170300 [Gossypium raimondii]
Length=586

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 135/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR++ P+ +K    P G T LQRIA+GLVLS + M  +AL E KRL AA
Sbjct  384  VGSILLTVPIYDRLIAPIARKLLRNPQGLTPLQRIAVGLVLSIIAMVAAALTEIKRLRAA  443

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G  N   + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  444  TTNGLANNPTAQIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  503

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  504  TLSLGFFVSSLLVTIVHKVTGNKH---PWLPDNLNQGRLYDFYWLLAILSCLNLAIYLVF  560

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  561  AKWYVYKDKRLADE  574



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score =   148 bits (374),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRIV+P+ ++  G P G T LQRI +GLVLS + M  +AL+E KRL  A
Sbjct  399  VGSILLTVPIYDRIVVPVSRRLNGNPHGLTPLQRIGIGLVLSILAMTSAALVEVKRLRVA  458

Query  703  -NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             +S     + + M+VF+LIPQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  459  RDSAVPAGAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  518

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+VV K+   +   + W+AD++N G L  FYWLLAG+ + N VVYL  + 
Sbjct  519  SLGFFVSSALVTVVHKI---TGDRRPWIADDLNKGELYKFYWLLAGVCLANLVVYLFAAR  575

Query  346  WFKPRKNKSAVE  311
            W+K +  +   +
Sbjct  576  WYKYKAGRPGAD  587



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDRI++P+ +K +K   G T LQRI +GLVLS   M  +AL E KRL  A
Sbjct  392  VASILLTVPIYDRIIVPICRKIFKNPQGLTPLQRIGVGLVLSIFAMVAAALSEIKRLHVA  451

Query  703  NSEG-RHN--STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  H+  + + +SVF+L+PQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  RSHGLTHDRAAIVPLSVFWLVPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWLL  L ++N  V+L+ 
Sbjct  512  TLSLGFFVSSILVAIVHKVTGEK---KPWLADNLNEGRLYNFYWLLTILSILNLAVFLVS  568

Query  352  SIWFKPRKNKSA  317
            + W+  ++N+ A
Sbjct  569  ARWYVYKENRLA  580



>gb|KHG03840.1| Uncharacterized protein F383_26454 [Gossypium arboreum]
Length=525

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 135/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+ +YDR+++P+ +K    P G T LQRIA+GLVLS + M  +ALIE KR+  A
Sbjct  323  VGAILLTVPIYDRLIVPIARKVLKNPQGLTPLQRIAVGLVLSIIAMVAAALIEIKRMRVA  382

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G  N   + + +SVF+L+PQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  383  TTNGLTNNPTAQIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  442

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V KV+   H    WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  443  TLSLGFFLSSLLVTIVDKVSGNKH---PWLPDNLNQGRLYDFYWLLAILCCLNLAIYLVF  499

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  500  AKWYVYKDKRLADE  513



>ref|XP_009110669.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brassica rapa]
 gb|AFK74856.1| low-affinity nitrate transporter [Brassica rapa subsp. oleifera]
Length=590

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ VGMAV+AL+E KRL  A
Sbjct  388  VGGLLLTTAVYDRVAIPLCKKLFNYPHGLRPLQRIGLGLILAAVGMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  448  HSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A +  +NF+++L+ S W
Sbjct  508  LGFFFSSVLVTIVEKFTDKAH---PWIADDLNKGRLYNFYWLVAVVVFLNFLIFLVFSKW  564

Query  343  FKPRKNKSA---VEME  305
            +  +  + A   +E+E
Sbjct  565  YVYKDKRLAELGIELE  580



>dbj|BAG91755.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRI +GLVLS V M  +AL E +RL  A
Sbjct  250  VGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVCAALTEVRRLRVA  309

Query  703  -NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  310  RDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  369

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWLLAG+ + N +VYL+ + 
Sbjct  370  SLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAAR  426

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W+K +  ++A   +  +     E C
Sbjct  427  WYKYKAGRAAAAGDGGVEMADAEPC  451



>ref|XP_012087157.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X1 [Jatropha 
curcas]
 gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 136/199 (68%), Gaps = 11/199 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ K  +K   G T LQRI +GLV S + M  +AL E KRL AA
Sbjct  381  VISILVTVPIYDRIILPIAKNIFKKKNGLTPLQRIGVGLVFSIIAMVAAALTELKRLRAA  440

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+LIPQF LVG+GEA  Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  RSNGLSNDATAQIPLSVFWLIPQFLLVGAGEAVTYIGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWLLA L  +NFV++   
Sbjct  501  TLSLGFFVSSILVTIVHKVTR----NKPWLADNLNQGRLYDFYWLLAILSALNFVIFFAS  556

Query  352  SIWF---KPRKNKSAVEME  305
            S W+     R  +  +EME
Sbjct  557  SKWYVYKDKRLGEVGIEME  575



>ref|XP_012087158.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X2 [Jatropha 
curcas]
Length=561

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 136/199 (68%), Gaps = 11/199 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ K  +K   G T LQRI +GLV S + M  +AL E KRL AA
Sbjct  359  VISILVTVPIYDRIILPIAKNIFKKKNGLTPLQRIGVGLVFSIIAMVAAALTELKRLRAA  418

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N   + + +SVF+LIPQF LVG+GEA  Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  419  RSNGLSNDATAQIPLSVFWLIPQFLLVGAGEAVTYIGQLDFFLRECPKGMKTMSTGLFLS  478

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FYWLLA L  +NFV++   
Sbjct  479  TLSLGFFVSSILVTIVHKVTR----NKPWLADNLNQGRLYDFYWLLAILSALNFVIFFAS  534

Query  352  SIWF---KPRKNKSAVEME  305
            S W+     R  +  +EME
Sbjct  535  SKWYVYKDKRLGEVGIEME  553



>ref|NP_001061020.1| Os08g0155400 [Oryza sativa Japonica Group]
 dbj|BAF22934.1| Os08g0155400, partial [Oryza sativa Japonica Group]
Length=525

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRI +GLVLS V M  +AL E +RL  A
Sbjct  322  VGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVCAALTEVRRLRVA  381

Query  703  -NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  382  RDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  441

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWLLAG+ + N +VYL+ + 
Sbjct  442  SLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAAR  498

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W+K +  ++A   +  +     E C
Sbjct  499  WYKYKAGRAAAAGDGGVEMADAEPC  523



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+ +  YDRI++P+ +++   P GFT LQRIA+GLV S   M  +AL E KRL  A
Sbjct  390  VGSILLMIIFYDRIMVPICRRFLNNPHGFTPLQRIAIGLVSSIFAMIAAALTEVKRLKVA  449

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL + PK MKTMSTGLF++
Sbjct  450  KLHGLTNDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFIS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T+SLGFF SS LV++V KVT  +   + WLADN+N G+L  FYWLLA L V+N +V+L C
Sbjct  510  TISLGFFFSSILVTIVDKVTGKT---KPWLADNLNKGKLYDFYWLLAILSVLNLMVFLFC  566

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +EME
Sbjct  567  SRRYVYKEKRLAEVGIEME  585



>ref|XP_006366745.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=592

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA++++ +  YDR+++PL  ++  +P GFT L RIA+GLV S   M  +AL E KRL  A
Sbjct  390  VASVMVVIIFYDRVIVPLCARYLNSPHGFTPLTRIAIGLVTSIFAMIAAALTEIKRLNVA  449

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL + PK MKTMSTGLF++
Sbjct  450  QSHGLTNNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFIS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T+SLGFF SS LVS+V KVT+ S   + WLADN+N G+L  FYWLLA L V+N +++  C
Sbjct  510  TISLGFFFSSILVSIVDKVTAKS---RPWLADNLNQGKLSNFYWLLAILSVLNVILFFYC  566

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++ + R  +  ++ME
Sbjct  567  AKRYVYKEKRLAEVGIQME  585



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P+ ++  G P G T LQRI +GLVLS V M  +AL E +RL  A
Sbjct  400  VGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVCAALTEVRRLRVA  459

Query  703  -NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  460  RDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  519

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSI  347
            SLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWLLAG+ + N +VYL+ + 
Sbjct  520  SLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAAR  576

Query  346  WFKPRKNKSAVEMETVMNGNGEEKC  272
            W+K +  ++A   +  +     E C
Sbjct  577  WYKYKAGRAAAAGDGGVEMADAEPC  601



>ref|XP_004245746.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 138/199 (69%), Gaps = 11/199 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T   YDR+V+P+ K+    P G + LQRIA+GLVLS + M  +AL E KRL  A
Sbjct  389  VGSILLTCVFYDRVVIPITKRVLNNPQGLSPLQRIAVGLVLSIIAMIAAALTEVKRLNVA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  HMHGLTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT    G + WLADN+N GRL  FYWLLA L V+N +++L  
Sbjct  509  TLSLGFFVSSILVTIVHKVT----GDKPWLADNLNQGRLYDFYWLLAILSVLNLMIFLFF  564

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R     +EME
Sbjct  565  SRRYVYKEKRLADVGIEME  583



>gb|KJB20886.1| hypothetical protein B456_003G170400 [Gossypium raimondii]
Length=585

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+ +YDR+++P+ +K    P G T LQRIA+GLVLS + M  +ALIE KR+  A
Sbjct  383  VGAILLTVPIYDRLIVPIARKVLKNPQGLTPLQRIAVGLVLSIIAMVAAALIEIKRMRVA  442

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             + G  N   + + +SVF+L+PQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  443  TTNGLTNNPTAQIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  502

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LV++V KVT   H    WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  503  TLSLGFFLSSLLVTIVDKVTGNKH---PWLPDNLNQGRLYDFYWLLAILCGLNLAIYLVF  559

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  560  AKWYVYKDKRLADE  573



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 141/210 (67%), Gaps = 8/210 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT-PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P  ++  G   G T  QRIA+GLVLS   M  +AL E+KRL AA
Sbjct  389  VGSILLTVPVYDRLVVPSARRLTGNRQGLTPFQRIAVGLVLSIFAMVAAALTERKRLHAA  448

Query  703  NSEGRHNS-----TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglf  539
             +  R +S     T+ +SVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLF
Sbjct  449  WATDRSSSVGRGATVPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLF  508

Query  538  lttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYL  359
            L+TLSLGFF SS LVS+V KVT  S  G  WLADN+N GRL  FYWLLA L V+N  V+L
Sbjct  509  LSTLSLGFFFSSALVSIVHKVTGESGRGA-WLADNLNEGRLYNFYWLLAVLSVVNLGVFL  567

Query  358  ICSIWFKPRKNKSAVEMETVMNGN-GEEKC  272
            + +  +  ++ +   E  +V      EE C
Sbjct  568  VSAKGYVYKEKRIEAEDGSVAAVELAEEAC  597



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+ +  YDRI++P+ +++   P GFT LQRIA+GLV S   M  +AL E KRL  A
Sbjct  390  VGSILLMIIFYDRIMVPICRRFLNNPHGFTPLQRIAIGLVSSIFAMIAAALTEVKRLKVA  449

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL + PK MKTMSTGLF++
Sbjct  450  KLHGLANDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFIS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T+SLGFF SS LV++V KVT  +   + WLADN+N G+L  FYWLLA L V+N +++L C
Sbjct  510  TISLGFFFSSILVTIVDKVTGKT---RPWLADNLNKGKLYDFYWLLAILSVLNLMLFLFC  566

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +EME
Sbjct  567  SSRYVYKEKRLAEVGIEME  585



>gb|EYU30304.1| hypothetical protein MIMGU_mgv1a003140mg [Erythranthe guttata]
Length=605

 Score =   145 bits (367),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 129/181 (71%), Gaps = 10/181 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA IL+T+A YDR+++PL++K    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  400  VATILLTVAFYDRLLVPLFRKVLKNPQGLTPLQRIGVGLVLSILAMVAAALTEVKRLGVA  459

Query  703  NSEGRHNSTLT------MSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl  542
             S G   S+ T      +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTMSTGL
Sbjct  460  RSYGLTTSSGTAAAVVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGL  519

Query  541  flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVY  362
            FL+TLSLGFFVSS LVS+V K    +   + WLADN+N G+L  FYWLLA L  +N VV+
Sbjct  520  FLSTLSLGFFVSSILVSIVHK---VTRQKKPWLADNLNQGKLYNFYWLLAILSTLNLVVF  576

Query  361  L  359
            L
Sbjct  577  L  577



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 113/194 (58%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ +YDRI++P+ +K    P G T LQRI +GLV S   M  +AL E KR+   
Sbjct  389  IGSILLTIPIYDRIIVPITRKIFNNPQGLTPLQRIGVGLVFSIFAMVAAALTELKRMRVT  448

Query  703  ---NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               N     NS + MSVF+L+PQFF VGSGEAF Y GQLDFFL + PK MKTM       
Sbjct  449  HLHNLTHNPNSEIPMSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTM---STGL  505

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
             LS       F   +V  V   +   + WLADN+N G+L  FYWLLA L   N V+YL C
Sbjct  506  FLSTLSLGFFFSSLLVTVVHRVTGHHKPWLADNLNQGKLYDFYWLLALLSGFNLVIYLFC  565

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  566  AKWYVYKDKRLADE  579



>ref|XP_004242006.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=592

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA++++ +  YDR+++PL  ++  +P GFT L RIA+GLV S   M  +AL E KRL  A
Sbjct  390  VASVMLVIIFYDRVIVPLCARYMNSPHGFTPLTRIAIGLVTSIFAMIAAALTEIKRLNVA  449

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL + PK MKTMSTGLF++
Sbjct  450  KSHGLINNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFIS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            T+SLGFF SS LVS+V KVT+ S   + WLADN+N G+L  FYWLLA L V+N +++  C
Sbjct  510  TISLGFFFSSILVSIVDKVTAKS---RPWLADNLNQGKLYNFYWLLAILSVLNVILFFYC  566

Query  352  S---IWFKPRKNKSAVEME  305
            +   ++ + R  +  ++ME
Sbjct  567  AKRYVYKEKRLAEVGIQME  585



>ref|XP_002464959.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
 gb|EER91957.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
Length=595

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ +YDR+V PL ++  G P G T LQR+ +GL LS  GMAV+AL+E+ R  AA
Sbjct  395  IGSILLTVPVYDRLVAPLARRVTGNPHGLTPLQRVFVGLFLSVAGMAVAALVERHRQTAA  454

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++E  H   +T+SVF L+PQF LVG+GEAF Y GQL FFL + PK MKTM +     +  
Sbjct  455  SAE--HG--VTLSVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTM-STGLFLSTC  509

Query  523  lgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
               F  S L+  +    +  HGG+  WLADN++ GRLD FYWLLA +  IN V++   + 
Sbjct  510  ALGFFFSTLLVTIVHKVTGRHGGRGGWLADNLDDGRLDYFYWLLAVISAINLVIFTFAAR  569

Query  349  --IWFKPRKNKSAVEM  308
              ++ + R   + +E+
Sbjct  570  GYVYKEKRLADAGIEL  585



>ref|XP_003574312.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=599

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 129/206 (63%), Gaps = 14/206 (7%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ LYDR+V P+ ++  G P G + LQR+ LGL LS  GMAV+AL+E+ RL ++
Sbjct  400  IGSILLTVPLYDRLVAPVARRITGNPHGLSPLQRVFLGLFLSIAGMAVAALVERHRLTSS  459

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl-flttl  527
            +    H +TLT  VF L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGL   T  
Sbjct  460  S----HGATLT--VFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTCA  513

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
               F  +  +  V K       G   WLA+N++ GRLD FYWLLA +  +N V +++ + 
Sbjct  514  LGFFLSTLTVTIVHKITGHGPQGSAGWLANNLDQGRLDYFYWLLAVMSAVNLVFFVVAAR  573

Query  349  --IWFKPRKNKSAVEM---ETVMNGN  287
              ++ + R   + +E+   E +M G+
Sbjct  574  GYVYKEKRLADAGIELADEEAIMVGH  599



>ref|XP_009382411.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +ILIT+ +YDR+++P  ++  G P G T LQRIA+GLVLS V M  +AL E+KRL AA
Sbjct  390  VGSILITVPIYDRLIVPAARRLTGNPQGVTPLQRIAVGLVLSIVAMCAAALTERKRLRAA  449

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             ++    + + ++VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TLS
Sbjct  450  RTD-PTAAVVPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  508

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVY  362
            LGFF+SS LV++V KVT  S  G  WL DN+N G+L  FYWLLA L V+N VV+
Sbjct  509  LGFFLSSTLVTIVHKVTGESGKGA-WLPDNLNKGKLYDFYWLLAVLSVLNLVVF  561



>ref|XP_006355480.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 140/210 (67%), Gaps = 16/210 (8%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T   YDR+V+P+ K+    P G + LQRIA+GLVLS + M  +AL E KRL  A
Sbjct  389  VGSILVTCVFYDRVVVPIAKRVLNNPQGLSPLQRIAVGLVLSIIAMIAAALTEVKRLNVA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  HLHGLTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V KVT    G + WLADN+N G+L  FYWLLA L V N +++L  
Sbjct  509  TLSLGFFFSSILVTIVHKVT----GKKPWLADNLNQGKLYDFYWLLAILSVFNLMIFLFF  564

Query  352  S---IWFKPRKNKSAVEMETVMNGNGEEKC  272
            S   ++ + R  +  +EME     + E  C
Sbjct  565  SRRYVYKEKRLAEVGIEME-----DSEPAC  589



>ref|XP_004244572.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT-PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+  YDR+++P+ +++     G T LQRI +GL+LS + M  SAL E KRL  A
Sbjct  388  VGAILLTVIFYDRVIVPICRRFANKRHGLTPLQRIFIGLILSIIAMIASALTEVKRLNTA  447

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ +SVF+LIPQF L+G+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  448  HLNGLTNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  507

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT   H    W+ADN+N G+L  FYWLLA L V+N +V+L  
Sbjct  508  TLALGFFFSSILVTIVHMVTGTKH---PWIADNLNQGKLHDFYWLLAILSVLNLMVFLYT  564

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  565  SKTYVYKEKRLAEMGIELE  583



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR ++P+  +    P G + LQR+ +GLVLS + M  +AL E KRL   
Sbjct  389  VASILLTVPIYDRFIVPIASRILKNPQGLSPLQRVGVGLVLSIIAMIAAALTEIKRLKVV  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G   +  + + +SVF+L PQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  EENGLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LG F SS LV++V K    +  G+ W+ DN+N G+L  FYWLLA L V+N +V+L+C
Sbjct  509  TLALGXFFSSLLVTIVGK---VTEHGKPWIPDNLNEGKLYDFYWLLAVLSVLNLMVFLVC  565

Query  352  SIWFKPRKNKSAVE  311
            + W+  ++ + A E
Sbjct  566  AKWYVYKEKRLADE  579



>ref|XP_004147617.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR ++P+  +    P G + LQR+ +GLVLS + M  +AL E KRL   
Sbjct  389  VASILLTVPIYDRFIIPIASRILKNPQGLSPLQRVGVGLVLSIIAMVAAALTEIKRLKVV  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               G   +  + + +SVF+L PQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  EENGLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V K    +  G+ W+ DN+N G+L  FYWLLA L V+N +V+L+C
Sbjct  509  TLALGFFFSSLLVTIVGK---VTEHGRPWIPDNLNEGKLYDFYWLLAILSVLNLMVFLVC  565

Query  352  SIWFKPRKNKSAVE  311
            + W+  ++ + A E
Sbjct  566  AKWYVYKEKRLADE  579



>ref|XP_009411557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+V+P  ++  G P G T LQRIA+GL LS + M  +AL E+KRLAAA
Sbjct  389  VGSILLTVPVYDRLVVPAARRVTGNPHGLTPLQRIAVGLALSVLAMCAAALTERKRLAAA  448

Query  703  NSEGRHNS-TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttl  527
             ++    +  + +SVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TL
Sbjct  449  WTDPTDTAGVVPLSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  508

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
            SLGFFVSS LV++V KVT  S  G  WL D++N G+L  FYWLLA L  +N VV+++ +
Sbjct  509  SLGFFVSSALVTIVHKVTGESGKGA-WLPDDLNKGKLYDFYWLLAVLSTLNLVVFVVAA  566



>gb|EYU24743.1| hypothetical protein MIMGU_mgv1a003354mg [Erythranthe guttata]
Length=590

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDRI+ P+ ++    P G + LQRI +GLVLS + M  +AL E KRL  A
Sbjct  388  VASILLTVPIYDRIIFPICRRILKNPNGLSPLQRIGVGLVLSIIAMVAAALTEVKRLRVA  447

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +   +T+ +SVF+LIPQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  448  ESHGLTDDPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  507

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K+   +     WLADN+N G+L  FYWLL  L V N V++  C
Sbjct  508  TLSLGFFFSSILVTIVHKL---TGDNNPWLADNLNQGKLYDFYWLLTILSVFNLVIFQYC  564

Query  352  SIWFKPRKNKSAVE  311
            +  +  ++ + A E
Sbjct  565  ARRYVYKEKRLAEE  578



>ref|XP_006358355.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGT-PGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+  YDR+++P+ ++      G T LQRI +GL+LS + M  SAL E KRL  A
Sbjct  388  VGAILLTVIFYDRVIVPICRRVANKRHGLTPLQRIFIGLILSIIAMVASALTEVKRLNTA  447

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ +SVF+LIPQF L+G+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  448  HLNGLTNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  507

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT  +H    W+ADN+N G+L  FYWLLA L V+N +V+L  
Sbjct  508  TLALGFFFSSILVTIVHMVTGTTH---PWIADNLNQGKLHDFYWLLAILSVLNLMVFLYT  564

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  565  SKTYVYKEKRLAEMGIELE  583



>gb|EYU18566.1| hypothetical protein MIMGU_mgv1a020825mg [Erythranthe guttata]
Length=590

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDRI+ P+ ++    P G + LQRI +GLVLS + M  +AL E KRL  A
Sbjct  388  VASILLTVPIYDRIIFPICRRILKNPNGLSPLQRIGVGLVLSIIAMVAAALTEVKRLRVA  447

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +   +T+ +SVF+LIPQF LVGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  448  ESHGLTDDPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  507

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K+   +     WLADN+N G+L  FYWLL  L V N V++  C
Sbjct  508  TLSLGFFFSSILVTIVHKL---TGDNNPWLADNLNQGKLYDFYWLLTILSVFNLVIFQYC  564

Query  352  SIWFKPRKNKSAVE  311
            +  +  ++ + A E
Sbjct  565  ARRYVYKEKRLAEE  578



>emb|CAC00544.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=590

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 140/210 (67%), Gaps = 16/210 (8%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T   YDR V+P+ ++    P G T LQRIA+GL+LS + M  +AL E KRL  A
Sbjct  389  VGSILLTCIFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  HLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V KVT  +     WLADN+N GRL  FYWLLA L V+N +V+L  
Sbjct  509  TLSLGFFVSSILVTIVHKVTVKN----PWLADNLNQGRLYDFYWLLATLSVLNLMVFLFI  564

Query  352  S---IWFKPRKNKSAVEMETVMNGNGEEKC  272
            S   ++ + R  +  +EME     + E  C
Sbjct  565  SRRYVYKEKRLAECGIEME-----DSEPAC  589



>ref|XP_006417264.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
 gb|ESQ35617.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
Length=590

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 132/189 (70%), Gaps = 4/189 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T ALYDR+ +PL KK    P G   LQRI LGLV +++ MAV+AL+E KRL  A
Sbjct  388  VGGLLLTTALYDRVAIPLCKKLFNYPQGLRPLQRIGLGLVFASMAMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  448  HSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+A+++N GRL  FYWL+A L  +NF+++L+ S W
Sbjct  508  LGFFFSSVLVTIVEKFTGKTH---PWIANDLNKGRLYNFYWLVAVLVALNFLIFLVFSKW  564

Query  343  FKPRKNKSA  317
            +  +  + A
Sbjct  565  YVYKDKRLA  573



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 7/200 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ +GMAV+AL+E KRL  A
Sbjct  388  IGGLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  448  HAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+A +  +NF+V+L+ S W
Sbjct  508  LGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKW  564

Query  343  FKPRKNKSA---VEMETVMN  293
            +  ++ + A   +E+E  ++
Sbjct  565  YVYKEKRLADLGIELEDELD  584



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T ALYDR+ + L KK    P G   LQRI LGL+L+++ MAV+AL+E KRL  A
Sbjct  389  VGGLLLTTALYDRVAIKLCKKLFNYPQGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTA  448

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  449  HSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  508

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A L  +NF+++L+ S W
Sbjct  509  LGFFFSSVLVTIVEKFTGTTH---PWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKW  565

Query  343  FKPRKNKSA---VEME  305
            +  +  + A   +E+E
Sbjct  566  YVYKDKRLAEVGIELE  581



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ +GMAV+AL+E KRL  A
Sbjct  388  IGGLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  448  HAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+A +  +NF+V+L+ S W
Sbjct  508  LGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKW  564

Query  343  FKPRKNKSA---VEME  305
            +  ++ + A   +E+E
Sbjct  565  YVYKEKRLADLGIELE  580



>ref|XP_007013427.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY31046.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=583

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 123/196 (63%), Gaps = 1/196 (1%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            + +I++TLA+YDR++MPL++K +   G TNLQ+I  GL  S + MA +A  E KRL+ A 
Sbjct  379  IGSIMLTLAIYDRLIMPLFRKTRKPQGLTNLQKIGFGLFFSIIAMAAAAFAEMKRLSVAK  438

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            ++G    TL +S F L+PQF LVG G+AF+Y GQLDFF+T+SP+ MK +       T   
Sbjct  439  TKGTTTLTLPVSGFLLLPQFILVGIGDAFIYAGQLDFFITESPRGMKAI-GTGLFLTTIA  497

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWF  341
                 S ++  + +  + ++GG DWLA  IN GRLD FY LLA L +IN  ++L+C+  +
Sbjct  498  LGLFGSSILVEIVRNVTETNGGHDWLAHRINDGRLDYFYGLLAVLSLINLGLFLVCAKRY  557

Query  340  KPRKNKSAVEMETVMN  293
            KP   + A+     +N
Sbjct  558  KPNHGEVALRTNDKVN  573



>ref|XP_009611019.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
 dbj|BAC56914.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T   YDR V+P+ ++    P G + LQRIA+GL+LS + M  +AL E KRL  A
Sbjct  389  VGSILLTCIFYDRAVVPVCRRVLNNPHGTSPLQRIAVGLILSIIAMIAAALTEVKRLNVA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  HLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V KVT    G   WLADN+N GRL  FYWLLA L V+N +++L  
Sbjct  509  TLSLGFFFSSILVTIVHKVT----GKNPWLADNLNQGRLYDFYWLLATLSVLNLMIFLFI  564

Query  352  S---IWFKPRKNKSAVEMETVMNGNGEEKC  272
            S   ++ + R  +  +EME     + E  C
Sbjct  565  SRRYVYKEKRLAECGIEME-----DSEPAC  589



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ +GMAV+AL+E KRL  A
Sbjct  387  IGGLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTA  446

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  447  HAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  506

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+A +  +NF+V+L+ S W
Sbjct  507  LGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKW  563

Query  343  FKPRKNKSA---VEME  305
            +  ++ + A   +E+E
Sbjct  564  YVYKEKRLADLGIELE  579



>ref|XP_010676153.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=593

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 133/184 (72%), Gaps = 7/184 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +A+IL+T+ +YDR+V P+  + +K   G + L+R+ +GL L+TV M V+AL E KRL  A
Sbjct  388  IASILLTVPIYDRLVAPIAARLFKNPQGLSPLRRVGVGLFLATVAMVVAALTEIKRLQVA  447

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G     N+ L ++VF+LIPQF L G+GEA +Y GQLDFFL + PK MKT+STGLFL+
Sbjct  448  ESHGLVHDQNAVLPITVFWLIPQFILTGAGEAMIYAGQLDFFLRECPKGMKTISTGLFLS  507

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLS+GFF S+ +VS+V  +T+ S   + WLADN+N GRL  FYWLL  + ++NFV+++ C
Sbjct  508  TLSIGFFFSTLVVSIVNSLTAHS---KPWLADNLNEGRLYNFYWLLGIISLVNFVLFMFC  564

Query  352  SIWF  341
            + W+
Sbjct  565  AKWY  568



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR ++P+ KK    P GFT LQRI +GLVLS V M V ALIE KRL  A
Sbjct  381  IGTILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVVSMVVGALIEIKRLRYA  440

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G   +  + + M+VF+LIPQ   VG+GEAFMY GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  QSHGLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L  IN V+YL+C
Sbjct  501  TLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAILSAINVVLYLVC  557

Query  352  SIWF---KPRKNKSAVEME  305
            + W+   + R  +  +E+E
Sbjct  558  AKWYVYKEKRLAEECIELE  576



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ +GMAV+AL+E KRL  A
Sbjct  388  IGGLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  448  HAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+A +  +NF+V+L+ S W
Sbjct  508  LGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKW  564

Query  343  FKPRKNKSA---VEME  305
            +  ++ + A   +E+E
Sbjct  565  YVYKEKRLADLGIELE  580



>ref|XP_006662041.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=589

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 123/206 (60%), Gaps = 16/206 (8%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+  YDR+V+P+ ++  G P G T LQR+ +GL LS  GMA +ALIE+ RLA++
Sbjct  392  IGSILLTVPFYDRLVLPVARRLTGNPHGLTPLQRVFVGLFLSIAGMAAAALIERHRLASS  451

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +    H + LT  VF L+PQF LVG+GEAF Y GQLDFFL + PK MKTM     L   +
Sbjct  452  S----HGAVLT--VFLLMPQFVLVGAGEAFTYMGQLDFFLRECPKGMKTM--STGLFLST  503

Query  523  lgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
                     + V        HG +  WLADN+++GRLD FYWLLA L  IN   + + + 
Sbjct  504  CAIGFFFSTLLVTIVHKITGHGPRGGWLADNLDHGRLDYFYWLLAVLSAINLCFFTLAAK  563

Query  349  --IWFKPRKNKSAVEM---ETVMNGN  287
              ++ + R   + +E+   ET+  G+
Sbjct  564  GYVYKEKRLADAGIELADEETIAVGH  589



>ref|XP_009798260.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
 dbj|BAC56913.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T   YDR V+P+ ++    P G T LQRIA+GL+LS + M  +AL E KRL  A
Sbjct  389  VGSILLTCIFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  HLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V KVT  +     WLADN+N GRL  FYWLLA L V+N +++L  
Sbjct  509  TLSLGFFFSSILVTIVHKVTVKN----PWLADNLNQGRLYDFYWLLATLSVLNLMIFLFI  564

Query  352  S---IWFKPRKNKSAVEMETVMNGNGEEKC  272
            S   ++ + R  +  +EME     + E  C
Sbjct  565  SRRYVYKEKRLAECGIEME-----DSEPAC  589



>ref|XP_010553465.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=589

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 5/201 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T A+YDR V+P  KK+   P G T LQRI +GL+ ++  MAV+AL+E KRL  A
Sbjct  387  VGGLLLTTAVYDRFVIPFTKKFLKKPNGLTPLQRIGIGLLFASFAMAVAALVEIKRLRTA  446

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +S    + TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMSTGL L+TL+
Sbjct  447  HSHSPTDKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  506

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF+SS LV++V KVT  +H    W+A+++N GRL  FYWL+A L  +NF V+L+ + W
Sbjct  507  LGFFLSSVLVAIVHKVTGTAHA---WIANDLNKGRLYNFYWLVAVLCALNFAVFLVFAKW  563

Query  343  FKPRKNKSAVEMETVMNGNGE  281
            +   K+K   E+   ++   E
Sbjct  564  YV-YKDKRLAEVGIELDDEPE  583



>ref|XP_007039889.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
 gb|EOY24390.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
Length=584

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR++ P+ +K    P G T LQRI +GLVLS + M  +A+ E KRL  A
Sbjct  382  VASILVTVPIYDRLIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAAMTEIKRLRVA  441

Query  703  NSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N     + +SVF+L+PQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  442  RSHGLTNDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  501

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  502  TLSLGFFVSSLLVTIVHK---VTGNKKPWLPDNLNQGRLYDFYWLLAILSSLNLAIYLVF  558

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  559  AKWYVYKDKRLADE  572



>ref|XP_007039888.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
 gb|EOY24389.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
Length=583

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA+IL+T+ +YDR++ P+ +K    P G T LQRI +GLVLS + M  +A+ E KRL  A
Sbjct  381  VASILVTVPIYDRLIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAAMTEIKRLRVA  440

Query  703  NSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  N     + +SVF+L+PQF  VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  441  RSHGLTNDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FYWLLA L  +N  +YL+ 
Sbjct  501  TLSLGFFVSSLLVTIVHK---VTGNKKPWLPDNLNQGRLYDFYWLLAILSSLNLAIYLVF  557

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  558  AKWYVYKDKRLADE  571



>ref|XP_010919516.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=592

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+ + +YDR+V+P  ++  G P G T LQRIA+GL LS   MA +AL E KRL AA
Sbjct  386  VGSILLMVPIYDRVVVPAARRLTGNPQGLTPLQRIAVGLTLSIFAMAAAALTELKRLHAA  445

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++     ST+ +SVF+L+PQFF  G+GEAF Y GQLDFFL + PK MKTMSTGLFL+TLS
Sbjct  446  SAV-DAGSTVPLSVFWLVPQFFFTGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  504

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS--  350
            LGFF SS LV++V KVT  +  G  WL DN+N GRL  FYWLLA L V+N  ++L+ +  
Sbjct  505  LGFFFSSALVTIVDKVTGETGRGA-WLPDNLNQGRLYDFYWLLAALSVLNLGLFLLSAKG  563

Query  349  IWFKPRKNKSAVEMETVMNGNGEEKC  272
              +K ++  S  +   V     +E C
Sbjct  564  YVYKEKRMASGEQGSVVAVELADEAC  589



>gb|EYU27205.1| hypothetical protein MIMGU_mgv1a025825mg, partial [Erythranthe 
guttata]
Length=280

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 108/181 (60%), Gaps = 10/181 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VA IL+ +A YDR+++PL++K    P G T LQR+ +GLVLS   M  +AL E KRL  A
Sbjct  75   VATILLIVAFYDRLLVPLFRKVLKNPQGLTPLQRMGVGLVLSIFAMVTAALTEVKRLGVA  134

Query  703  NSEGRHNS------TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl  542
             S    +S       + +SVF+L+PQFFLVGSGEAF Y GQLDFFL + PK MKTM    
Sbjct  135  RSHLTTSSGTATSAVVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTM---S  191

Query  541  flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVY  362
                LS           +V  V   +   + WLADN+N G+L  FYWLLA L  +N VV+
Sbjct  192  TGLFLSTLSLGFFVSSILVSIVHKVTGQKKSWLADNLNQGKLYNFYWLLAILSTLNLVVF  251

Query  361  L  359
            L
Sbjct  252  L  252



>ref|XP_002529778.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32592.1| oligopeptide transporter, putative [Ricinus communis]
Length=584

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 137/199 (69%), Gaps = 11/199 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +  +K + G T LQRI +GL+ S + M  +AL E KRL  A
Sbjct  382  VGSILLTVPIYDRIIVPVLRNVFKKSNGLTPLQRIGVGLIFSIIAMIAAALTEIKRLRTA  441

Query  703  NSEG-RHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  H+ T  +  +VF+LIPQF LVGSGEA  Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  442  ESHGLTHDPTAEIPTTVFWLIPQFILVGSGEALTYVGQLDFFLKECPKGMKTMSTGLFLS  501

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V KVT    G   W+ADNIN G+L  FYWLLA L  +N V++L C
Sbjct  502  TLSLGFFFSSLLVTIVHKVT----GNSPWIADNINEGKLYDFYWLLAILAGLNLVLFLGC  557

Query  352  SIWFKPRKNKSA---VEME  305
            + W+  +  + A   +E+E
Sbjct  558  AKWYVYKDKRLAEVGIELE  576



>dbj|BAJ98569.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 138/188 (73%), Gaps = 10/188 (5%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANS  698
            +IL+  +L +R+++PL  +  G P G T+LQR+  GLV +TV MAV+AL+EK R  AAN 
Sbjct  386  SILLFTSLNERLLVPLASRLTGRPQGLTSLQRVGTGLVFATVAMAVAALVEKMRRDAANG  445

Query  697  EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslg  518
            E R    + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++P+ MK+MSTGLFL TLS+G
Sbjct  446  EPR----VAISAFWLVPQFFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLVTLSMG  501

Query  517  ffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFK  338
            FF+SSFLV +V  VTS +     W+ +N++ GRLDLFYW+LA LGV+NF+V+++ +   +
Sbjct  502  FFLSSFLVFLVHTVTSGA-----WIRNNLDMGRLDLFYWMLAVLGVVNFIVFVMIARRHE  556

Query  337  PRKNKSAV  314
             + N S V
Sbjct  557  YKPNTSVV  564



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 5/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            + A +ITLALYDR+VM   KK +G+ G TNLQ+I LGL +S + MAV+A +E+KRL    
Sbjct  380  IGATMITLALYDRMVM---KKSRGSRGLTNLQKIGLGLAISVIAMAVAAAMEQKRLKVIR  436

Query  700  S-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +      STL ++ F LIPQF +VG  EAFMY+GQL FF++++PK MK +S  LFLTT+S
Sbjct  437  ANRNTPTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAISNSLFLTTIS  496

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
             G+FV++ LV ++KK+T    GG  WLA  IN  RLD FY L++ L  IN  +YL+C+ W
Sbjct  497  FGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINLGLYLVCARW  556

Query  343  FKPRKNKSAVEMETVMNGNGEEK  275
            +KP  +++A + + V   + EEK
Sbjct  557  YKPNSSENAKDSD-VNASHDEEK  578



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 5/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            + A +ITLALYDR+VM   KK +G+ G TNLQ+I LGL +S + MAV+A +E+KRL    
Sbjct  382  IGATMITLALYDRMVM---KKSRGSRGLTNLQKIGLGLAISVIAMAVAAAMEQKRLKVIR  438

Query  700  S-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +      STL ++ F LIPQF +VG  EAFMY+GQL FF++++PK MK +S  LFLTT+S
Sbjct  439  ANRNTPTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAISNSLFLTTIS  498

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
             G+FV++ LV ++KK+T    GG  WLA  IN  RLD FY L++ L  IN  +YL+C+ W
Sbjct  499  FGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINLGLYLVCARW  558

Query  343  FKPRKNKSAVEMETVMNGNGEEK  275
            +KP  +++A + + V   + EEK
Sbjct  559  YKPNSSENAKDSD-VNASHDEEK  580



>ref|XP_006307075.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
 gb|EOA39973.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
Length=590

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T A+YDR+ +PL KK    P G   LQRI LGL+L+ +GMAV+ALIE KRL  A
Sbjct  389  VGGLLLTTAVYDRVAIPLCKKLFNYPHGLRPLQRIGLGLILACMGMAVAALIEIKRLRTA  448

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MK MSTGL L+TL+
Sbjct  449  HAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLA  508

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS--  350
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A L  +NF+V+L+ S  
Sbjct  509  LGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLVAVLVALNFLVFLVFSKR  565

Query  349  -IWFKPRKNKSAVEME  305
             ++ + R   + +E++
Sbjct  566  YVYKEKRLADAGIELD  581



>ref|XP_006650950.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=570

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 140/204 (69%), Gaps = 10/204 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL T+ LYDR++ PL ++  G P G + LQRI +GL+L+ +GMA +AL E++R  AA
Sbjct  370  VAAILFTVPLYDRLLAPLARRLTGHPHGLSPLQRIFVGLLLAVLGMAAAALTERRRRDAA  429

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             S     S +T SVF L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+T+S
Sbjct  430  KS----GSGVTQSVFLLLPQFMLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTIS  485

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-I  347
            LG F+S+ LVSVV KVTS     + WLADN++ GRLD FYW+L  + V+N  V++  + +
Sbjct  486  LGLFLSTALVSVVHKVTSR----RPWLADNLDDGRLDNFYWMLGAMNVLNLAVFVAAARV  541

Query  346  WFKPRKNKSAVEMETVMNGNGEEK  275
            +    K  +   + +  + +G++ 
Sbjct  542  YVYKEKRPADAGIISSAHDDGDDD  565



>ref|XP_008658424.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46299.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
 tpg|DAA46300.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
Length=595

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 119/196 (61%), Gaps = 13/196 (7%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ +YDR++ PL ++  G P G T LQR+ +GL+LS  GMAV+AL+E+ R  A+
Sbjct  398  IGSILLTVPVYDRLLAPLARRLTGNPHGLTPLQRVFVGLLLSVAGMAVAALVERHRQVAS  457

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
                 H +TLT  VF L+PQF LVG+GEAF Y GQL FFL + PK MKTM     L   +
Sbjct  458  G----HGATLT--VFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTM--STGLFLST  509

Query  523  lgffvssflvsvvkkvtSASHGGQD-WLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
                     + V       +H G+D WLADN++ GRLD FYWLLA +  IN V++   + 
Sbjct  510  CALGFFFSTLLVTIVHKVTAHAGRDGWLADNLDDGRLDYFYWLLAVISAINLVLFTFAAR  569

Query  349  --IWFKPRKNKSAVEM  308
              ++ + R   + +E+
Sbjct  570  GYVYKEKRLADAGIEL  585



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 118/204 (58%), Gaps = 7/204 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLA---  710
            V + +ITL +YDR++  L +   G  GFTNLQ+I + + LS +GMA ++  E KRL    
Sbjct  383  VGSTIITLIMYDRLLPFLRQSSNGVQGFTNLQKIGIAIFLSILGMAAASFAEMKRLEVVR  442

Query  709  AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
            A       +STL ++ FYL+PQF LVG G+ FMYTGQLDFF+T+SPK MK + +     T
Sbjct  443  ANRGSTSTSSTLPITAFYLLPQFVLVGIGDGFMYTGQLDFFITESPKGMKAI-STGLFLT  501

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
             +   F  S ++  +    +    G  WL   IN  RLD FY LLA LG IN V YL+ +
Sbjct  502  TNALGFFGSSILVTIITKVTGEEVGHGWLLSRINDSRLDFFYALLAVLGFINLVFYLVLA  561

Query  349  IWFKPRKNKSAVEMETVMNGNGEE  278
             W+KP   + A +    +NG  E+
Sbjct  562  SWYKPSPVEDAHQK---INGKEEK  582



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 140/192 (73%), Gaps = 6/192 (3%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR+++P+ +K +K   G T LQRI +GLV+S   MA +AL E KRL AA
Sbjct  389  VGSILLTVPVYDRVIVPVARKLFKNPQGLTPLQRIGVGLVMSATAMAAAALTELKRLRAA  448

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G     ++ + +SVF+L+PQFFLVGSGEAF Y GQL FFL + P+ MKTMSTG+FL+
Sbjct  449  RSNGLADDPSAQIPLSVFWLVPQFFLVGSGEAFTYIGQLGFFLRECPEGMKTMSTGMFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LVS+V KVT        WL+DN+N G+L  FYWLLA L V+NF +YL+C
Sbjct  509  TLSLGFFLSSLLVSIVHKVTGERR--PPWLSDNLNQGKLYNFYWLLAVLSVLNFGLYLVC  566

Query  352  SIWFKPRKNKSA  317
            + W+  ++++ A
Sbjct  567  ARWYVYKESRLA  578



>dbj|BAC56915.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDR+++P+ +++   P G T LQRI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FYWLLA L V+N + +L  
Sbjct  512  TLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFYWLLAILSVLNLMFFLYF  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>ref|XP_009763469.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=594

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDR+++P+ +++   P G T LQRI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FYWLLA L V+N + +L  
Sbjct  512  TLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFYWLLAILSVLNLMFFLYF  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 139/199 (70%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            +  IL+T+  YDR ++P+ KK    P GFT LQRI +GLVLS V M V ALIE KRL  A
Sbjct  381  IGTILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVVSMVVGALIEIKRLRYA  440

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G   +  + + M+VF+LIPQ   VG+GEAFMY GQL+FFL + PK MKTMSTGLFL+
Sbjct  441  QSHGLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLS  500

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L  IN V+YL+C
Sbjct  501  TLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAILSAINVVLYLVC  557

Query  352  SIWF---KPRKNKSAVEME  305
            + W+   + R  +  +E+E
Sbjct  558  AKWYVYKEKRLAEECIELE  576



>gb|EYU29794.1| hypothetical protein MIMGU_mgv1a003534mg [Erythranthe guttata]
Length=579

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAAN  701
            + +IL+ L ++DR+++PL KK KGT G T  Q+I +GL +S + M  +A+IE KRL  A 
Sbjct  382  IGSILLALGIHDRLIVPLLKKKKGTLGLTKFQKIGVGLFISILSMVFAAIIETKRLKVAK  441

Query  700  SEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlsl  521
            S  R  S L +S F+L+PQF L G+ E F+YTGQ+DFFLT+SPK MK MST LFLTT+S 
Sbjct  442  STSRAVSILPISAFWLVPQFVLAGAAEGFVYTGQIDFFLTESPKGMKAMSTSLFLTTISF  501

Query  520  gffvssflvsvvkkvtSASHGGQDWLADNINY--GRLDLFYWLLAGLGVINFVVYLICSI  347
            GFFVSS L+++++K      GG +WL  N+N   G+L+ FY L+A L  IN   YL C+ 
Sbjct  502  GFFVSSALIAIIRKA--TQRGGHNWLPANLNNADGKLNYFYALVALLSAINLGFYLYCAK  559

Query  346  WFKPRKNK  323
             F  +K +
Sbjct  560  LFLRKKRQ  567



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 128/189 (68%), Gaps = 4/189 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L T A+YDR V+P  K +   P G T LQRI LGL L+ + M V+AL+E KRL  A
Sbjct  440  VGGLLFTTAVYDRFVIPFTKNFLKKPNGLTPLQRIGLGLFLAFMAMVVAALVEIKRLRTA  499

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++  +   TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MKTMS GL L+TL+
Sbjct  500  HAHDQTVKTLPLGFYLLIPQYLIVGIGEALLYTGQLDFFLRECPKGMKTMSAGLLLSTLA  559

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V KVT  +H    W+ADN+N GRL  FYWL++ L  +NF+V+L+ S W
Sbjct  560  LGFFFSSVLVTIVHKVTGTTHA---WIADNLNKGRLYNFYWLVSVLCALNFIVFLVFSKW  616

Query  343  FKPRKNKSA  317
            +  +  + A
Sbjct  617  YVYKDKRLA  625



>ref|XP_009598780.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=594

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 136/199 (68%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDRI++P+ +++   P G T LQRI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRIIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ ++VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FYWLLA L V N + +L  
Sbjct  512  TLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFYWLLAILSVFNLMFFLYS  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>ref|XP_009382412.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 119/191 (62%), Gaps = 3/191 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDRIV+P+ ++  G P G ++LQRIA+GLV S +GM  ++L E+KRL+ A
Sbjct  388  VGSILVTVPFYDRIVVPVTRRITGNPQGLSSLQRIAVGLVFSILGMCAASLTERKRLSTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             +     + + + VF+LIPQFFLVG+G AFMY GQLDFFL + PK MKTM +     +  
Sbjct  448  LAN-PTAAVVPLVVFWLIPQFFLVGAGVAFMYIGQLDFFLRECPKGMKTM-STGLFLSTL  505

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
               F  S  +  +    + S G   WL D++N G+L  FYWLL  L  +N V ++  S  
Sbjct  506  SLGFFLSTALVTIVHKVTGSGGKGAWLTDDLNKGKLYNFYWLLVALSTLNLVAFVAASRG  565

Query  343  FKPRKNKSAVE  311
            +  ++ +++V+
Sbjct  566  YVYKETRTSVD  576



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T A+YDR+ + L KK    P G   LQRI LGL+L+++ MAV+AL+E KRL  A
Sbjct  388  VGGLLLTTAIYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MK MSTGL L+TL+
Sbjct  448  HAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A L  INF+++L+ S W
Sbjct  508  LGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLVAVLVAINFLIFLVFSKW  564

Query  343  F---KPRKNKSAVEME  305
            +   + R  ++ +EM+
Sbjct  565  YVYKEKRLAEAGIEMD  580



>dbj|BAC56916.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 136/199 (68%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDRI++P+ +++   P G T LQRI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRIIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ ++VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FYWLLA L V N + +L  
Sbjct  512  TLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFYWLLAILSVFNLMFFLYS  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T A+YDR+ + L KK    P G   LQRI LGL+L+++ MAV+AL+E KRL  A
Sbjct  388  VGGLLLTTAIYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            ++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MK MSTGL L+TL+
Sbjct  448  HAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A L  INF+++L+ S W
Sbjct  508  LGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLVAVLVAINFLIFLVFSKW  564

Query  343  F---KPRKNKSAVEME  305
            +   + R  ++ +EM+
Sbjct  565  YVYKEKRLAEAGIEMD  580



>ref|XP_009800593.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800594.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Nicotiana 
sylvestris]
Length=594

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 136/199 (68%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDR+++P+ +++   P G T LQRI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ ++VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLANDENATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFFVSS LV++V  VT   +    WLADN+N GRL  FYWLLA L V N + +L  
Sbjct  512  TLALGFFVSSILVTIVHIVTGTKN---PWLADNLNQGRLYDFYWLLAILSVFNLMFFLYS  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>ref|XP_003572060.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=601

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 129/196 (66%), Gaps = 11/196 (6%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ LYDR+V P+ ++  G P G + LQR+ LGL LS  GMAV+AL+E+ RL ++
Sbjct  402  IGSILLTVPLYDRLVAPVARRITGNPHGLSPLQRVFLGLFLSIAGMAVAALVERHRLTSS  461

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +    H +TLT  VF L+PQF LVG+GEAF Y GQL FFL + PK MKTMSTGLFL+T +
Sbjct  462  S----HGATLT--VFLLMPQFLLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCA  515

Query  523  lgff-vssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
            LGFF  +  +  V K     + G   WLA+NI+ GRLD FYWLLA +  IN V + + + 
Sbjct  516  LGFFFSTLIVTIVHKVTGHGTRGSGGWLANNIDQGRLDYFYWLLAVMSAINLVFFTVAAR  575

Query  349  --IWFKPRKNKSAVEM  308
              ++   R   + +E+
Sbjct  576  GYVYKDKRLADAGIEL  591



>gb|KHG00259.1| Uncharacterized protein F383_18798 [Gossypium arboreum]
Length=585

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL+T+ +YD+++ P+ KK    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  383  VAAILLTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTA  442

Query  703  NSEGRHNSTLT---MSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G  N+ +    +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MK MSTGLFL+
Sbjct  443  SSRGLTNNPMAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLS  502

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV K    +   + WL +N+N GRL  FYWLL  L   N  +YL+ 
Sbjct  503  TLSLGFFVSSLLVTVVHK---VTGNNKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVF  559

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  560  AKWYMYKDKRLADE  573



>ref|XP_004983703.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 115/196 (59%), Gaps = 13/196 (7%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ LYDR++ P+ K+  G P G + LQR+ +GL LS  GMAV+ALIE+ R    
Sbjct  393  IGSILLTVPLYDRLIAPVVKRLTGNPHGLSPLQRVFVGLFLSVAGMAVAALIERHR----  448

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             +   H  T+T  VF L+PQF LVG+GEAF Y GQL FFL + PK MKTM     L   +
Sbjct  449  QTTSEHGVTIT--VFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTM--STGLFLST  504

Query  523  lgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
                     + V        HGG   WLADN+N GRLD FYWLLA +  IN V++ + + 
Sbjct  505  CALGFFFSTLLVTIVGKVTGHGGHGGWLADNLNDGRLDYFYWLLAVISAINLVLFTLAAR  564

Query  349  --IWFKPRKNKSAVEM  308
              ++ + R   + +E+
Sbjct  565  GYVYKEKRLADAGIEL  580



>gb|EMT27347.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=542

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 118/196 (60%), Gaps = 13/196 (7%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ LYDR+V P+ ++  G P G + LQR+ +GL LS  GMA +ALIE+ RL   
Sbjct  345  IGSILLTVPLYDRLVAPVARRVTGNPHGLSPLQRVFVGLFLSIAGMAAAALIERYRLTE-  403

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +++G     +T++VF L+PQF LVG+GEAF Y GQLDFFL + PK MKTM     L   +
Sbjct  404  SADG-----VTLTVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTM--STGLFLST  456

Query  523  lgffvssflvsvvkkvtSASHGGQD-WLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
                     + V        HG  D WLA+NI+ GRLD FYWLLA +  IN V + I + 
Sbjct  457  CALGFFFSTLIVTIVHKVTGHGSNDGWLANNIDQGRLDYFYWLLAVMSGINIVFFTIAAR  516

Query  349  --IWFKPRKNKSAVEM  308
              ++ + R   + +E+
Sbjct  517  GYVYKEKRMADAGIEL  532



>ref|XP_002889915.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66174.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
Length=589

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 130/189 (69%), Gaps = 4/189 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V  +L+T ALYDR+ + L KK    P G   LQRI LGL+  ++ MAV+AL+E KRL  A
Sbjct  388  VGGLLLTTALYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLFGSMAMAVAALVELKRLRTA  447

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            NS G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + PK MK MSTGL L+TL+
Sbjct  448  NSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLA  507

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+A L  +NF+++L+ S W
Sbjct  508  LGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKW  564

Query  343  FKPRKNKSA  317
            +  ++ + A
Sbjct  565  YVYKEKRLA  573



>ref|XP_008367434.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Malus domestica]
Length=598

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 137/201 (68%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K    P G T LQRI +GLV S   M  +AL E KRL AA
Sbjct  396  VGSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSIFAMVAAALTEVKRLNAA  455

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G      + + +SVF+L+PQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  456  RSHGLTGNPTAEIPLSVFWLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  515

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V K    + G + W ADN+N G+L  FYWLLA L  +N VVYL C
Sbjct  516  TLSLGFFVSSLLVSIVHK---VTGGHEPWPADNLNQGKLYDFYWLLALLSALNLVVYLFC  572

Query  352  SIWFKPRKNKSA---VEMETV  299
            + W+  +  + A   +E+E V
Sbjct  573  ANWYVYKDKRFADEGIELEEV  593



>emb|CAN71417.1| hypothetical protein VITISV_004658 [Vitis vinifera]
Length=591

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 134/201 (67%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+ +YDRI++P+  +    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  389  VGAILLTVPVYDRILVPIAARILKNPQGLTPLQRIGVGLVLSILAMVAAALTELKRLHVA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +   + + + VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTDDPTAVVPLGVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LVS+V K+   +   + WLADN+N G+L  FYWLLA L V N   YLI 
Sbjct  509  TLSLGFFLSSLLVSIVHKL---TGDRKPWLADNLNQGKLYNFYWLLAILSVFNLGFYLIG  565

Query  352  SIWF---KPRKNKSAVEMETV  299
            + W+     R     +E+E V
Sbjct  566  AKWYVYKDKRLADEGIELEDV  586



>ref|XP_002266951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Vitis vinifera]
Length=591

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 134/201 (67%), Gaps = 10/201 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V AIL+T+ +YDRI++P+  +    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  389  VGAILLTVPVYDRILVPIAARILKNPQGLTPLQRIGVGLVLSILAMVAAALTELKRLHVA  448

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G  +   + + + VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  449  RSHGLTDDPTAVVPLGVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF+SS LVS+V K+   +   + WLADN+N G+L  FYWLLA L V N   YLI 
Sbjct  509  TLSLGFFLSSLLVSIVHKL---TGDRKPWLADNLNQGKLYNFYWLLAILSVFNLGFYLIG  565

Query  352  SIWF---KPRKNKSAVEMETV  299
            + W+     R     +E+E V
Sbjct  566  AKWYVYKDKRLADEGIELEDV  586



>ref|XP_009333673.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 134/192 (70%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K    P G T LQRI +GLV ST  M  +AL E KRL AA
Sbjct  394  VGSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSTFAMVAAALTEVKRLNAA  453

Query  703  NS---EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S    G   + + +SVF+L+PQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  454  RSLGLTGNPTAEIPLSVFWLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  513

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V  VT  ++    WLADN+N G+L  FYWLLA L  +N VVYL C
Sbjct  514  TLSLGFFVSSLLVSIVHNVTGDTN---PWLADNLNQGKLYDFYWLLALLSALNLVVYLFC  570

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  571  ANWYVYKDKRLA  582



>ref|XP_002452347.1| hypothetical protein SORBIDRAFT_04g024090 [Sorghum bicolor]
 gb|EES05323.1| hypothetical protein SORBIDRAFT_04g024090 [Sorghum bicolor]
Length=597

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 134/201 (67%), Gaps = 14/201 (7%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANS  698
            +IL+  +L +R+++PL  +  G P G T+LQR+  GL LS   MAVSAL+EKKR  A+N 
Sbjct  391  SILLFTSLNERLLVPLAARLTGRPQGLTSLQRVGTGLALSVAAMAVSALVEKKRRDASNG  450

Query  697  EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslg  518
             G     + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++P+ MK+MSTGLFL TLS+G
Sbjct  451  PGH----VAISAFWLVPQFFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLVTLSMG  506

Query  517  ffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFK  338
            FF+SSFLV  V  VT     G  W+ +N++ GRLDLFYW+LA LGV NF V+++    F 
Sbjct  507  FFLSSFLVFAVDAVT-----GGAWIRNNLDRGRLDLFYWMLAVLGVANFAVFIV----FA  557

Query  337  PRKNKSAVEMETVMNGNGEEK  275
             R    A  +   +  +G  +
Sbjct  558  RRHQYKASNLPAAVAPDGAAR  578



>gb|KJB25600.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
 gb|KJB25601.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
 gb|KJB25602.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=402

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL+T+ +YD+++ P+ KK    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  200  VAAILLTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTA  259

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G      + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MK MSTGLFL+
Sbjct  260  SSHGLTTNPVAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLS  319

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV K    +   + WL +N+N GRL  FYWLL  L   N  +YL+ 
Sbjct  320  TLSLGFFVSSLLVTVVHK---VTGNKKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVF  376

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  377  AKWYMYKDKRLADE  390



>emb|CAC00545.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=594

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 135/199 (68%), Gaps = 10/199 (5%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+  YDRI++P+ +++   P G T L RI  GLVLS + M  +AL E KRL  A
Sbjct  392  VGSILLTVIFYDRIIVPICRRFMNKPHGLTPLHRIFTGLVLSILAMIAAALTEVKRLKVA  451

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +  G     N+T+ ++VF+L+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  452  HLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  511

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TL+LGFFVSS LV++V  VT   +    WLADN+N GRL  FYWLLA L V N + +L  
Sbjct  512  TLALGFFVSSILVTIVHVVTGTKN---PWLADNLNQGRLYDFYWLLAILSVFNLMFFLYS  568

Query  352  S---IWFKPRKNKSAVEME  305
            S   ++ + R  +  +E+E
Sbjct  569  SRKYVYKEKRLAEMGIELE  587



>ref|XP_010228489.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brachypodium distachyon]
Length=559

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = -3

Query  853  LYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANSEGRHNST  677
            LYDR+++P+ +++ G P GFT LQR+ +GLV+S   M  + ++E  RL AA S G  +S 
Sbjct  367  LYDRLIVPVARRFTGHPRGFTQLQRMGIGLVISVFSMIAAGVLEVARLRAAASHGMLDSK  426

Query  676  --LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslgffvss  503
              L +S+F+ +PQ+F+VG+ E F++ GQ+DFF  Q+P +M+++       T +      S
Sbjct  427  DFLPVSIFWQVPQYFIVGAAEVFVFVGQIDFFYDQAPDAMRSL-GAALSLTSAALGNYLS  485

Query  502  flvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK  323
             L+ V+    S  +GG  W+ DN+N G LD F+WLLA L V+NFVVYL  + W+K +  K
Sbjct  486  TLLVVIVTAVSTRNGGIGWIPDNLNKGHLDYFFWLLAALSVLNFVVYLWIAKWYKYKVYK  545

Query  322  SA  317
            +A
Sbjct  546  TA  547



>ref|XP_009333599.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDRI++P+ +K    P G T LQRI +GLV ST  M  +AL E KRL AA
Sbjct  394  VGSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSTFAMVAAALTEVKRLNAA  453

Query  703  NSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
             S G      + + +SVF L+PQFF VG+GEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  454  RSHGLTGNPTAEIPLSVFSLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  513

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LVS+V  VT  ++    WLADN+N G+L  FYWLLA L  +N VVYL C
Sbjct  514  TLSLGFFVSSLLVSIVHNVTGDTN---PWLADNLNQGKLYDFYWLLALLSALNLVVYLFC  570

Query  352  SIWFKPRKNKSA  317
            + W+  +  + A
Sbjct  571  ANWYVYKDKRLA  582



>gb|KJB25603.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=555

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL+T+ +YD+++ P+ KK    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  353  VAAILLTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTA  412

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G      + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MK MSTGLFL+
Sbjct  413  SSHGLTTNPVAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLS  472

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV K    +   + WL +N+N GRL  FYWLL  L   N  +YL+ 
Sbjct  473  TLSLGFFVSSLLVTVVHK---VTGNKKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVF  529

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  530  AKWYMYKDKRLADE  543



>gb|ERN02841.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
Length=578

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 133/203 (66%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+ + LYDR++ PL ++  G P GF+ LQRIA GL+LS + M  +AL E KR+ AA
Sbjct  378  VVSILLIVPLYDRVIRPLSRRITGHPQGFSPLQRIACGLILSVLAMVAAALTEIKRVHAA  437

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +     +S + +SVF+L+PQF LVG GEA  Y GQLDFFL + P+ MK+MSTG+FL+TLS
Sbjct  438  HPS---SSVVPLSVFWLVPQFVLVGVGEALTYVGQLDFFLKECPQGMKSMSTGMFLSTLS  494

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LVSVV K+T+    G  W+AD++N GRL  FYWLL  L  +N  V+  C+  
Sbjct  495  LGFFFSSILVSVVDKLTTHGSSGGGWIADDLNKGRLYDFYWLLGILSFLNLGVFFFCARG  554

Query  343  FKPRKNKSAVEMETVMNGNGEEK  275
            +     + A E E     N  E+
Sbjct  555  YVYNDARMAEEDEMKCLDNMHEE  577



>emb|CCN27450.1| low affiniy nitrate transporter, partial [Triticum aestivum]
Length=230

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 132/185 (71%), Gaps = 10/185 (5%)
 Frame = -3

Query  874  AILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAANS  698
            ++L+  AL +R+++PL  +    P G T+LQR+A GLVL+T+GMAVSAL+EKKR  A+N 
Sbjct  46   SVLLFTALNERLLVPLAARLTRRPQGLTSLQRVAAGLVLATLGMAVSALVEKKRRDASNG  105

Query  697  EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslg  518
             G     + +S  +L+PQFFLVG+GEAF Y GQL+FF+ ++P+ MK+MSTGLFL TL++G
Sbjct  106  SG----GVAVSALWLVPQFFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLATLAMG  161

Query  517  ffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFK  338
            FF+SS LV  V  VT  +     W+  +++ GRLDLFYW+LA LG+ NF V+L+ +   +
Sbjct  162  FFLSSLLVLGVDAVTRGA-----WIRGHLDDGRLDLFYWMLAVLGLANFAVFLVFASRHQ  216

Query  337  PRKNK  323
             ++ +
Sbjct  217  YKRTR  221



>ref|XP_006841166.2| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Amborella trichopoda]
Length=582

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 133/203 (66%), Gaps = 4/203 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+ + LYDR++ PL ++  G P GF+ LQRIA GL+LS + M  +AL E KR+ AA
Sbjct  382  VVSILLIVPLYDRVIRPLSRRITGHPQGFSPLQRIACGLILSVLAMVAAALTEIKRVHAA  441

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
            +     +S + +SVF+L+PQF LVG GEA  Y GQLDFFL + P+ MK+MSTG+FL+TLS
Sbjct  442  HPS---SSVVPLSVFWLVPQFVLVGVGEALTYVGQLDFFLKECPQGMKSMSTGMFLSTLS  498

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIW  344
            LGFF SS LVSVV K+T+    G  W+AD++N GRL  FYWLL  L  +N  V+  C+  
Sbjct  499  LGFFFSSILVSVVDKLTTHGSSGGGWIADDLNKGRLYDFYWLLGILSFLNLGVFFFCARG  558

Query  343  FKPRKNKSAVEMETVMNGNGEEK  275
            +     + A E E     N  E+
Sbjct  559  YVYNDARMAEEDEMKCLDNMHEE  581



>ref|XP_004983702.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 121/196 (62%), Gaps = 13/196 (7%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ LYDR++ P+ K+  G P G + LQR+ +GL LS  GMAV+ALIE+ R    
Sbjct  393  IGSILLTVPLYDRLIAPVVKRLTGNPHGLSPLQRVFVGLFLSVAGMAVAALIERHR----  448

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl-flttl  527
             +  +H  T+T  VF L+PQF LVG+GEAF Y GQL FFL + PK MKTMSTGL   T  
Sbjct  449  QTTSKHGVTIT--VFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCA  506

Query  526  slgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
               FF +  +  V K      HGG  WLADN+N GRLD FYWLL  +  IN V + + + 
Sbjct  507  IGFFFSTLLVTIVGKVTGHDGHGG--WLADNLNDGRLDYFYWLLGVISTINLVFFTLAAK  564

Query  349  --IWFKPRKNKSAVEM  308
              ++ + R   + +E+
Sbjct  565  GYVYKEKRLADAGIEL  580



>ref|XP_008796822.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=600

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 8/198 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRL---  713
            V +IL+T+ +YDR+V+P   +  G P G T LQRIA+GLVLS   M  +AL E KRL   
Sbjct  388  VGSILLTVPVYDRLVVPAAVRLTGNPQGLTPLQRIAVGLVLSIFAMVAAALTEHKRLHAA  447

Query  712  --AAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglf  539
              A ++S     ST+ + VF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTGLF
Sbjct  448  WAANSSSSVSQGSTVPLGVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLF  507

Query  538  lttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYL  359
            L+TLSLGFF+SS LVS+V KVT  S  G  WLADN+N GRL  FYWLLA L V N V++L
Sbjct  508  LSTLSLGFFLSSALVSIVHKVTGESGKGP-WLADNLNDGRLYNFYWLLAVLSVANLVLFL  566

Query  358  ICSIWFKPRKNKSAVEME  305
            + +  +   K K  +E E
Sbjct  567  VSAKGYV-YKEKRRMEAE  583



>gb|AAM47310.1|AF377946_12 putative peptide transporter protein [Oryza sativa Japonica Group]
Length=377

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 127/187 (68%), Gaps = 4/187 (2%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +++I + LYD I++P+ +++ G P GFT LQR+ +GLV+S   MA +A++E KRL  A
Sbjct  190  VVSVIIWVPLYDSILVPIARRFTGNPRGFTELQRMGIGLVISIFSMAAAAVLEIKRLDIA  249

Query  703  NSEG--RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglfltt  530
             +E     N  + +++ + IPQ+FLVG+ E F + G L+FF  QSP +M+++ + L L T
Sbjct  250  RAEHLVDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPDAMRSLCSALQLVT  309

Query  529  lslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
             +LG ++S+F++++V   T+   G   W+ DN+N G LD F+WLLAGL  +NFV+Y+IC+
Sbjct  310  TALGNYLSAFILTLVAYFTTRG-GNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICA  368

Query  349  IWFKPRK  329
              +K +K
Sbjct  369  NKYKSKK  375



>gb|KJB25604.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=554

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL+T+ +YD+++ P+ KK    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  352  VAAILLTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTA  411

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G      + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MK MSTGLFL+
Sbjct  412  SSHGLTTNPVAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLS  471

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV K    +   + WL +N+N GRL  FYWLL  L   N  +YL+ 
Sbjct  472  TLSLGFFVSSLLVTVVHK---VTGNKKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVF  528

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  529  AKWYMYKDKRLADE  542



>gb|KJB25599.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=586

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 130/194 (67%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            VAAIL+T+ +YD+++ P+ KK    P G T LQRI +GLVLS + M  +AL E KRL  A
Sbjct  384  VAAILLTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTA  443

Query  703  NSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
            +S G      + + +SVF+L+PQF LVG+GEAF Y GQLDFFL + PK MK MSTGLFL+
Sbjct  444  SSHGLTTNPVAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLS  503

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFFVSS LV+VV K    +   + WL +N+N GRL  FYWLL  L   N  +YL+ 
Sbjct  504  TLSLGFFVSSLLVTVVHK---VTGNKKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVF  560

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  561  AKWYMYKDKRLADE  574



>ref|XP_003608752.1| Nitrate transporter [Medicago truncatula]
 gb|AES90949.1| peptide/nitrate transporter [Medicago truncatula]
Length=593

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKK-WKGTPGFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+ +YDR+++P+ +K +K   G T LQRI +GLV S   M  +AL E KR+  A
Sbjct  390  IGSILLTIPIYDRVIVPITRKIFKNPQGLTPLQRIGVGLVFSIFAMVAAALTELKRMRMA  449

Query  703  ---NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflt  533
               N     NS + MSVF+LIPQFF VGSGEAF Y GQLDFFL + PK MKTMSTGLFL+
Sbjct  450  HLHNLTHNPNSEIPMSVFWLIPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  509

Query  532  tlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLIC  353
            TLSLGFF SS LV++V K    +   + WLADN+N  +L  FYWLLA L V+N V+YL+C
Sbjct  510  TLSLGFFFSSLLVTLVHK---VTSQHKPWLADNLNEAKLYNFYWLLALLSVLNLVIYLLC  566

Query  352  SIWFKPRKNKSAVE  311
            + W+  +  + A E
Sbjct  567  ANWYVYKDKRLAEE  580



>ref|XP_008658431.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46302.1| TPA: hypothetical protein ZEAMMB73_201644 [Zea mays]
Length=588

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 136/208 (65%), Gaps = 20/208 (10%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            + +IL+T+  YDR+V P+  +  G P G T LQR+ +GL+LS  GMAV+ALIE+ R    
Sbjct  391  IGSILLTVPAYDRLVAPVAHRLTGNPHGLTPLQRVFVGLLLSVAGMAVAALIERHR----  446

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
              +      +T++VF L+PQF LVG+GEAF Y GQL FFL + PK MKTMSTGLFL+T +
Sbjct  447  --QTTSELGVTITVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCA  504

Query  523  lgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLLAGLGVINFVVYLICS-  350
             GFF S+ LV++V KVT   HGG+  WLADNI+ GRLD FYWLLA +  IN V++   + 
Sbjct  505  FGFFFSTLLVTIVHKVT--GHGGRGGWLADNIDDGRLDYFYWLLAVISAINLVLFTFAAR  562

Query  349  --IWFKPRKNKSAVEMETVMNGNGEEKC  272
              ++ + R   + +E+        +E+C
Sbjct  563  GYVYKEKRLADAGIEL-------ADEEC  583



>dbj|BAK05363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 111/178 (62%), Gaps = 8/178 (4%)
 Frame = -3

Query  880  VAAILITLALYDRIVMPLWKKWKGTP-GFTNLQRIALGLVLSTVGMAVSALIEKKRLAAA  704
            V +IL+T+ +YDR++ PL ++  G P G + LQRI +GL LS + MAV+ L E++RL A+
Sbjct  406  VGSILLTVPIYDRLIAPLARRLTGNPQGLSPLQRIFVGLFLSILAMAVAGLTERRRLTAS  465

Query  703  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  524
             +       + +SVF ++PQF LVG+GEAF Y GQLDFFL + PK MKTM +     T  
Sbjct  466  TAG------VQLSVFLIVPQFLLVGAGEAFTYIGQLDFFLRECPKDMKTM-STGLFLTTL  518

Query  523  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICS  350
               F  S  +  V    ++S G + WLA++I+ GRLD FYWLLA +   N  +++  +
Sbjct  519  SLGFFLSSGLVSVVHAVTSSDGRRPWLANDIDKGRLDYFYWLLAAISAANLGIFVAAA  576



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2004804698818