BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4137

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          364   4e-120   Nicotiana tomentosiformis
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          361   4e-119   Nicotiana sylvestris
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    360   7e-119   Solanum tuberosum [potatoes]
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    360   9e-119   Solanum tuberosum [potatoes]
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          357   3e-117   Solanum lycopersicum
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   353   6e-116   Sesamum indicum [beniseed]
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              352   2e-115   Sesamum indicum [beniseed]
emb|CAN80825.1|  hypothetical protein VITISV_015452                     343   5e-112   Vitis vinifera
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                342   7e-112   Erythranthe guttata [common monkey flower]
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                341   3e-111   Erythranthe guttata [common monkey flower]
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    335   1e-109   
gb|EPS69883.1|  hypothetical protein M569_04879                         327   3e-106   Genlisea aurea
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    327   4e-106   Nicotiana sylvestris
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          328   7e-106   Nelumbo nucifera [Indian lotus]
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    326   1e-105   Nicotiana sylvestris
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          325   4e-105   Nicotiana tomentosiformis
emb|CDP02616.1|  unnamed protein product                                323   2e-104   Coffea canephora [robusta coffee]
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    322   5e-104   Cucumis sativus [cucumbers]
gb|ACE60602.1|  putative galactomannan galactosyl transferase           322   5e-104   Coffea arabica [arabica coffee]
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    322   1e-103   Nelumbo nucifera [Indian lotus]
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    318   3e-102   Cucumis melo [Oriental melon]
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              312   9e-100   Morus notabilis
gb|ADL36661.1|  CAMTA domain class transcription factor                 308   3e-98    Malus domestica [apple tree]
emb|CDP02619.1|  unnamed protein product                                308   3e-98    Coffea canephora [robusta coffee]
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             307   3e-98    Prunus persica
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    307   4e-98    Prunus mume [ume]
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    308   8e-98    Pyrus x bretschneideri [bai li]
gb|ADL36663.1|  CAMTA domain class transcription factor                 306   9e-98    Malus domestica [apple tree]
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    305   4e-97    Glycine max [soybeans]
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    306   4e-97    
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             303   1e-96    Phaseolus vulgaris [French bean]
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    303   2e-96    
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            303   3e-96    Gossypium arboreum [tree cotton]
gb|KJB46678.1|  hypothetical protein B456_008G0841002                   301   8e-96    Gossypium raimondii
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     299   2e-95    Solanum tuberosum [potatoes]
gb|KJB18050.1|  hypothetical protein B456_003G031400                    300   2e-95    Gossypium raimondii
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              300   2e-95    Sesamum indicum [beniseed]
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            300   4e-95    Gossypium arboreum [tree cotton]
emb|CAI79403.1|  galactomannan galactosyltransferase                    299   5e-95    Senna occidentalis [antbush]
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    300   6e-95    Fragaria vesca subsp. vesca
ref|XP_003611556.1|  Galactomannan galactosyltransferase                298   1e-94    Medicago truncatula
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              298   1e-94    
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             298   1e-94    Citrus clementina [clementine]
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     298   2e-94    Citrus sinensis [apfelsine]
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    298   2e-94    Glycine max [soybeans]
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    296   6e-94    
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    294   6e-93    
ref|XP_012079430.1|  PREDICTED: putative glycosyltransferase 7          294   7e-93    Jatropha curcas
ref|XP_006857127.1|  PREDICTED: galactomannan galactosyltransfera...    295   9e-93    Amborella trichopoda
ref|XP_002310890.2|  alpha galactosyltransferase family protein         293   1e-92    
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          293   2e-92    Populus euphratica
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   291   7e-92    Citrus sinensis [apfelsine]
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          289   5e-91    Populus euphratica
ref|XP_002525290.1|  transferase, putative                              289   6e-91    Ricinus communis
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              288   8e-91    Solanum lycopersicum
emb|CAI11452.1|  alpha-6-galactosyltransferase                          288   8e-91    Solanum tuberosum [potatoes]
ref|XP_002320005.2|  alpha galactosyltransferase family protein         288   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     287   2e-90    
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    286   5e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43940.1|  hypothetical protein B456_007G224800                    286   6e-90    Gossypium raimondii
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              286   8e-90    Nicotiana tomentosiformis
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          282   3e-88    Eucalyptus grandis [rose gum]
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      281   4e-88    Zea mays [maize]
emb|CAI11453.1|  alpha-6-galactosyltransferase                          281   5e-88    Nicotiana benthamiana
ref|XP_002513422.1|  transferase, putative                              280   6e-88    
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              278   6e-87    Morus notabilis
gb|KHN20359.1|  Galactomannan galactosyltransferase 1                   272   1e-86    Glycine soja [wild soybean]
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              276   3e-86    Nicotiana sylvestris
emb|CDY49440.1|  BnaA09g42270D                                          276   5e-86    Brassica napus [oilseed rape]
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          276   6e-86    Tarenaya hassleriana [spider flower]
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          276   6e-86    Brassica rapa
emb|CDP02617.1|  unnamed protein product                                276   6e-86    Coffea canephora [robusta coffee]
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             275   1e-85    Eutrema salsugineum [saltwater cress]
emb|CDX76887.1|  BnaC08g34730D                                          275   1e-85    
gb|ACH58908.1|  galactosyl transferase                                  273   5e-85    Coffea canephora [robusta coffee]
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          273   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          272   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    271   2e-84    Glycine max [soybeans]
ref|NP_565544.1|  putative glycosyltransferase 7                        271   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             271   3e-84    Capsella rubella
gb|KJB46680.1|  hypothetical protein B456_008G0841002                   271   4e-84    Gossypium raimondii
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   270   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              270   5e-84    Camelina sativa [gold-of-pleasure]
ref|XP_012087425.1|  PREDICTED: galactomannan galactosyltransfera...    270   6e-84    Jatropha curcas
emb|CAD98924.1|  galactomannan galactosyltransferase                    270   9e-84    Lotus japonicus
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          270   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          269   2e-83    Pyrus x bretschneideri [bai li]
ref|NP_680773.1|  glycosyltransferase 6                                 269   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             268   5e-83    
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    269   6e-83    Phoenix dactylifera
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    267   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          267   1e-82    
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              267   1e-82    
gb|EAY87343.1|  hypothetical protein OsI_08746                          266   1e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             266   2e-82    
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          267   2e-82    Prunus mume [ume]
ref|NP_001047970.1|  Os02g0723200                                       267   2e-82    
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    266   2e-82    
ref|NP_001281283.1|  putative glycosyltransferase 7                     266   3e-82    Malus domestica [apple tree]
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              265   7e-82    
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    265   8e-82    Fragaria vesca subsp. vesca
emb|CAI11454.1|  alpha-6-galactosyltransferase                          265   8e-82    Medicago truncatula
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    265   1e-81    Arabis alpina [alpine rockcress]
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      265   2e-81    
emb|CDY29577.1|  BnaA03g54220D                                          264   3e-81    Brassica napus [oilseed rape]
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   263   3e-81    Brassica rapa
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    263   9e-81    Elaeis guineensis
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    261   2e-80    Arabidopsis lyrata subsp. lyrata
emb|CDX72649.1|  BnaC07g46710D                                          259   1e-79    
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          259   1e-79    Sorghum bicolor [broomcorn]
emb|CAB52246.1|  alpha galactosyltransferase                            259   2e-79    Trigonella foenum-graecum [fenugreek]
ref|NP_001068066.1|  Os11g0546500                                       257   4e-78    
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    255   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY81250.1|  hypothetical protein OsI_36429                          256   6e-78    Oryza sativa Indica Group [Indian rice]
emb|CDP02618.1|  unnamed protein product                                255   7e-78    Coffea canephora [robusta coffee]
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like     251   1e-77    Oryza brachyantha
gb|ACF33173.1|  putative galactomannan galactosyl transferase           254   2e-77    Coffea canephora [robusta coffee]
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    253   3e-77    Cyamopsis tetragonoloba [cluster bean]
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          253   4e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              250   4e-76    Pyrus x bretschneideri [bai li]
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    248   2e-75    Setaria italica
dbj|BAK05879.1|  predicted protein                                      244   5e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             242   1e-73    
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910          243   5e-73    Sorghum bicolor [broomcorn]
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              241   6e-73    Prunus mume [ume]
gb|AFW64907.1|  glycosyltransferase 6                                   240   7e-72    
ref|NP_001152534.1|  glycosyltransferase 6                              239   2e-71    
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...    236   8e-71    Zea mays [maize]
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    235   1e-70    Brachypodium distachyon [annual false brome]
gb|ADE76992.1|  unknown                                                 236   2e-70    Picea sitchensis
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    234   2e-70    
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...    235   7e-70    
gb|EMS46901.1|  Galactomannan galactosyltransferase 1                   229   2e-69    Triticum urartu
ref|XP_003608540.1|  Galactomannan galactosyltransferase                232   4e-69    Medicago truncatula
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   226   7e-67    Glycine soja [wild soybean]
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    227   8e-67    Pinus radiata
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...    224   9e-67    Setaria italica
gb|EMT11268.1|  Putative glycosyltransferase 7                          220   1e-66    
gb|ABK25085.1|  unknown                                                 226   2e-66    Picea sitchensis
ref|XP_004980585.1|  PREDICTED: galactomannan galactosyltransfera...    221   2e-66    Setaria italica
dbj|BAJ96459.1|  predicted protein                                      226   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              226   3e-66    
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    226   3e-66    Pinus taeda
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...    224   4e-66    Setaria italica
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...    219   4e-64    Zea mays [maize]
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930          218   1e-63    
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    219   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          213   7e-62    Phoenix dactylifera
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    214   4e-61    Elaeis guineensis
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...    204   2e-58    Setaria italica
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    203   6e-58    Elaeis guineensis
tpg|DAA64594.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    174   5e-50    Pinus taeda
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5          167   2e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5          166   7e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5          165   2e-43    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001761988.1|  predicted protein                                  162   3e-43    
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5          164   4e-43    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48702.1|  Putative glycosyltransferase 3                          159   4e-43    Glycine soja [wild soybean]
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg             164   5e-43    Eutrema salsugineum [saltwater cress]
gb|KEH31956.1|  xyloglucan xylosyltransferase                           163   6e-43    Medicago truncatula
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    163   6e-43    Setaria italica
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5          163   7e-43    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5          163   8e-43    Elaeis guineensis
gb|KHN18571.1|  Putative glycosyltransferase 3                          158   1e-42    Glycine soja [wild soybean]
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5          162   1e-42    Camelina sativa [gold-of-pleasure]
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...    162   2e-42    
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4          162   3e-42    
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...    161   3e-42    
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4          162   3e-42    
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5          160   7e-42    Elaeis guineensis
ref|XP_001765298.1|  predicted protein                                  157   7e-42    
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5          160   7e-42    Prunus mume [ume]
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5          160   7e-42    Pyrus x bretschneideri [bai li]
emb|CDY26738.1|  BnaA06g12840D                                          160   8e-42    Brassica napus [oilseed rape]
gb|ACN27080.1|  unknown                                                 155   8e-42    Zea mays [maize]
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5          160   9e-42    Eucalyptus grandis [rose gum]
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg             160   9e-42    Prunus persica
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5          160   1e-41    Phoenix dactylifera
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5          160   1e-41    Nicotiana sylvestris
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                    160   1e-41    Arabis alpina [alpine rockcress]
gb|KJB50959.1|  hypothetical protein B456_008G195000                    160   1e-41    Gossypium raimondii
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5          160   1e-41    
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg             159   1e-41    Capsella rubella
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    159   2e-41    
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3          159   2e-41    Nicotiana tomentosiformis
ref|XP_012080311.1|  PREDICTED: putative glycosyltransferase 5          159   2e-41    Jatropha curcas
gb|KDP31286.1|  hypothetical protein JCGZ_11662                         158   2e-41    Jatropha curcas
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like     159   2e-41    Glycine max [soybeans]
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like     159   2e-41    Glycine max [soybeans]
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5          159   3e-41    Malus domestica [apple tree]
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like     158   3e-41    Cicer arietinum [garbanzo]
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5          159   3e-41    Tarenaya hassleriana [spider flower]
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5          159   3e-41    Pyrus x bretschneideri [bai li]
emb|CDX85826.1|  BnaC06g23080D                                          153   4e-41    
emb|CAI11456.1|  putative glycosyltransferase                           158   4e-41    Lotus japonicus
ref|XP_010108713.1|  Putative glycosyltransferase 3                     158   5e-41    Morus notabilis
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5          158   5e-41    Sesamum indicum [beniseed]
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g             158   7e-41    Populus trichocarpa [western balsam poplar]
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg                157   8e-41    Erythranthe guttata [common monkey flower]
ref|NP_001047014.1|  Os02g0529600                                       158   8e-41    
emb|CDX96540.1|  BnaA07g31510D                                          152   9e-41    
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5          157   1e-40    Elaeis guineensis
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g             157   1e-40    Phaseolus vulgaris [French bean]
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5          157   1e-40    Nicotiana sylvestris
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5          157   1e-40    Populus euphratica
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4          158   1e-40    Brassica rapa
ref|XP_001781241.1|  predicted protein                                  154   1e-40    
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                       157   2e-40    Arabidopsis thaliana [mouse-ear cress]
gb|EAY89696.1|  hypothetical protein OsI_11232                          156   2e-40    Oryza sativa Indica Group [Indian rice]
ref|NP_001173389.1|  Os03g0306100                                       156   2e-40    
emb|CDY19235.1|  BnaC05g14360D                                          156   2e-40    Brassica napus [oilseed rape]
gb|ABF95527.1|  Glycosyltransferase 3, putative                         156   2e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    156   2e-40    Brachypodium distachyon [annual false brome]
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg             156   2e-40    Eutrema salsugineum [saltwater cress]
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3          156   2e-40    Tarenaya hassleriana [spider flower]
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like     157   2e-40    Setaria italica
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg             156   2e-40    
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g             156   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...    156   2e-40    
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...    156   2e-40    Camelina sativa [gold-of-pleasure]
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                       156   2e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5          156   2e-40    Camelina sativa [gold-of-pleasure]
emb|CDX69995.1|  BnaA10g23440D                                          156   2e-40    
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                    156   3e-40    Arabis alpina [alpine rockcress]
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090          156   3e-40    Sorghum bicolor [broomcorn]
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5          156   3e-40    Camelina sativa [gold-of-pleasure]
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3          156   3e-40    Brassica rapa
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5          156   3e-40    Fragaria vesca subsp. vesca
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5          156   3e-40    Cucumis sativus [cucumbers]
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...    156   3e-40    Arabidopsis lyrata subsp. lyrata
ref|NP_173304.2|  putative glycosyltransferase 4                        157   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5          156   3e-40    Brassica rapa
gb|KEH33442.1|  xyloglucan xylosyltransferase                           156   3e-40    Medicago truncatula
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 5          156   3e-40    Cucumis sativus [cucumbers]
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5          155   3e-40    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg             156   3e-40    
dbj|BAD43079.1|  hypothetical protein                                   157   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    154   4e-40    Oryza brachyantha
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5          155   4e-40    Solanum lycopersicum
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like     155   4e-40    Cicer arietinum [garbanzo]
ref|NP_001049853.1|  Os03g0300000                                       153   5e-40    
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative          155   5e-40    Ricinus communis
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5          155   6e-40    Vitis vinifera
emb|CAN80739.1|  hypothetical protein VITISV_027037                     155   7e-40    Vitis vinifera
gb|ACF82576.1|  unknown                                                 151   7e-40    Zea mays [maize]
gb|AFW71661.1|  putative glycosyltransferase                            155   7e-40    
ref|NP_001105849.1|  putative glycosyltransferase                       155   7e-40    
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570          155   7e-40    Sorghum bicolor [broomcorn]
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530          155   8e-40    Sorghum bicolor [broomcorn]
gb|EMS58373.1|  Putative glycosyltransferase 2                          153   9e-40    Triticum urartu
gb|KJB19373.1|  hypothetical protein B456_003G098400                    155   9e-40    Gossypium raimondii
ref|NP_001049886.1|  Os03g0305800                                       155   9e-40    
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                         154   9e-40    Glycine soja [wild soybean]
emb|CAI11458.1|  putative glycosyltransferase                           154   1e-39    Nicotiana benthamiana
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3          154   1e-39    Camelina sativa [gold-of-pleasure]
gb|EPS66800.1|  hypothetical protein M569_07974                         154   1e-39    Genlisea aurea
gb|EAY89653.1|  hypothetical protein OsI_11184                          154   1e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3          154   1e-39    Camelina sativa [gold-of-pleasure]
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5          154   1e-39    Nelumbo nucifera [Indian lotus]
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like     154   1e-39    Setaria italica
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                    154   1e-39    
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like     154   1e-39    Oryza brachyantha
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...    154   1e-39    
ref|XP_001767750.1|  predicted protein                                  153   2e-39    
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       154   2e-39    Tarenaya hassleriana [spider flower]
dbj|BAK06777.1|  predicted protein                                      154   2e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010089891.1|  Putative glycosyltransferase 5                     154   2e-39    Morus notabilis
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed              154   2e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                    154   2e-39    Morus notabilis
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817             155   2e-39    
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg                154   2e-39    Erythranthe guttata [common monkey flower]
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5          154   2e-39    Nicotiana tomentosiformis
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like     154   2e-39    Glycine max [soybeans]
gb|KHN20409.1|  Putative glycosyltransferase 2                          147   2e-39    Glycine soja [wild soybean]
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...    154   2e-39    
ref|XP_008663454.1|  PREDICTED: putative glycosyltransferase 2          149   3e-39    
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like     153   3e-39    Cicer arietinum [garbanzo]
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                         153   3e-39    
gb|EAY82266.1|  hypothetical protein OsI_37474                          153   4e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative          153   4e-39    
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    152   4e-39    
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg                153   5e-39    
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3          153   5e-39    
gb|KJB28609.1|  hypothetical protein B456_005G060400                    152   5e-39    
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                   152   5e-39    
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5          152   5e-39    
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like     152   6e-39    
gb|KEH24376.1|  xyloglucan xylosyltransferase                           152   6e-39    
ref|NP_001066160.1|  Os12g0149300                                       152   6e-39    
ref|XP_007035584.1|  CAMTA domain class transcription factor            152   6e-39    
ref|XP_006841140.1|  PREDICTED: putative glycosyltransferase 5          152   7e-39    
emb|CBX24469.1|  hypothetical_protein                                   152   7e-39    
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like     152   7e-39    
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase        152   7e-39    
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like     152   7e-39    
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg             152   8e-39    
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5          152   8e-39    
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg             152   8e-39    
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    152   8e-39    
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g             152   8e-39    
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    152   9e-39    
dbj|BAK03947.1|  predicted protein                                      152   9e-39    
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like     152   1e-38    
gb|ACN29046.1|  unknown                                                 152   1e-38    
ref|NP_001150077.1|  glycosyltransferase 5                              152   1e-38    
emb|CDO98874.1|  unnamed protein product                                152   1e-38    
gb|AFW88652.1|  glycosyltransferase 5                                   152   1e-38    
gb|ACE95677.1|  putative xylosyl transferase                            152   1e-38    
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540          152   1e-38    
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3          152   1e-38    
ref|NP_001151451.1|  glycosyltransferase 5                              152   1e-38    
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg                152   1e-38    
gb|AFK30382.1|  galactosyltransferase A                                 152   1e-38    
emb|CDY70418.1|  BnaA04g27220D                                          151   1e-38    
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like     151   1e-38    
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5          152   2e-38    
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...    151   2e-38    
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    151   2e-38    
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110          151   2e-38    
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    151   2e-38    
dbj|BAK00169.1|  predicted protein                                      150   2e-38    
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000          151   2e-38    
emb|CBX25402.1|  hypothetical_protein                                   151   2e-38    
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       151   2e-38    
gb|KHN14624.1|  Putative glycosyltransferase 2                          148   2e-38    
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg             151   2e-38    
ref|XP_010497538.1|  PREDICTED: putative glycosyltransferase 5          144   2e-38    
gb|KHN26556.1|  Putative glycosyltransferase 2                          148   3e-38    
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like     150   3e-38    
emb|CDX93965.1|  BnaC04g21240D                                          150   3e-38    
gb|EMT32465.1|  Putative glycosyltransferase 3                          150   3e-38    
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3          150   3e-38    
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3          150   3e-38    
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       150   3e-38    
emb|CDX99024.1|  BnaC09g48110D                                          150   3e-38    
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    150   3e-38    
ref|XP_006389383.1|  glycosyltransferase 2 family protein               150   3e-38    
ref|XP_006838788.2|  PREDICTED: xyloglucan 6-xylosyltransferase 2       150   3e-38    
ref|XP_001759108.1|  predicted protein                                  149   4e-38    
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    150   4e-38    
gb|ERN01357.1|  hypothetical protein AMTR_s00002p00259350               150   4e-38    
ref|XP_001767288.1|  predicted protein                                  148   4e-38    
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    150   4e-38    
emb|CBI26079.3|  unnamed protein product                                150   4e-38    
gb|AFW59084.1|  hypothetical protein ZEAMMB73_119802                    151   4e-38    
ref|XP_002315554.2|  glycosyltransferase 2 family protein               150   4e-38    
emb|CDP21247.1|  unnamed protein product                                150   5e-38    
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg             150   5e-38    
ref|XP_012083933.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       150   5e-38    
gb|AFK30383.1|  galactosyltransferase B1                                150   5e-38    
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog              147   6e-38    
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase         150   6e-38    
emb|CAI11457.1|  putative glycosyltransferase                           149   8e-38    
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    149   8e-38    
gb|ADE59448.1|  galactosyltransferase                                   149   8e-38    
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1             149   8e-38    
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2             149   9e-38    
emb|CAN77730.1|  hypothetical protein VITISV_027412                     149   1e-37    
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                       152   1e-37    
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    149   1e-37    
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5          149   1e-37    
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1       149   1e-37    
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2          149   1e-37    
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                       149   1e-37    
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...    149   1e-37    
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg             149   1e-37    
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2          148   2e-37    
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                    153   2e-37    
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2          148   2e-37    
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1       148   2e-37    
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847             149   2e-37    
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                           148   2e-37    
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                       148   2e-37    
gb|KJB22531.1|  hypothetical protein B456_004G052700                    148   2e-37    
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       148   2e-37    
dbj|BAK08324.1|  predicted protein                                      148   2e-37    
ref|XP_001755467.1|  predicted protein                                  147   3e-37    
gb|KJB84424.1|  hypothetical protein B456_N024600                       148   3e-37    
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein            148   3e-37    
ref|XP_001772519.1|  predicted protein                                  147   3e-37    
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg             148   3e-37    
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2          147   3e-37    
gb|AAC78266.1|  putative glycosyltransferase                            148   3e-37    
ref|XP_004134208.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    147   3e-37    
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2          147   3e-37    
ref|XP_008453680.1|  PREDICTED: putative glycosyltransferase 3          142   3e-37    
ref|NP_567241.1|  UDP-xylosyltransferase 2                              147   4e-37    
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg                147   4e-37    
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       147   4e-37    
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg             147   4e-37    
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    147   4e-37    
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    147   4e-37    
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    147   4e-37    
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg             147   5e-37    
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...    147   5e-37    
gb|EMT25995.1|  hypothetical protein F775_42861                         143   5e-37    
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    147   5e-37    
dbj|BAK06850.1|  predicted protein                                      147   6e-37    
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    147   6e-37    
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    147   7e-37    
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g             147   7e-37    
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                    147   8e-37    
ref|NP_001288054.1|  calmodulin binding transcription activator 1       147   8e-37    
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg             146   9e-37    
gb|EMT05890.1|  Putative glycosyltransferase 3                          149   9e-37    
ref|XP_008453679.1|  PREDICTED: putative glycosyltransferase 3          140   1e-36    
gb|AFU82535.1|  alpha-1,6-xylosyltransferase                            141   1e-36    
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5          146   1e-36    
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase         145   1e-36    
ref|XP_001776727.1|  predicted protein                                  146   1e-36    
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                           146   1e-36    
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like     146   1e-36    
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2          145   2e-36    
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...    145   2e-36    
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316             145   2e-36    
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       145   2e-36    
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2          145   2e-36    
gb|EPS71488.1|  hypothetical protein M569_03267                         145   2e-36    
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    145   2e-36    
emb|CDY18017.1|  BnaC03g30890D                                          143   2e-36    
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    145   2e-36    
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3          145   2e-36    
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    145   2e-36    
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       145   2e-36    
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like     145   3e-36    
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2          145   3e-36    
ref|XP_001777149.1|  predicted protein                                  145   3e-36    
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like     145   4e-36    
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       145   4e-36    
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                           144   4e-36    
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2          144   5e-36    
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2          144   5e-36    
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       144   5e-36    
ref|XP_001771886.1|  predicted protein                                  144   5e-36    
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2          144   6e-36    
gb|ABK24302.1|  unknown                                                 144   6e-36    
emb|CDX90935.1|  BnaA03g26150D                                          144   6e-36    
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...    144   7e-36    
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg             144   7e-36    
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                           143   7e-36    
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2          144   8e-36    
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...    144   8e-36    
emb|CDY50378.1|  BnaCnng19100D                                          144   9e-36    
ref|XP_002314448.2|  glycosyltransferase 2 family protein               143   9e-36    
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...    144   1e-35    
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like     144   1e-35    
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...    141   1e-35    
emb|CDY22055.1|  BnaA09g00840D                                          143   1e-35    
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2          143   1e-35    
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2          143   1e-35    
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    142   2e-35    
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                    146   2e-35    
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...    142   2e-35    
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2          142   2e-35    
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...    142   2e-35    
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein         142   3e-35    
gb|KJB41948.1|  hypothetical protein B456_007G128800                    141   6e-35    
gb|ABC87290.1|  putative galactosyl transferase                         140   8e-35    
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    140   9e-35    
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein         140   1e-34    
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like     141   1e-34    
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    140   1e-34    
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2          140   2e-34    
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3          140   3e-34    
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080          139   4e-34    
ref|XP_002987473.1|  glycosyltransferase-like protein                   134   4e-33    
ref|XP_001769838.1|  predicted protein                                  135   6e-33    
ref|XP_002980077.1|  glycosyltransferase-like protein                   132   1e-32    
gb|KEH19400.1|  xyloglucan xylosyltransferase                           134   4e-32    
ref|XP_001755939.1|  predicted protein                                  131   2e-31    
emb|CBI25835.3|  unnamed protein product                                128   2e-31    
ref|XP_001764909.1|  predicted protein                                  130   7e-31    
ref|XP_001775066.1|  predicted protein                                  129   8e-31    
ref|XP_001756042.1|  predicted protein                                  129   9e-31    
emb|CBI15187.3|  unnamed protein product                                125   7e-30    
ref|XP_001773763.1|  predicted protein                                  126   1e-29    
ref|XP_001755245.1|  predicted protein                                  125   3e-29    
gb|EPS64541.1|  hypothetical protein M569_10236                         124   4e-29    
ref|XP_001768129.1|  predicted protein                                  124   6e-29    
ref|XP_010040898.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       117   4e-28    
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    119   3e-27    
ref|XP_006665210.1|  PREDICTED: putative glycosyltransferase 3-like     114   7e-27    
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                    117   1e-26    
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3          113   3e-26    
gb|EMT32015.1|  Xyloglucan 6-xylosyltransferase                         110   1e-25    
gb|AIA92435.1|  Glyco_transf_34                                         106   1e-24    
gb|KCW44805.1|  hypothetical protein EUGRSUZ_L01630                     105   1e-23    
emb|CDY65940.1|  BnaUnng01300D                                          106   3e-23    
emb|CDX97271.1|  BnaA02g20620D                                          106   3e-23    
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...    102   1e-21    
emb|CDY70090.1|  BnaCnng66640D                                          102   1e-21    
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...    102   1e-21    
gb|ACF06190.1|  xylosyl transferase                                   94.7    5e-20    
gb|AEN82275.1|  AT3G62720-like protein                                94.4    7e-20    
gb|AEN82277.1|  AT3G62720-like protein                                94.4    7e-20    
gb|AEN82274.1|  AT3G62720-like protein                                93.6    1e-19    
emb|CDY49114.1|  BnaA02g16920D                                        91.7    4e-19    
gb|AFG70961.1|  hypothetical protein CL1035Contig1_04                 87.0    4e-18    
emb|CDX76657.1|  BnaC08g32430D                                        86.3    1e-16    
gb|EMS45714.1|  Putative glycosyltransferase 3                        88.6    4e-16    



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   364 bits (934),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E+KSWTS+NAGVFLIRNCQW+MD M+ WA MGPQSP YD WG  LR TFKDKIF ES
Sbjct  242  LIYEQKSWTSINAGVFLIRNCQWSMDLMEAWAKMGPQSPEYDKWGEILRSTFKDKIFQES  301

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LDNITD YLGIEK      LR
Sbjct  302  DDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLDNITDKYLGIEKVVPS--LR  359

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC DAM
Sbjct  360  RRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQPCSGDHNQMYSGETCFDAM  419

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  420  QKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   361 bits (927),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E+KSWTS+NAGVFLIRNCQW+MD M+ W+ MGPQSP YD WG  LR TFKDKIF ES
Sbjct  242  LIYEQKSWTSINAGVFLIRNCQWSMDLMEAWSKMGPQSPEYDKWGEILRSTFKDKIFQES  301

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LDNITD YLGIEK      LR
Sbjct  302  DDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLDNITDKYLGIEKGVPS--LR  359

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC DAM
Sbjct  360  RRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQPCSGDHNQMYSGETCFDAM  419

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  420  QKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   360 bits (923),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++E++SWTS+NAGVFLIRNCQW+MD M+ WA MGPQSP YD WG  LR TFKDKIF ES
Sbjct  209  LLYEQQSWTSINAGVFLIRNCQWSMDLMEAWAKMGPQSPEYDKWGEILRTTFKDKIFQES  268

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IEK+ A  +LR
Sbjct  269  DDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIEKSEA--RLR  326

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC DAM
Sbjct  327  RRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMYSGETCFDAM  386

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  387  QKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  422



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   360 bits (925),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++E++SWTS+NAGVFLIRNCQW+MD M+ WA MGPQSP YD WG  LR TFKDKIF ES
Sbjct  241  LLYEQQSWTSINAGVFLIRNCQWSMDLMEAWAKMGPQSPEYDKWGEILRTTFKDKIFQES  300

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IEK+ A  +LR
Sbjct  301  DDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIEKSEA--RLR  358

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC DAM
Sbjct  359  RRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMYSGETCFDAM  418

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  419  QKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++E++SWTS+NAGVFLIRNCQW+MD M+ WA MGPQSP YD WG  L  TFKDKIF ES
Sbjct  241  LLYEQQSWTSINAGVFLIRNCQWSMDLMETWAKMGPQSPEYDKWGEILHTTFKDKIFQES  300

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IEK+    +LR
Sbjct  301  DDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIEKSEG--RLR  358

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC DAM
Sbjct  359  RRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMYSGETCFDAM  418

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  419  QKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   353 bits (907),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I+EKKSWTS+NAGVFLIRNCQWAMDFMDVWA MGPQ+P YD WG  LR TFKDKIFPE
Sbjct  251  NLIYEKKSWTSINAGVFLIRNCQWAMDFMDVWARMGPQTPDYDKWGEILRTTFKDKIFPE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQSGL+YL+LKE+EKWG KIYVES+YYFEGYW+EIVGK DNIT  Y+ +EK      L
Sbjct  311  SDDQSGLVYLLLKEKEKWGEKIYVESEYYFEGYWMEIVGKFDNITRKYMEMEKEVGA--L  368

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS SY    +E+L++ G GR  WRRPFITHFTGCQPCSGDHN+MYSG+TC DA
Sbjct  369  RRRHAEKVSGSYGRLREEYLKDVGYGRESWRRPFITHFTGCQPCSGDHNQMYSGQTCFDA  428

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KAL FADNQVLRNYGF+H DLLD ++V PLP+D+P
Sbjct  429  MQKALTFADNQVLRNYGFVHPDLLDPSTVDPLPFDYP  465



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EKKSWTS+NAGVFLIRNCQWAMDFM+VWASMGPQSP Y+ WG  L   FKDKIFPE
Sbjct  247  SLIQEKKSWTSINAGVFLIRNCQWAMDFMEVWASMGPQSPDYEKWGEILSTMFKDKIFPE  306

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQSGL+YLILKE+EKWGNKIYVE +YYFEGYW+EIVG  DNIT+ Y  IEK      L
Sbjct  307  SDDQSGLVYLILKEKEKWGNKIYVEGEYYFEGYWMEIVGTFDNITERYTQIEKEVPA--L  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESYA  W+E+L++AG GR  WRRPFITHFTGCQPCSGDHN+MYSG+TC DA
Sbjct  365  RRRHAEKVSESYARVWEEYLKDAGYGRGSWRRPFITHFTGCQPCSGDHNQMYSGQTCFDA  424

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KAL FADNQVLRNYGF+H DLLD ++V  LP+D+P
Sbjct  425  MQKALIFADNQVLRNYGFVHPDLLDPSTVNLLPFDYP  461



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++KKSWT +NAGVFLIRNCQW++DFM+VWASMGPQ+P YD WG TL  TFKDK+FPE
Sbjct  231  NLIYDKKSWTGLNAGVFLIRNCQWSLDFMEVWASMGPQAPDYDKWGKTLTSTFKDKMFPE  290

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LDNIT  YL IEK      L
Sbjct  291  SDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLDNITSKYLEIEKGV--NTL  348

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY+GE+C ++
Sbjct  349  RRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMYAGESCWNS  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  409  MQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  445



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   342 bits (878),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -1

Query  835  SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSGL  656
            SWTSVNAGVFLIRNCQWAMDF+D WA+MGPQSP YD WG  L  TFKDKIFPESDDQSGL
Sbjct  226  SWTSVNAGVFLIRNCQWAMDFIDTWATMGPQSPEYDKWGEILSATFKDKIFPESDDQSGL  285

Query  655  IYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEK  476
            +YL+LKE+EKWGNKIYVES+YYFEGYW+EI+G  DNIT+ Y   EK AA   LRRRH EK
Sbjct  286  VYLLLKEKEKWGNKIYVESEYYFEGYWMEIIGTFDNITERYTETEKPAAAAALRRRHGEK  345

Query  475  VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNF  296
            VSE YA  W+++L+ AGQGR  WRRPFITHFTGCQPCSG HN+MYSG+TC DAM +AL F
Sbjct  346  VSEGYATVWEDYLKEAGQGRGSWRRPFITHFTGCQPCSGAHNQMYSGQTCVDAMQRALTF  405

Query  295  ADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            ADNQVLRNYGF+H D+ D  +V P+P+D+P
Sbjct  406  ADNQVLRNYGFVHPDIGDPTTVNPIPFDYP  435



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I+EK+SWTS+NAGVFLIRN QWAMDFMD WA MGPQSP YD WG   + TFKDKIFPE
Sbjct  231  HLIYEKQSWTSINAGVFLIRNSQWAMDFMDTWARMGPQSPEYDKWGEIQKSTFKDKIFPE  290

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQSGL+YL+LK+++KWG+KIY+ES YYFEGYW+EIVG  +NIT+ Y  +E  AA  +L
Sbjct  291  SDDQSGLVYLLLKDKDKWGDKIYLESGYYFEGYWMEIVGNFENITERYKQVE--AAEGRL  348

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y   W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSG+TC DA
Sbjct  349  RRRHAEKVSEGYVPVWEEHLKEAGYGRGSWRRPFITHFTGCQPCSGDHNQMYSGQTCFDA  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KAL FADNQVLR+YG++H DLLD ++V+PLP+D+P
Sbjct  409  MQKALIFADNQVLRSYGYVHPDLLDPSTVLPLPFDYP  445



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F  K WT +NAGVFLIRNCQW++DFM+VWASMGPQ+P YD WG TL  TFKDK+FPESD
Sbjct  190  LFWAKLWTGLNAGVFLIRNCQWSLDFMEVWASMGPQAPDYDKWGKTLTSTFKDKMFPESD  249

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LDNIT  YL IEK      LRR
Sbjct  250  DQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLDNITSKYLEIEKGV--NTLRR  307

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            RHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY+GE+C ++M 
Sbjct  308  RHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMYAGESCWNSMQ  367

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  368  KALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  402



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F+KKSWTS+NAGV LIRNCQWAMDF+D WA+MGPQSP YD WG   R  F DK FPE
Sbjct  206  SLVFDKKSWTSINAGVLLIRNCQWAMDFIDAWAAMGPQSPEYDKWGEIQRSIFADKAFPE  265

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GLIYL+LKE +KWG KIYVES+YYFEGYW+EIVG+LD I   YL I++      L
Sbjct  266  SDDQAGLIYLLLKENKKWGPKIYVESEYYFEGYWLEIVGELDRIAAEYLKIQRAVPA--L  323

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEK+S+SYA  W++HL++ G GR   RRPF+THFTGCQPCSG+HN MY  ++CAD 
Sbjct  324  RRRHAEKLSKSYAAAWEKHLKDKGYGRGSLRRPFVTHFTGCQPCSGEHNPMYPEKSCADG  383

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            + KAL FAD+QVLRNYG++HRD LD ++VVPLP+D+P
Sbjct  384  LQKALTFADDQVLRNYGYLHRDPLDPSTVVPLPFDYP  420



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 183/220 (83%), Gaps = 7/220 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT +NAGVFLIRNCQW+MD ++ WA MGPQS  YD WG  L+ TFKDK FP+S
Sbjct  199  LIYEKKSWTGLNAGVFLIRNCQWSMDLIEAWAKMGPQSTEYDKWGQILQSTFKDKNFPQS  258

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+NITD YLGIEK      LR
Sbjct  259  DDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLNNITDKYLGIEKKMPS--LR  316

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+PCSGDHN +YS ETC +AM
Sbjct  317  RRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIYSWETCYNAM  371

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  194
             KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  372  QKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  411



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 182/217 (84%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I++K+SWTS+NAGVFLIRNCQW+M+FMD WA MGPQ+P YD WG T R T  DK+FPE
Sbjct  245  DLIYDKRSWTSLNAGVFLIRNCQWSMEFMDAWAKMGPQTPNYDKWGKTQRSTLSDKLFPE  304

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQSGL+YL+L+E+EKW +KIY+E +YYFEGYW+EIVG L+NITD Y+G+EK   G  L
Sbjct  305  ADDQSGLVYLLLEEKEKWADKIYLEGEYYFEGYWLEIVGTLNNITDKYVGMEKEIRG--L  362

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKV E Y+   +  L+ AG GR  WRRPFITHFTGCQPCSG++N+MYSG++C   
Sbjct  363  RRRHAEKVMEHYSLVREPFLKAAGNGRGSWRRPFITHFTGCQPCSGEYNQMYSGDSCWQG  422

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLR++GFMHRDL D++SV PLP+D+P
Sbjct  423  MEKALNFADNQVLRSFGFMHRDLQDSSSVSPLPFDYP  459



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 183/220 (83%), Gaps = 7/220 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT +NAGVFLIRNCQW+MD ++ WA MGPQS  YD WG  L+ TFKDK FP+S
Sbjct  218  LIYEKKSWTGLNAGVFLIRNCQWSMDLIEAWAKMGPQSTEYDKWGQILQSTFKDKNFPQS  277

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+NITD YLGIEK      LR
Sbjct  278  DDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLNNITDKYLGIEKKMPS--LR  335

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+PCSGDHN +YS ETC +AM
Sbjct  336  RRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIYSWETCYNAM  390

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  194
             KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  391  QKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  430



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 180/217 (83%), Gaps = 7/217 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT +NAGVFLIRNCQW+MD ++ WA MGPQS  YD WG TL+ TF DK FP+S
Sbjct  230  LIYEKKSWTGLNAGVFLIRNCQWSMDLIETWAKMGPQSTEYDKWGQTLQSTFNDKNFPQS  289

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+G+LDNITD YLGIEK      LR
Sbjct  290  DDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIIGQLDNITDKYLGIEKKMPS--LR  347

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y + WKE+L      +  WRRPFITHFTGC+PCSGDHN +YS ETC +AM
Sbjct  348  RRHAEKVSERYGKLWKEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIYSWETCYNAM  402

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             K LNFADNQVLRNYGF+H+DLLD++SV PL +DFP+
Sbjct  403  QKTLNFADNQVLRNYGFVHKDLLDSSSVSPLSFDFPS  439



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I  +KSWT +NAGVFL+RNCQW+MDFM+ WASMGPQ+P YD WG   R TFKDK FPE
Sbjct  225  HLIHREKSWTGLNAGVFLMRNCQWSMDFMEEWASMGPQAPEYDKWGVIQRTTFKDKTFPE  284

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+NITD Y GIEK     +L
Sbjct  285  SDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLENITDAYTGIEKRER--RL  342

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQPCSGDHN+MYSG++C DA
Sbjct  343  RRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQPCSGDHNQMYSGQSCWDA  402

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M  ALNFADNQVLR YGF+HRDLLDT++V+PLP+D+P
Sbjct  403  MQIALNFADNQVLRRYGFVHRDLLDTSTVLPLPFDYP  439



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 179/217 (82%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I+E+KSWT +NAGVFL+RNCQW+MDFMDVWASMGPQ+P Y+ WG  L+ T  DK+FPE
Sbjct  230  HLIYERKSWTGLNAGVFLMRNCQWSMDFMDVWASMGPQTPNYEKWGQVLKSTIPDKLFPE  289

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   DNIT+ Y+ +E+   G++L
Sbjct  290  SDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFDNITERYMEMER--GGQEL  347

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y E  +++L+ AG G+  WRRPFITHFTGCQPCSGDHN+MYSG +C D 
Sbjct  348  RRRHAEKVSEQYGEFREKYLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQMYSGGSCWDG  407

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLR YGFMH D  D+ SV  +PYD+P
Sbjct  408  MRKALNFADNQVLRKYGFMHPDAFDS-SVSEVPYDYP  443



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I  +KSWT +NAGVFL+RNCQW+MDFM+ WASMGPQ+P YD WG   R TFKDK FPE
Sbjct  225  HLIHREKSWTGLNAGVFLMRNCQWSMDFMEEWASMGPQAPEYDKWGVIQRTTFKDKTFPE  284

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+NITD Y GIEK     +L
Sbjct  285  SDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLENITDAYTGIEKRER--RL  342

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQPCSGDHN+MYSG++C DA
Sbjct  343  RRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQPCSGDHNQMYSGQSCWDA  402

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M  ALNFADNQVLR YGF+HRDLLDT++V PLP+D+P
Sbjct  403  MQIALNFADNQVLRRYGFVHRDLLDTSTVPPLPFDYP  439



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 184/217 (85%), Gaps = 2/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSW S+NAGVFLIRNCQW+MDFMDVWASMGPQ+P YD WG T +   KDK++ ES
Sbjct  251  LIYEKKSWVSLNAGVFLIRNCQWSMDFMDVWASMGPQTPDYDKWGKTQKSVLKDKVYAES  310

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL+YL+L+++EKW +KIYVES YYFEGYW+EIV +L+NI+D Y+GIE T+AGE LR
Sbjct  311  DDQSGLVYLLLEQKEKWADKIYVESQYYFEGYWLEIVERLENISDRYVGIE-TSAGE-LR  368

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKV+  YA+  + +L+ AG G   WRRPF+THFTGCQPC+G+HN +YSGE+C   M
Sbjct  369  RRHAEKVNGYYAQLREPYLKEAGFGWGSWRRPFVTHFTGCQPCNGNHNRIYSGESCWKGM  428

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR +GF+H D+LD++SV PLP+D+P+
Sbjct  429  EKALNFADNQVLRTFGFVHGDMLDSSSVSPLPFDYPS  465



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 177/217 (82%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I+E+KSWT +NAGVFL+RNCQW+MDFMDVWASMGPQ+P Y+ WG  L+ T  DK+FPE
Sbjct  231  HLIYERKSWTGLNAGVFLMRNCQWSMDFMDVWASMGPQTPNYEKWGQVLKSTIPDKLFPE  290

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   DNITD Y  +E+   G++L
Sbjct  291  SDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFDNITDKYREMER--GGQEL  348

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y    +++L+ AG G+  WRRPFITHFTGCQPCSGDHN+MYSG +C D 
Sbjct  349  RRRHAEKVSEQYGVFREKYLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQMYSGGSCWDG  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLR YGF+H D +D  SV  +PYD+P
Sbjct  409  MRKALNFADNQVLRKYGFVHPDAMD-PSVSEVPYDYP  444



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I E+ SWT +NAGVFLIRNCQW+MDFM+ WA MGPQ+P Y+ WG+ LR TF DK FPE
Sbjct  245  HLINEQHSWTGLNAGVFLIRNCQWSMDFMETWAKMGPQTPEYEKWGSILRSTFADKAFPE  304

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI KE+EKW ++IY+ES+YYFEGYW EIV  LDNIT+ YL IEK    EKL
Sbjct  305  SDDQTGLAYLIYKEKEKWADRIYLESEYYFEGYWEEIVRTLDNITERYLEIEKK--DEKL  362

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y    +EHL  AG G   WRRPFITHFTGCQPCSG+HN+MYSGE+C D 
Sbjct  363  RRRHAEKVSEQYGAFREEHLGAAGYGLGSWRRPFITHFTGCQPCSGNHNQMYSGESCWDG  422

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLR YGFMH  LLD  SV  +P+D P
Sbjct  423  MTKALNFADNQVLRTYGFMHPHLLD-PSVNAVPFDHP  458



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 173/219 (79%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGVFLIRN QWAMDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  229  HLVMETHSWTGLNAGVFLIRNSQWAMDFLEVWASMGPQTPEYEKWGETLRSTFKDKAFPE  288

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK--TAAGE  503
            SDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE+   A   
Sbjct  289  SDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIERGEEANAV  348

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNEMYSGE+C 
Sbjct  349  RLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNEMYSGESCW  408

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  409  DGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 170/217 (78%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I+EKKSW +VNAG+FLIRNCQW+M+F+DVWA MGPQSP Y  WG TLR TFKDK+FPE
Sbjct  246  NLIYEKKSWVAVNAGIFLIRNCQWSMEFLDVWARMGPQSPEYARWGQTLRSTFKDKMFPE  305

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+YL+LKE+ KWG+ +YVE++Y   GYW  +VG++DNIT  Y  IE+     KL
Sbjct  306  SDDQSALVYLLLKEKRKWGDMMYVENEYSLHGYWAAVVGRIDNITGRYEKIERQEV--KL  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE V E Y + W+EHL +AG  + GWRRPFITHFTGCQPCSGDHN  Y G+ C   
Sbjct  364  RRRHAEAVGERYGKLWEEHLEDAGDRKGGWRRPFITHFTGCQPCSGDHNPSYVGKDCWVG  423

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GF+H DL +  SV PL +DFP
Sbjct  424  MERALNFADNQVLRNFGFVHPDLRN-GSVSPLAFDFP  459



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 168/220 (76%), Gaps = 3/220 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGV LIRNCQW MDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  229  HLVMETHSWTGLNAGVLLIRNCQWTMDFLEVWASMGPQTPDYEKWGETLRSTFKDKAFPE  288

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA--GE  503
            SDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD I D Y  IE+       
Sbjct  289  SDDQTGLAYLIYKEKEKWGKKIYMESEYYFEGYWAEIVGTLDKIEDRYAEIERGEEDNAV  348

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y E  +E+L  AG GR  WRRPFITHFTGCQPCSG HNEMY   +C 
Sbjct  349  RLRRRHAEKVSEQYGEFREEYLSEAGNGRGSWRRPFITHFTGCQPCSGRHNEMYKANSCW  408

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  409  DGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 168/220 (76%), Gaps = 3/220 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGVFLIRNCQW MDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  229  HLVMETHSWTGLNAGVFLIRNCQWTMDFLEVWASMGPQTPDYEKWGETLRSTFKDKAFPE  288

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA--GE  503
            SDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD I D Y  IE+       
Sbjct  289  SDDQTGLAYLIYKEKEKWGKKIYLESEYYFEGYWAEIVGTLDKIEDRYAEIERGEEDNAV  348

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+L  AG GR  WRRPFITHFTGCQPCSG HNEMY   +C 
Sbjct  349  RLRRRHAEKVSEQYGAFREEYLSEAGYGRGSWRRPFITHFTGCQPCSGRHNEMYKANSCW  408

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  409  DGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   308 bits (789),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 172/219 (79%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGVFLIRN QWAMDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  275  HLVTETHSWTGLNAGVFLIRNSQWAMDFLEVWASMGPQTPEYEKWGETLRSTFKDKAFPE  334

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA--GE  503
            SDDQ+GL YLI KE+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE+       
Sbjct  335  SDDQTGLAYLIYKEKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIERGEEDNAV  394

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNEMYSGE+C 
Sbjct  395  RLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNEMYSGESCW  454

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            D M KALNFADNQVLR YG++H    D+A+  P+P+D+P
Sbjct  455  DGMRKALNFADNQVLRKYGYVHASTGDSAA-TPVPFDYP  492



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGVFLIRN QWAMDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  221  HLVMETHSWTGLNAGVFLIRNSQWAMDFLEVWASMGPQTPDYEKWGETLRSTFKDKAFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTA--AGE  503
            SDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD I   Y  IE+    +  
Sbjct  281  SDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLDKIEARYAEIERGEEDSAM  340

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNEMYSGE+C 
Sbjct  341  RLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTGCQPCSGAHNEMYSGESCW  400

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  401  DGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  438



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 175/217 (81%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAGVFLIRNCQW++DFM+ WASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  234  HLIHEKRSWTGLNAGVFLIRNCQWSLDFMEAWASMGPQTPNYEKWGQTLRSTFKDKFFPE  293

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E++KW ++IY+ES+YYFEGYW EI+G   NIT+ Y  +EK  +  +L
Sbjct  294  SDDQTGLAYLIAIEKDKWADRIYLESEYYFEGYWEEILGTFQNITEKYNEMEKGVS--RL  351

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE+Y E  +E+L++AG G+  WRRPFITHFTGCQPCSG +N MYS + C + 
Sbjct  352  RRRHAEKVSETYGEMREEYLKDAGNGKGSWRRPFITHFTGCQPCSGKYNAMYSADDCWNG  411

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQV+R +G+M  DLLD A + P+P+D+P
Sbjct  412  MQKALNFADNQVMRKFGYMRPDLLDNA-ISPVPFDYP  447



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGVFLIRN QWAMDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  284  HLVMETHSWTGLNAGVFLIRNSQWAMDFLEVWASMGPQTPDYEKWGETLRSTFKDKAFPE  343

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTA--AGE  503
            SDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD I   Y  IE+    +  
Sbjct  344  SDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLDKIEARYAEIERGEEDSAM  403

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNEMYSGE+C 
Sbjct  404  RLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTGCQPCSGAHNEMYSGESCW  463

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  464  DGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  501



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 173/218 (79%), Gaps = 6/218 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAGVFLIRNCQW++DFMD WASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  238  HLIHEKRSWTGLNAGVFLIRNCQWSLDFMDSWASMGPQTPNYEKWGKTLRSTFKDKFFPE  297

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E+EKW +KIY+ESDYYFEGYW EIVG L NI+D Y  +E+     +L
Sbjct  298  SDDQTGLAYLIAIEKEKWADKIYLESDYYFEGYWKEIVGTLQNISDKYKKMEEGV--HRL  355

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESY    +E L++AG    GWRRPFITHFTGCQPCSG +N MYS + C + 
Sbjct  356  RRRHAEKVSESYGGIREEDLKDAG---FGWRRPFITHFTGCQPCSGKYNAMYSADDCWNG  412

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            MHKALNFADNQVLRNYGF+  DLL   SV  LP+D+P+
Sbjct  413  MHKALNFADNQVLRNYGFLRPDLL-LNSVSTLPFDYPH  449



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ E  SWT +NAGV LIRN QWAMDF++VWASMGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  229  HLVMETHSWTGLNAGVXLIRNSQWAMDFLEVWASMGPQTPEYEKWGETLRSTFKDKAFPE  288

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA--GE  503
            SDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE+       
Sbjct  289  SDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIERGEEDNAV  348

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNEMYSGE+C 
Sbjct  349  RLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNEMYSGESCW  408

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  409  DGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 2/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWTS+NAGVFLIRNCQW+MD ++ W+SMGP S  Y+ WG   R TFKDK+FPES
Sbjct  237  LIYEKKSWTSLNAGVFLIRNCQWSMDLINTWSSMGPMSKDYEKWGQIQRSTFKDKLFPES  296

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS ++YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE+ A   KLR
Sbjct  297  DDQSAMVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIERGAP--KLR  354

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN+MY+GE+C + M
Sbjct  355  RRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNQMYAGESCWNGM  414

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  415  VKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>gb|KJB46678.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46679.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46681.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46682.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=456

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWTS+NAGVFLIRNCQW+MD ++ W+SMGP S  Y+ WG   R TFKDK+FPES
Sbjct  237  LIYEKKSWTSLNAGVFLIRNCQWSMDLINTWSSMGPMSKDYEKWGQIQRLTFKDKLFPES  296

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE+ A   KLR
Sbjct  297  DDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIERGAP--KLR  354

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN MY+GE+C + M
Sbjct  355  RRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNLMYAGESCWNGM  414

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSP  191
             KALNFADNQVLR YGF+H DL D+++V  +P+D+P    P
Sbjct  415  VKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYPADEGP  455



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 172/217 (79%), Gaps = 6/217 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E KSWT +NAGVFLIRNCQW+MD ++ WA MGPQSP Y+ WG  LR TFKDK FP+S
Sbjct  199  LIYENKSWTGINAGVFLIRNCQWSMDLIEAWAKMGPQSPEYNKWGEILRTTFKDKKFPQS  258

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE++KWG KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IEK      LR
Sbjct  259  DDQSGLSYLLLKEKDKWGEKIYIESEYYFQGYWVDIIETLDNITNKYFEIEKKIP--ILR  316

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKV  S  + W+E+L    +     RRPF+THFTGC+PCSGD+N +YS ETC DAM
Sbjct  317  RRHAEKVV-SEIKVWEEYLI---KDNYSIRRPFVTHFTGCEPCSGDYNPIYSWETCYDAM  372

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H +LLD+++V PLP+DFP+
Sbjct  373  QKALNFADNQVLRKYGFLHNNLLDSSTVFPLPFDFPS  409



>gb|KJB18050.1| hypothetical protein B456_003G031400 [Gossypium raimondii]
Length=450

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 175/221 (79%), Gaps = 2/221 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I++KKSWTS+NAGVFLIRNCQW+MD ++ W++MGP S  Y  WG   R TFKDK+FPES
Sbjct  231  LIYDKKSWTSLNAGVFLIRNCQWSMDLIETWSNMGPISKDYKKWGEIQRSTFKDKLFPES  290

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N T+MYL IE+ AA  +LR
Sbjct  291  DDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENTTEMYLAIERGAA--ELR  348

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    +E+L++AG G+  WRRP ITHFTGCQPC+GDHN+MY GE+C + M
Sbjct  349  RRHAEKVSEQYGAFREEYLKSAGNGKGSWRRPLITHFTGCQPCNGDHNKMYDGESCWNGM  408

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSP  191
             KALNFADNQVLR YGF+H DLLD++ V  +P+D+P    P
Sbjct  409  VKALNFADNQVLRKYGFIHPDLLDSSIVSEVPFDYPADEGP  449



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 169/218 (78%), Gaps = 3/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NMI+EKKSW +VNAGVFLIRNCQW+MDF+DVWASMGP+SP Y  WG  L  TFKDK+FPE
Sbjct  210  NMIYEKKSWVAVNAGVFLIRNCQWSMDFLDVWASMGPKSPDYRKWGQILISTFKDKLFPE  269

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL+LKE+ KWG+ IYVE++Y   GYW+EIV K   I   Y+ IEK     +L
Sbjct  270  SDDQSALIYLLLKERRKWGDMIYVENEYSLHGYWLEIVKKFARIAKKYVEIEKRVP--RL  327

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGR-SGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAE V ESYA + + HL   G+ + SGWRRPFITHFTGCQPCSG+HN  Y G++C  
Sbjct  328  RRRHAEAVRESYAAELERHLAGGGERQDSGWRRPFITHFTGCQPCSGEHNPAYEGDSCWV  387

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             M +ALNFADNQVLR+YGF+H D+ + + V PLP+D+P
Sbjct  388  GMERALNFADNQVLRSYGFVHPDIANGSYVRPLPFDYP  425



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 175/221 (79%), Gaps = 2/221 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I++KKSWTS+NAGVFLIRNCQW+M+ ++ W++MGP S  Y  WG   R TFKDK+FPES
Sbjct  231  LIYDKKSWTSLNAGVFLIRNCQWSMNLIETWSNMGPVSKDYKKWGEIQRSTFKDKLFPES  290

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N T+MYL IE+ AA  +LR
Sbjct  291  DDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENTTEMYLEIERGAA--ELR  348

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    +E+L+ AG G+  WRRP ITHFTGCQPC+GDHN+MY GE+C + M
Sbjct  349  RRHAEKVSEHYGAFREEYLKGAGNGKGSWRRPLITHFTGCQPCNGDHNKMYDGESCWNGM  408

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSP  191
             KALNFADNQVLR YGF+H DLLD+++V  LP+D+P    P
Sbjct  409  VKALNFADNQVLRKYGFIHPDLLDSSTVSELPFDYPADEGP  449



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
             +I E KSWT +NAGVFLIRNCQW++DFMDVWASMGPQ+P Y+ WG  LR TFKDK FPE
Sbjct  235  TLIHEAKSWTGLNAGVFLIRNCQWSLDFMDVWASMGPQTPSYEKWGEKLRTTFKDKAFPE  294

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E+EKW ++IY+ES+YYFEGYW EIV   +NITD Y  +E+      L
Sbjct  295  SDDQTGLAYLIAVEKEKWADRIYLESEYYFEGYWKEIVETYENITDKYHEVERKV--RSL  352

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESY    + ++  AG GR  WRRPFITHFTGCQPCSG+HN MYS + C + 
Sbjct  353  RRRHAEKVSESYGAVREPYVMVAGSGRGSWRRPFITHFTGCQPCSGNHNAMYSPDACWNG  412

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M+KAL FADNQVLR +G++H DL D  SV P+P+D+P
Sbjct  413  MNKALIFADNQVLRKFGYVHPDLQDN-SVSPIPFDYP  448



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   300 bits (767),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 171/222 (77%), Gaps = 6/222 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I +  SWT +NAGVFLIRNC+W+M F++ WA+MGPQ+P Y+ WG TLR TFKDK FPE
Sbjct  234  HLILDTHSWTGLNAGVFLIRNCEWSMKFLEAWAAMGPQTPDYEKWGETLRATFKDKAFPE  293

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGE--  503
            SDDQ+GL YLI KE EKW ++IY+ESDYYFEGYW EIVG L+NIT+ Y  IEK    E  
Sbjct  294  SDDQTGLAYLIYKENEKWADRIYLESDYYFEGYWAEIVGNLENITEKYTEIEKRRGDEDV  353

Query  502  -KLRRRHAEKVSESYAEKWKEHLRNAGQGR--SGWRRPFITHFTGCQPCSGDHNEMYSGE  332
             +LRRRHAEKVSE Y    ++ L++AG G     WRRPF+THFTGCQPCSG HN MYSG 
Sbjct  354  ARLRRRHAEKVSEQYGAFREKFLKDAGSGYGVGSWRRPFVTHFTGCQPCSGAHNLMYSGT  413

Query  331  TCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            +C D M KALNFADNQVLR YGF+H   +D+ S+ PLP+++P
Sbjct  414  SCWDGMQKALNFADNQVLRKYGFVHASAVDS-SIQPLPFNYP  454



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 170/218 (78%), Gaps = 3/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAGVFLIRNCQW++DFM+ WA MGPQSP Y+ WG TLR TFKDK FPE
Sbjct  231  HLIHEKRSWTGLNAGVFLIRNCQWSLDFMEAWAGMGPQSPDYEEWGKTLRSTFKDKFFPE  290

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E+EKWG+KIY+E +YYFEGYW EIV    NI+  Y  IEK     KL
Sbjct  291  SDDQTGLAYLIAIEKEKWGDKIYLEGEYYFEGYWEEIVETFSNISKKYEDIEKVEP--KL  348

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRR+AEKVSE+Y    +E+L++AG G+  WRRPF+THFTGCQPCSG +NEMY+ + C + 
Sbjct  349  RRRYAEKVSEAYGVIREEYLKDAGYGKGSWRRPFVTHFTGCQPCSGKYNEMYTADACWNG  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQV+R +GF+H+DL D   V  LP+D+P 
Sbjct  409  MKKALNFADNQVMRKFGFVHKDLGDNG-VSSLPFDYPQ  445



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 174/217 (80%), Gaps = 6/217 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT +NAGVFLIRNCQW+MD ++ WA MGPQSP Y+ WG  LR TFKDK FP+S
Sbjct  234  LIYEKKSWTGINAGVFLIRNCQWSMDLIEAWAKMGPQSPEYNRWGEILRTTFKDKNFPQS  293

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IEK      LR
Sbjct  294  DDQSGLSYLLLKEKDKWGDKIYIESEYYFQGYWVDIIDTLDNITNKYFEIEKKIP--ILR  351

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKV  S  + W+E+L    +     RRPF+THFTGC+PCSGD+N +YS ETC +AM
Sbjct  352  RRHAEKVV-SEIKVWEEYLI---KDSYSIRRPFVTHFTGCEPCSGDYNPIYSWETCYNAM  407

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H +LLD++SV PLP+D+P+
Sbjct  408  QKALNFADNQVLRKYGFVHNNLLDSSSVRPLPFDYPS  444



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 172/217 (79%), Gaps = 2/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E KSWTS+NAGVFLIRNCQW+MDFMD WA+MGP    Y  WG   R TFKDKIFPES
Sbjct  233  LIYEAKSWTSLNAGVFLIRNCQWSMDFMDTWANMGPIGADYAKWGQVQRSTFKDKIFPES  292

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNIT  Y+ IE+      LR
Sbjct  293  DDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNITGRYMEIERRVR--TLR  350

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC   M
Sbjct  351  RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMYSGETCWSGM  410

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  411  VKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 172/217 (79%), Gaps = 2/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E KSWTS+NAGVFLIRNCQW+MDFMD WA+MGP    Y  WG   R TFKDKIFPES
Sbjct  233  LIYEAKSWTSLNAGVFLIRNCQWSMDFMDTWANMGPIGADYAKWGQIQRSTFKDKIFPES  292

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNIT  Y+ IE+      LR
Sbjct  293  DDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNITGRYMEIERRVR--TLR  350

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC   M
Sbjct  351  RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMYSGETCWSGM  410

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  411  VKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 170/217 (78%), Gaps = 6/217 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAGVFLIRNCQW++DFM+ WASMGPQSP Y+ WG TLR TFKDK FPE
Sbjct  237  HLIHEKRSWTGLNAGVFLIRNCQWSLDFMEAWASMGPQSPNYEKWGQTLRSTFKDKFFPE  296

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   NIT+ Y  +EK    ++L
Sbjct  297  SDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFKNITEKYKEMEKGV--QRL  354

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQPCSG +N MYS   C +A
Sbjct  355  RRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQPCSGKYNAMYSAHDCWNA  414

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            MH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  415  MHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  447



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 170/221 (77%), Gaps = 2/221 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I++ KSWTS+NAGVFLIRNCQW+MD ++ W+SMGP S  Y  WG   R TFKDK+FPES
Sbjct  236  LIYQSKSWTSLNAGVFLIRNCQWSMDLINTWSSMGPMSEDYVKWGQIQRSTFKDKLFPES  295

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS LIYL+ KE+EK+ + IY+E ++Y EGYWVEIVG  +N T+ YL IE+     KLR
Sbjct  296  DDQSALIYLLYKEKEKYYDHIYLEGEFYLEGYWVEIVGGYENTTERYLEIERGVP--KLR  353

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN+MY+GETC + M
Sbjct  354  RRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNQMYAGETCWNGM  413

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSP  191
             KALNFADNQVLR YGF+  DL D+++V  +PYD+P    P
Sbjct  414  VKALNFADNQVLRKYGFVRPDLRDSSTVTEVPYDYPADEGP  454



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 169/217 (78%), Gaps = 3/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAGVFLIRNCQW++DFMD WA MGPQSP Y+ WG+ LR TFKDK FPE
Sbjct  243  HLIHEKRSWTGLNAGVFLIRNCQWSLDFMDSWAGMGPQSPDYEEWGHKLRSTFKDKFFPE  302

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E+EKW ++IY+E +YYFEGYW EIVG  +NI+  Y  IEK     +L
Sbjct  303  SDDQTGLAYLIAIEKEKWADRIYLEGEYYFEGYWEEIVGTFENISKKYDEIEKGV--RRL  360

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESY    +E+LR AG G+  WRRPF+THFTGCQPCSG +NEMY+ + C + 
Sbjct  361  RRRHAEKVSESYGAVREEYLREAGYGKGSWRRPFVTHFTGCQPCSGKYNEMYTADACWNG  420

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +AL+FADNQV+R YG++H DL +   V  +P+D+P
Sbjct  421  MRRALHFADNQVIRKYGYVHPDLGNNL-VTSIPFDYP  456



>ref|XP_012079430.1| PREDICTED: putative glycosyltransferase 7 [Jatropha curcas]
 gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 165/216 (76%), Gaps = 3/216 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  KSWT++NAGVFLIRNCQW+MDF+D WASMGP SP  + WG   R  FKDK+FP S
Sbjct  236  LIYGAKSWTALNAGVFLIRNCQWSMDFIDTWASMGPMSPDVEKWGQIQRSLFKDKLFPGS  295

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS LIYL+ K++    +KIY+E +YYFEGYW EI+   DNITD Y  IEK     KLR
Sbjct  296  DDQSALIYLLYKDKSL-MDKIYLEGEYYFEGYWSEILPTYDNITDKYTEIEK--EDPKLR  352

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE YA   + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY G++C   M
Sbjct  353  RRHAEKVSEQYAAFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNKMYEGDSCWKGM  412

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             KALNFADNQVLR YGF+H DLLD+ +VV  P+D+P
Sbjct  413  VKALNFADNQVLRKYGFVHPDLLDSKTVVETPFDYP  448



>ref|XP_006857127.1| PREDICTED: galactomannan galactosyltransferase 1 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++++ +SWTS+NAG+FLIRNCQW+MDFM+VWAS GPQSP Y+  G T      D++F  
Sbjct  260  HLVYQNRSWTSLNAGIFLIRNCQWSMDFMEVWASFGPQSPNYEEAGKTQTSVLSDRLFSA  319

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+YL+L E++KWG+KI++E+ YYFEGYWVEI+G  +NIT  Y  +EK  A   L
Sbjct  320  SDDQSALVYLLLTERDKWGDKIFLENSYYFEGYWVEIIGTYENITRRYEDMEK--AQPIL  377

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRR  EK++  + E  + +L+ AG GR  WRRPF+THFTGCQPCSGDHN++YSGE C   
Sbjct  378  RRRKPEKLAMKFGELREPYLKEAGNGRFSWRRPFVTHFTGCQPCSGDHNKIYSGENCWKG  437

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GF+H DL D+ASV PLP+DFP
Sbjct  438  MERALNFADNQVLRNFGFVHEDLSDSASVKPLPFDFP  474



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT++NAGVFLIRNCQW+MDFM+ W+ MGP S  Y+ WG   R  FKDK+FPES
Sbjct  240  LIYEKKSWTALNAGVFLIRNCQWSMDFMEKWSGMGPMSSEYEKWGEIQRSVFKDKLFPES  299

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+ K++   G KIY+E +YYFEGYW +I+   DNIT+ Y  +EK     KLR
Sbjct  300  DDQSGLTYLLYKDKSLTG-KIYLEGEYYFEGYWADILPTYDNITEKYTELEKEDG--KLR  356

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY GETC + M
Sbjct  357  RRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNQMYEGETCWNGM  416

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  417  VKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+EKKSWT++NAGVFLIRNCQW+MDFM+ W+SMGP S  Y+ WG   R  FKDK+FPES
Sbjct  240  LIYEKKSWTALNAGVFLIRNCQWSMDFMEKWSSMGPMSSEYEKWGEIQRSVFKDKLFPES  299

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL YL+ K++     KIY+E +YYFEGYW +I+   DNIT+ Y  +EK     KLR
Sbjct  300  DDQSGLTYLLYKDKSL-TEKIYLEGEYYFEGYWADILPTYDNITEKYTELEKEDG--KLR  356

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY GETC   M
Sbjct  357  RRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNQMYEGETCWTGM  416

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  417  VKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 164/217 (76%), Gaps = 16/217 (7%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+E KSWTS+NAGVFLIRNCQW+MDFMD WA+MGP    Y  WG   R TFKDKIFPES
Sbjct  233  LIYEAKSWTSLNAGVFLIRNCQWSMDFMDTWANMGPIGADYAKWGQIQRSTFKDKIFPES  292

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV  +                  LR
Sbjct  293  DDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTV----------------RTLR  336

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MYSGETC   M
Sbjct  337  RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMYSGETCWSGM  396

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  397  VKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  433



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+++KSWT++NAGVFLIRNCQW+MDFM+ W+SMGP S  Y  WG   R  FKDK+FPES
Sbjct  241  LIYKEKSWTALNAGVFLIRNCQWSMDFMEKWSSMGPMSSEYKKWGPIQRSVFKDKLFPES  300

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNIT+ Y  +EK     KLR
Sbjct  301  DDQSGLIYMLYQDK-GLMDKIYLEGEYYFEGYWADIVPTYDNITEKYTELEKEDG--KLR  357

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSGDHN++Y GETC + M
Sbjct  358  RRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQIYHGETCWNGM  417

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  418  VKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 169/217 (78%), Gaps = 3/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+ ++SWT++NAGVFLIRNCQW+MDFMD WA+MGP SP +  WG+  R  FKDK+FP+S
Sbjct  229  LIYGERSWTALNAGVFLIRNCQWSMDFMDTWANMGPMSPDFQKWGHIQRSLFKDKLFPDS  288

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIY++ K++    +KIY+E +YYFEGYW+EIV   DNIT+ Y  IE+     KLR
Sbjct  289  DDQTALIYMLYKDKSL-TDKIYLEGEYYFEGYWLEIVPTYDNITEKYTEIERQDV--KLR  345

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSG+HN+MY G+ C D M
Sbjct  346  RRHAEKVSEQYGAFREPHLKAAGNGKGSWRRPFITHFTGCQPCSGEHNKMYEGDACWDGM  405

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             +ALNFADNQVLR YGF+H DLL++ +VV  P+D+P+
Sbjct  406  VRALNFADNQVLRKYGFVHPDLLNSNTVVETPFDYPD  442



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+SP Y  WG  LR TFKDK FPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSPEYKQWGKILRTTFKDKTFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L YLILK ++KW +KI+  +DY   GYW+ IV + +NIT  Y+ IE+     KL
Sbjct  281  SDDQSALSYLILKGEQKWRSKIHAITDYSLHGYWLGIVNRFENITANYMKIERDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VS SYA  W+  L      + GWRRPFITHFTGCQPCSGDH   Y G++C   
Sbjct  339  RRRHAEAVSHSYAAAWEPLLAEGADEKGGWRRPFITHFTGCQPCSGDHATEYVGDSCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+SP Y  WG  LR TFKDK FPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSPEYKQWGKILRTTFKDKTFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D IT+ Y  IE+     KL
Sbjct  281  SDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDKITENYTKIERDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQPCSGDH   Y G++C   
Sbjct  339  RRRHAEAVSDSYAEAREPLLAEGADGKGGWRRPFITHFTGCQPCSGDHAAEYVGDSCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 167/217 (77%), Gaps = 3/217 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+++KSWT++NAGVFLIRNCQW+MDFM+ W+ MGP S  Y  WG   R  FKDK+FPES
Sbjct  241  LIYKEKSWTALNAGVFLIRNCQWSMDFMEKWSGMGPMSSEYKKWGPIQRSVFKDKLFPES  300

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNIT+ Y  +EK     KLR
Sbjct  301  DDQSGLIYMLYQDK-GLMDKIYLEGEYYFEGYWADIVPTYDNITEKYTELEKEDG--KLR  357

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSGDHN++Y GETC + M
Sbjct  358  RRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQIYHGETCWNGM  417

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  418  VKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+SP Y  WG  LR TFKDK FPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSPEYKQWGKILRTTFKDKTFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D IT+ Y  IE+     KL
Sbjct  281  SDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDKITENYTKIERDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQPCSGDH   Y G++C   
Sbjct  339  RRRHAEAVSDSYAEAREPLLAEGEDGKGGWRRPFITHFTGCQPCSGDHAAEYVGDSCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++E +SW S+NAGVFLIRNCQW++DFM VWA+ GP SP YD WG   +  FKDK+F ES
Sbjct  233  LVYEARSWVSLNAGVFLIRNCQWSLDFMAVWAATGPMSPDYDRWGQLQKAEFKDKLFNES  292

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS L+YL+LK +++WG+KI++ESDYYFEGYWVEIVG+L+N+T  Y  +E+   G  LR
Sbjct  293  DDQSALVYLLLKHKDQWGDKIFLESDYYFEGYWVEIVGRLENMTAKYAAVERQVQG--LR  350

Query  493  RRHAEKVSESYAEKWKEHLR---NAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRHAE  + +Y      HL     A  G +GWRRPF+THFTGCQPCSGDHN+MYSGE+C 
Sbjct  351  RRHAEVANGAYGRLRDRHLSGEDGAVSGPNGWRRPFMTHFTGCQPCSGDHNKMYSGESCW  410

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  411  EGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  449



>gb|KJB43940.1| hypothetical protein B456_007G224800 [Gossypium raimondii]
Length=456

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+ K+SWTS+NAGVFL+RNCQW+MD +  W++MGP S  Y+ WG   R  FKDK++PES
Sbjct  233  LIYNKRSWTSLNAGVFLVRNCQWSMDLISTWSNMGPISEDYEKWGQIQRSMFKDKLYPES  292

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS LIYL+ KE+EK+ + IY+E ++YF+GYWV+++G  DN T+ YL +E+  A  +LR
Sbjct  293  DDQSALIYLLYKEKEKYYDHIYLEKEFYFQGYWVDLIGVYDNTTERYLQMERKVA--RLR  350

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE YA   +E L+  G+    W+RPFITHFTGC+PCSG+HN+ Y GETC + M
Sbjct  351  RRHAEKVSEQYAAFREEFLKETGK----WKRPFITHFTGCEPCSGNHNQKYDGETCWEGM  406

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  197
             KALNFADNQ+LRNYGF+H DLLD+++V  +P+D+PN T
Sbjct  407  VKALNFADNQILRNYGFLHSDLLDSSTVTEVPFDYPNPT  445



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   286 bits (731),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+SP Y  WG  LR TFKDKIFPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSPEYKQWGKILRSTFKDKIFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DNIT  Y+ I++     KL
Sbjct  281  SDDQSALSYIIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDNITGNYVKIDRDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQPCSGDH   Y G+ C   
Sbjct  339  RRRHAEAVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQPCSGDHAAEYVGDKCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHNDIKSNSPVSPVNFDFP  435



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 168/217 (77%), Gaps = 8/217 (4%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I+EKKSWTS+NAGVFLIRNCQW+MDFMDVWA MGPQSP Y+ WG+ LR TF DK+FP+
Sbjct  234  NLIYEKKSWTSINAGVFLIRNCQWSMDFMDVWAGMGPQSPEYERWGHVLRSTFADKLFPD  293

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL+L +++++G+KIYVE++YYFEGYW  IVG L NIT  Y  +++      L
Sbjct  294  SDDQSALIYLLLTQKDRYGDKIYVENEYYFEGYWEGIVGTLPNITREYEDMDRQGP-PAL  352

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEK S  YA +  E      +       PF+THFTGCQPCSG+HN+MYSGE+C + 
Sbjct  353  RRRHAEKASRHYAARRAEAGAARKR-------PFVTHFTGCQPCSGNHNQMYSGESCWNG  405

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVLR YG++  DL+D+A V P+P+D+P
Sbjct  406  MVKALNFADNQVLRRYGYVRPDLMDSAVVKPIPFDYP  442



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE  SWTS+NAGVFLIRNCQW++DFMD WA+MGP SP Y HWG  L+ TFKDK+F E
Sbjct  220  SLVFEASSWTSLNAGVFLIRNCQWSLDFMDAWAAMGPDSPDYQHWGAVLKSTFKDKVFDE  279

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+Y++L+E  +W +K+++ES YYFEGYW+EIVG+L N+T+ Y  +E+      L
Sbjct  280  SDDQSALVYMLLQEGSRWRDKVFLESGYYFEGYWMEIVGRLANMTERYEAMERRPGAAAL  339

Query  496  RRRHAEKVSESYAEKWKEHLRNAG---QGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRRHAE+    YA      L  AG    G  GWRRPF+THFTGCQPCSG  NE YSG++C
Sbjct  340  RRRHAEREHAEYAVARNAALGGAGLAETGVHGWRRPFVTHFTGCQPCSGQRNEHYSGDSC  399

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
               M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  400  DQGMRRALNFADDQVLRAYGFRHASSL-SDDVQPLPFDYP  438



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 160/217 (74%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+SP Y  WG  LR TFKDK FPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSPEYKKWGKILRSTFKDKTFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DNIT  Y  I++     KL
Sbjct  281  SDDQSALSYVIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDNITGNYEKIDRDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQPCSGDH   Y G+ C   
Sbjct  339  RRRHAESVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQPCSGDHVSEYVGDKCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHVDIKSNSPVTPVNFDFP  435



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 165/212 (78%), Gaps = 5/212 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++EK+SWTS+NAGVFLIRNCQW+MDFMDVW SMGPQ+P Y+ WG   R  FKDK+ PE
Sbjct  216  SLVYEKQSWTSINAGVFLIRNCQWSMDFMDVWVSMGPQTPNYESWGQIQRSKFKDKMIPE  275

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQ+ LIYL+LKE+EKWG+KIY+E +Y  + YW+++V   DNIT  YL I++      L
Sbjct  276  ADDQAALIYLLLKEKEKWGDKIYIEEEYDLQKYWLDVVDAYDNITRGYLEIKREVPS--L  333

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y   W+++L+     +   RRP ITHFTGC+PCSG+HN  YS ++C + 
Sbjct  334  RRRHAEKVSEKYGASWEQYLKAKSSFQ---RRPLITHFTGCEPCSGNHNPAYSWDSCFNG  390

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPL  221
            M KALNFADNQVL NYGF+H++L+D++SV PL
Sbjct  391  MRKALNFADNQVLLNYGFLHQNLVDSSSVSPL  422



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 166/215 (77%), Gaps = 8/215 (4%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +++++SWT +NAGVFLIRNCQW+MD +D WA MGPQS  Y+ WG T +  FKDK++PESD
Sbjct  224  VYKEQSWTGLNAGVFLIRNCQWSMDLIDEWAKMGPQSLEYEKWGKTQKLVFKDKLYPESD  283

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQSGLIYL+LKE EKWG+KIY+ES+Y FEGYW+ +VG LDNIT  Y  IEK      LRR
Sbjct  284  DQSGLIYLLLKENEKWGDKIYLESEYNFEGYWLGMVGGLDNITKGYTEIEKKVG--VLRR  341

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            RHAEK+SE Y+E       N  +G    +RPF+ HFTGC+PC+GDHN +Y+ E C + M 
Sbjct  342  RHAEKMSEYYSEI----RENYSKGVE--KRPFVIHFTGCEPCTGDHNPVYTWEACWNGMQ  395

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            KALNFADNQVLR++GF+H DLL+++ V PLP+DFP
Sbjct  396  KALNFADNQVLRSFGFVHPDLLNSSLVSPLPFDFP  430



>gb|KHN20359.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=268

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 166/218 (76%), Gaps = 8/218 (4%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N++ E +SWT +NAGVFL+RNCQW++DFMDVWASMGP SP Y+ WG TL+ TFKDK+ P+
Sbjct  57   NLVRENRSWTGLNAGVFLMRNCQWSLDFMDVWASMGPMSPEYEKWGETLKSTFKDKVLPD  116

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ L YLI  E+ KW +KI++ES+YYF+GYW+EI     N+++ Y  +E+   G  L
Sbjct  117  SDDQTALAYLIAVEK-KWADKIFLESEYYFQGYWLEISKTYYNVSERYDEVERKVKG--L  173

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQPC+G HN  Y    C ++
Sbjct  174  RRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQPCNGHHNPAYDAMDCWNS  229

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  230  MERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  266



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF+KKSW ++NAG+FLIRNCQW+MDF+DVWA+MGP+S  Y  WG  LR TFKDK FPE
Sbjct  221  DLIFKKKSWVAINAGIFLIRNCQWSMDFLDVWANMGPKSREYKQWGKILRTTFKDKTFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L Y+I+K +EKW  KI+  +DY   GYW+ IV + DNIT  Y+ I++     KL
Sbjct  281  SDDQSALSYIIMKGEEKWRRKIHAITDYSLHGYWLGIVDRFDNITGNYVKIDRDVP--KL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAE VSESYA   +  +      + GWRRPFITHFTGCQPCSGDH   Y G+ C   
Sbjct  339  RRRHAEAVSESYAAAREPLVAEGSDWKGGWRRPFITHFTGCQPCSGDHAAEYVGDKCWVG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  399  MERALNFADNQVLRNFGFMHDDIKSNSPVSPVNFDFP  435



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++++++SWT++NAGVFLIRNCQW+M+ +D W SMGP SP +  WG   R  FKDK+FPES
Sbjct  230  VVYDERSWTALNAGVFLIRNCQWSMELIDTWTSMGPVSPDFAKWGEIQRSIFKDKLFPES  289

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E+  A   LR
Sbjct  290  DDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEMEREDA--TLR  347

Query  493  RRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN MY+G+TC + 
Sbjct  348  RRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTMYNGDTCWNG  407

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  408  MIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 167/219 (76%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++ ++SWT++NAGVFL+RNCQW+M+ +D W  MGP SP Y+ WG   R  FKDK+FPE
Sbjct  230  DLVYNQRSWTALNAGVFLMRNCQWSMELIDTWTGMGPTSPEYEKWGEIQRSIFKDKLFPE  289

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E + +KIY+E  YYFEGYW+EIV  LDN+T+ YL +E+  A    
Sbjct  290  SDDQTALIYLLYKHREVYYDKIYLEGAYYFEGYWLEIVSGLDNVTERYLEMERQDA--TC  347

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    G+   RRPFITHFTGCQPCSGDHN MY+G+TC +
Sbjct  348  RRRHAEKVSERYGAFREERFLKGVAGGKGSVRRPFITHFTGCQPCSGDHNRMYNGDTCWN  407

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R+YGF+H DL  T+ + P+P+D+P+
Sbjct  408  GMIRALNFADNQVMRSYGFVHSDLRKTSPLQPVPFDYPD  446



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++++++SWT++NAGVFLIRNCQW+M+ +D W SMGP SP +  WG   R  FKDK+FPES
Sbjct  230  VVYDERSWTALNAGVFLIRNCQWSMELIDTWTSMGPVSPDFAKWGEIQRSIFKDKLFPES  289

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E+  A   LR
Sbjct  290  DDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEMEREDA--TLR  347

Query  493  RRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN MY+G+TC + 
Sbjct  348  RRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTMYNGDTCWNG  407

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  408  MIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+++EKKSW +VN G FL+RNC+W+++F+DVWASM P+SP Y +W  TL  T  DK+ P 
Sbjct  221  NLVYEKKSWVAVNTGSFLMRNCEWSLEFLDVWASMSPRSPDYKYWSETLMSTLSDKVIPG  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +D+QS L+YL+L+E++KWG+ IY+E+ YY  GYWVEIVG+L++I   YL  E  A    L
Sbjct  281  ADEQSSLVYLLLREKKKWGDMIYLENQYYLHGYWVEIVGRLNDIIKKYLDTE--AKVPVL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRR AE VSES    W++ LR+AG  G SGWRRPFITHFTGCQPC+G  +  Y G  C  
Sbjct  339  RRRVAEVVSESLDGVWEKCLRDAGGFGNSGWRRPFITHFTGCQPCTGKRDPAYKGNACWV  398

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  399  AMEKALNFADNQVLRRYGFMHPDLGNGSSVFPVPFDFP  436



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 165/218 (76%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++  +SWT++NAGVFLIRNCQW+M+ +D W +MGP SP Y  WG   R  FKDK+FPES
Sbjct  231  VVYNDRSWTALNAGVFLIRNCQWSMELIDTWTNMGPVSPEYAKWGQIQRSIFKDKLFPES  290

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E++  KIY+E +YYFEGYW+EIV  L N+TD YL +E+  A   LR
Sbjct  291  DDQTALIYLLFKHREEYYPKIYLEGEYYFEGYWLEIVPGLANVTDRYLEMEREDA--TLR  348

Query  493  RRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE Y A + +  LR    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  349  RRHAEKVSERYGAFREERFLRGERGGKGSLRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  409  MIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  446



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 164/218 (75%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++++ +SWT++NAGVFLIRNCQW+M+ +D W SMGP SP +  WG   R  FKDK+FPES
Sbjct  230  VVYDDRSWTALNAGVFLIRNCQWSMELIDTWTSMGPVSPDFAKWGEIQRSIFKDKLFPES  289

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E+  A   LR
Sbjct  290  DDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEMEREDA--TLR  347

Query  493  RRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN MY G+TC + 
Sbjct  348  RRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTMYDGDTCWNG  407

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  408  MIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 162/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+++EKKSW +VN G FL+RNC+W+++F+DVWASM P+SP Y +W  TL  T  DK+ P 
Sbjct  221  NLVYEKKSWVAVNTGSFLMRNCEWSLEFLDVWASMSPRSPDYKYWSETLMSTLSDKVIPG  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +D+QS L+YL+L+E++KWG+  Y+E+ YY  GYWV IVG+L++I   YL  E  A    L
Sbjct  281  ADEQSSLVYLLLREKKKWGDMTYLENQYYLHGYWVAIVGRLNDIIKKYLDTE--AKVPVL  338

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRR AE VSES    W+++LR+AG  G SGWRRPFITHFTGCQPC+G  +  Y G  C  
Sbjct  339  RRRVAEVVSESLDGVWEKYLRDAGGFGNSGWRRPFITHFTGCQPCTGKRDPAYKGNACWV  398

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  399  AMEKALNFADNQVLRRYGFMHPDLGNGSSVSPVPFDFP  436



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 162/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++  +SWT++NAGVFLIRNCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  248  VVYNDRSWTALNAGVFLIRNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  307

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E DYYFEGYW+EIV    N+T+ YL +E+  A   LR
Sbjct  308  DDQTALIYLLYKHREVYYPKIYLEGDYYFEGYWLEIVPGFANVTERYLEMEREDAA--LR  365

Query  493  RRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  366  RRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  425

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  426  MIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  463



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 162/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  +SWT++NAGVFLIRNCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  237  VIYNDRSWTALNAGVFLIRNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  296

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+T+ YL +E+  A   LR
Sbjct  297  DDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANVTERYLEMEREDA--TLR  354

Query  493  RRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  355  RRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  414

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  415  MIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 165/218 (76%), Gaps = 8/218 (4%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N++ E +SWT +NAGVFL+RNCQW++DFMDVWASMGP SP Y+ WG TL+ TFKDK+ P+
Sbjct  217  NLVRENRSWTGLNAGVFLMRNCQWSLDFMDVWASMGPMSPEYEKWGETLKSTFKDKVLPD  276

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ L YLI  E  KW +KI++ES+YYF+GYW+EI     N+++ Y  +E+   G  L
Sbjct  277  SDDQTALAYLIAVEN-KWADKIFLESEYYFQGYWLEISKTYYNVSERYDEVERKVKG--L  333

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQPC+G HN  Y    C ++
Sbjct  334  RRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQPCNGHHNPAYDAMDCWNS  389

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  390  MERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  426



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  +SWT++NAGVFLIRNCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  231  VIYNDRSWTALNAGVFLIRNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  290

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ L+YL+ K +E +  KIY+E D+YFEGYW+EIV  L N+T+ YL +E+  A   LR
Sbjct  291  DDQTALLYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLSNVTERYLEMEREDA--TLR  348

Query  493  RRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  349  RRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  408

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  409  MIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  446



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  +SWT++NAGVFLIRNCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  234  VIYNDRSWTALNAGVFLIRNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  293

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E++  KIY+E DYYFEGYW+EIV  L N+T+ YL +E+  A   LR
Sbjct  294  DDQTALIYLLYKHREEYYPKIYLEGDYYFEGYWLEIVPGLANVTERYLEMEREDA--TLR  351

Query  493  RRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  352  RRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  411

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ +  +P+D+P+
Sbjct  412  MIKAINFADNQVMRKYGFVHSDLGKTSPLQHVPFDYPD  449



>gb|KJB46680.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=424

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 159/209 (76%), Gaps = 2/209 (1%)
 Frame = -1

Query  832  WTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSGLI  653
            +T +   + L RNCQW+MD ++ W+SMGP S  Y+ WG   R TFKDK+FPESDDQS L+
Sbjct  212  FTDMEFKLPLERNCQWSMDLINTWSSMGPMSKDYEKWGQIQRLTFKDKLFPESDDQSALV  271

Query  652  YLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKV  473
            YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE+ A   KLRRRHAEKV
Sbjct  272  YLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIERGAP--KLRRRHAEKV  329

Query  472  SESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFA  293
            SE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN MY+GE+C + M KALNFA
Sbjct  330  SEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNLMYAGESCWNGMVKALNFA  389

Query  292  DNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            DNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  390  DNQVLRKYGFVHSDLHDSSTVTEIPFDYP  418



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++ +SWT++NAGVFLIRNCQW+M+F+D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  210  NIIYDTQSWTALNAGVFLIRNCQWSMEFIDTWKSMGPVSPDYKKWGPIQRSIFKDKLFPE  269

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E+    + L
Sbjct  270  SDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEMER--QDDTL  327

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +Y G+TC +
Sbjct  328  RRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPIYHGDTCWN  387

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  388  EMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++ +SWT++NAGVFLIRNCQW+M+F+D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  210  NIIYDTQSWTALNAGVFLIRNCQWSMEFIDTWKSMGPVSPDYKKWGPIQRSIFKDKLFPE  269

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E+    + L
Sbjct  270  SDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEMERQ--DDTL  327

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +Y G+TC +
Sbjct  328  RRRHAEKVSERYGAFREERFLKGEFGGRDSRRRAFVTHFTGCQPCSGDHNPIYHGDTCWN  387

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  388  EMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|XP_012087425.1| PREDICTED: galactomannan galactosyltransferase 1-like [Jatropha 
curcas]
 gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I++K+SWTS+NAGVFLIRNC+W+M+F+D W +MGPQ+P YD WG   R TFKDK+ PE
Sbjct  224  SLIYKKQSWTSLNAGVFLIRNCEWSMNFLDAWVNMGPQTPNYDKWGQIQRSTFKDKMIPE  283

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQ+ L+YL+LKE+EKWG+KIY+E DY  + YW+E V   D IT  Y+ IE+  +   L
Sbjct  284  ADDQAALVYLLLKEKEKWGDKIYIEEDYDLQTYWLEAVQDYDKITQDYMEIERKVSS--L  341

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RR+HAEKVSESY    +++++     R   +RP ITHFTGC+PC+G+HN +YS E C + 
Sbjct  342  RRKHAEKVSESYGASREQYIKVKNNFR---KRPLITHFTGCEPCTGNHNPVYSWEDCLNG  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPL  221
            + +ALNFADNQVL+NYGF+H++LLD +SV PL
Sbjct  399  IQRALNFADNQVLQNYGFLHQNLLDFSSVSPL  430



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 159/217 (73%), Gaps = 7/217 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++ +K SWT +NAGVFL+RNCQW++DFMDVWA+MGP SP Y  WG  L  TFKDK+ P+
Sbjct  226  DLVKKKHSWTGLNAGVFLMRNCQWSLDFMDVWAAMGPSSPDYKKWGEKLMATFKDKVIPD  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ L YLI   ++KW  KIY+E DYYFEGYWVE+    +N++  Y  +E+   G  L
Sbjct  286  SDDQTALAYLIAMGEDKWTEKIYLEKDYYFEGYWVELAKMYENVSVRYDEVERRVGG--L  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE Y E  +EH++  GQ    WRRPFITHFTGCQPC+G HN  Y+ + C + 
Sbjct  344  RRRHAEKVSERYGEMREEHVKYFGQ----WRRPFITHFTGCQPCNGHHNPAYAADDCWNG  399

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M +ALNFADNQVLR YG++ R L D A V P+PYD+P
Sbjct  400  MDRALNFADNQVLRTYGYVRRSLNDKA-VTPIPYDYP  435



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  +SWT++NAG FLIRNCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  237  VIYNDRSWTALNAGFFLIRNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  296

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+T+ YL +E+  A   LR
Sbjct  297  DDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANVTERYLEMEREDA--TLR  354

Query  493  RRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  355  RRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  414

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  415  MIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW++  +D WASMGPQ P  + WG   +   KDK +P 
Sbjct  226  NMVYEQKSWTSLNAGVLLIRNCQWSLSLLDKWASMGPQGPNPEKWGKIQKSLIKDKAYPG  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+YL++KE+ +W  KIY+ES+YY  GYW+ IV  LD I+  Y+ I++    + L
Sbjct  286  SDDQSALVYLLIKEKSRWAAKIYLESEYYLHGYWLGIVDGLDGISKGYMEIDREV--DLL  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  344  RRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCEPCSGEHNGMYTWEACWNG  403

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  404  MQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I+EK+SWT++NAGVFLIRNCQW+MD +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  213  NIIYEKQSWTALNAGVFLIRNCQWSMDLIDTWKSMGPVSPDYKKWGPIQRSIFKDKLFPE  272

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E++YY +GYW+ + G   N+T+ YL +E+    + L
Sbjct  273  SDDQTALIYLLYKHKELYYPKIYLEAEYYLQGYWIGVFGDFANVTERYLEMER--EDDTL  330

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    GR   RR FITHFTGCQPCSGDHN  Y G+TC +
Sbjct  331  RRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFITHFTGCQPCSGDHNPSYDGDTCWN  390

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  391  EMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  429



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++K+SWT++NAGVFLIRNCQW+M+ +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  221  NIIYDKQSWTALNAGVFLIRNCQWSMELIDTWKSMGPVSPDYAKWGPIQRSIFKDKLFPE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +VG L N+T+ YL +E+  A   L
Sbjct  281  SDDQTALIYLLYKHKEVYYPKIYLEGEYYLQGYWIGVVGGLANVTERYLEMERDDA--TL  338

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  LR    GR   RR F+THFTGCQPCSGDHN +Y G+TC  
Sbjct  339  RRRHAEKVSERYGAFREERFLRGEFGGRGSRRRAFVTHFTGCQPCSGDHNPIYDGDTCWK  398

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R YG++H DL  T+ + P+P+D+P+
Sbjct  399  EMIRALNFADNQVMRTYGYVHSDLSKTSPLQPVPFDYPD  437



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 161/219 (74%), Gaps = 5/219 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N++FE+KSW  +NAGVFLIRNCQW++DFM  WA  GPQ P Y  WG  L+  FK K+F E
Sbjct  252  NLVFEEKSWVGLNAGVFLIRNCQWSLDFMARWARFGPQDPDYVQWGQRLKNEFKGKVFAE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L++++++E++ W +KI++E  +YFEGYW+EI+G+L+ +++MYL +E+      L
Sbjct  312  SDDQSALVHILIRERDLWADKIFLEDSFYFEGYWLEIIGRLEKMSEMYLALERNVP--PL  369

Query  496  RRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRRHAEKV+  Y       L   G   G +GWRRPF+THFTGCQPCSGDHN+ YSGE C 
Sbjct  370  RRRHAEKVAAVYGRMRDGELERQGAETGPAGWRRPFMTHFTGCQPCSGDHNKKYSGENCY  429

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
              M +ALNFAD+QV+R YGF H + L++  V PLP+D+P
Sbjct  430  QGMLRALNFADDQVMRVYGFKHTE-LESYGVTPLPFDYP  467



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 167/219 (76%), Gaps = 4/219 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++ +SWT++NAGVFLIRNCQW+M+F+D W SMGP SP Y  WG  ++R+ KDK+FPE
Sbjct  210  NIIYDTQSWTALNAGVFLIRNCQWSMEFIDTWKSMGPVSPDYKKWG-PIQRSXKDKLFPE  268

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E+    + L
Sbjct  269  SDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEMERQ--DDTL  326

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +Y G+TC D
Sbjct  327  RRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPIYRGDTCWD  386

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  387  EMIRALNFADNQVMRVYGYVHSDLSMTSPLQPLPFDYPN  425



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW+++ +D WASMGPQ P   +WG   +   KDK +P 
Sbjct  226  NMLYEQKSWTSLNAGVLLIRNCQWSLNLLDKWASMGPQGPDPKNWGKIQKSLIKDKAYPG  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD I+  YL I++    + L
Sbjct  286  SDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDGISKGYLEIDREV--DLL  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  344  RRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEPCSGEHNGMYTWEACWNG  403

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  404  MQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW+++ +D WASMGPQ P   +WG   +   KDK +P 
Sbjct  226  NMLYEQKSWTSLNAGVLLIRNCQWSLNLLDKWASMGPQGPDPKNWGKIQKSLIKDKAYPG  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD I+  YL I++    + L
Sbjct  286  SDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDGISKGYLEIDREV--DLL  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  344  RRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEPCSGEHNGMYTWEACWNG  403

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  404  MQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 161/224 (72%), Gaps = 6/224 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++E +SWTS+NAGVFLIRNCQW++DFMD WA+MGP SP Y HWG  L  TFKDK+F E
Sbjct  202  HLVYESRSWTSLNAGVFLIRNCQWSLDFMDAWAAMGPDSPEYQHWGAVLTSTFKDKVFNE  261

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L NIT+ Y  +E+ AA   L
Sbjct  262  SDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGNITERYEAMERGAA--PL  319

Query  496  RRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRRHAE       +  +        A  G SGWRRPF+THFTGCQPCSG  NE Y+G++C
Sbjct  320  RRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTGCQPCSGHRNEHYTGKSC  379

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  194
             + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T+
Sbjct  380  DEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQTA  422



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 163/217 (75%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW+MD M+ W SMGPQ+P ++ WG   +   KDK +P 
Sbjct  187  NMLYEEKSWTSLNAGVLLIRNCQWSMDLMERWTSMGPQNPDHEKWGKAQKSLIKDKAYPG  246

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+++W ++IY+ES+Y   GYW+ IV  LD I+  Y+ I++    + L
Sbjct  247  SDDQSALIYLLIKEKDRWADRIYLESEYNLHGYWLGIVDGLDKISKGYMEIDREV--DLL  304

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  305  RRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCEPCSGEHNSMYTWEACWNG  364

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  365  MQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  401



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 163/217 (75%), Gaps = 2/217 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW+MD M+ W SMGPQ+P ++ WG   +   KDK +P 
Sbjct  224  NMLYEEKSWTSLNAGVLLIRNCQWSMDLMERWTSMGPQNPDHEKWGKAQKSLIKDKAYPG  283

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+++W +KIY+ES+Y   GYW+ IV  LD I+  Y+ I++    + L
Sbjct  284  SDDQSALIYLLIKEKDRWADKIYLESEYNLHGYWLGIVDGLDKISKGYMEIDREV--DLL  341

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  342  RRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCEPCSGEHNSMYTWEACWNG  401

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  402  MQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  438



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 161/224 (72%), Gaps = 6/224 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++E +SWTS+NAGVFLIRNCQW++DFMD WA+MGP SP Y HWG  L  TFKDK+F E
Sbjct  227  HLVYESRSWTSLNAGVFLIRNCQWSLDFMDAWAAMGPDSPEYQHWGAVLTSTFKDKVFNE  286

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L NIT+ Y  +E+ AA   L
Sbjct  287  SDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGNITERYEAMERGAA--PL  344

Query  496  RRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRRHAE       +  +        A  G SGWRRPF+THFTGCQPCSG  NE Y+G++C
Sbjct  345  RRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTGCQPCSGHRNEHYTGKSC  404

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  194
             + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T+
Sbjct  405  DEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQTA  447



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +I+  +SWT++NAGVF + NCQW+M+ +D W  MGP SP Y  WG   R  FKDK+FPES
Sbjct  216  VIYNDRSWTALNAGVFHMGNCQWSMELIDTWTGMGPVSPEYAKWGQIQRSIFKDKLFPES  275

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV  L N+T+ YL +E+  A   LR
Sbjct  276  DDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLTNVTERYLEMEREDA--TLR  333

Query  493  RRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQPCSGDHN+MY G+TC + 
Sbjct  334  RRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNG  393

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KA+NFADNQV+R YGF+H DL  T+ + PLP+D+P+
Sbjct  394  MIKAINFADNQVMRKYGFVHSDLGKTSPLQPLPFDYPD  431



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 161/218 (74%), Gaps = 2/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW++  +D WASMGPQ P  + WG   +   KDK +P 
Sbjct  226  NMVYEQKSWTSLNAGVLLIRNCQWSLSLLDKWASMGPQGPNPEKWGKIQKSLIKDKAYPG  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+ +W  KIY+ES+Y   GYW+ IV  LD I+  Y+ +++    + L
Sbjct  286  SDDQSALIYLLIKEKSRWAAKIYLESEYNLHGYWLGIVDGLDGISKGYMEVDREV--DLL  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  344  RRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCEPCSGEHNGMYTWEACWNG  403

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  404  MQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            NM++E+KSWTS+NAGV LIRNCQW+++ +D WASMGPQ P   +WG   +   KDK +P 
Sbjct  226  NMLYEQKSWTSLNAGVLLIRNCQWSLNLLDKWASMGPQGPDPKNWGKIQKSLIKDKAYPG  285

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS LIYL++KE+ KW +KIY+ES+Y   GYW+ IV  LD I+  Y+ I++    + L
Sbjct  286  SDDQSALIYLLIKEKAKWADKIYLESEYNLHGYWLGIVDGLDGISKGYMEIDREV--DLL  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY+ E C + 
Sbjct  344  RRRHAEKVSLFYGQMREKYMREKGIWRENKRRPFVTHFTGCEPCSGEHNGMYTWEACWNG  403

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP+
Sbjct  404  MQKALNFADNQVLIRFGFLHPDLLNSSWVSPLPFDFPD  441



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            + +++SWTS+NAGVFLIRNCQW++DF+D WASMGPQ P  + WG   R   KDK++P SD
Sbjct  222  MVKQQSWTSLNAGVFLIRNCQWSLDFIDEWASMGPQGPAQEKWGEIQRSMLKDKLYPGSD  281

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL+LK+++KWG+K+Y+ESD  F+ YW+ +V  LDNIT  Y  +++     KLRR
Sbjct  282  DQSALIYLLLKQKQKWGDKVYLESDN-FQSYWLGVVDGLDNITKGYTEVDREMG--KLRR  338

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            RH EKVSE Y E  ++++++ G  R   RRPF+THFTGC+PCSGD N  Y+ E C   M 
Sbjct  339  RHGEKVSELYGEMREQYMKDKGMWRENVRRPFVTHFTGCEPCSGDCNPDYTWEDCWKGMQ  398

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            KALN+ADNQVLR YGF+H DLL+++ V PLP+D+P
Sbjct  399  KALNYADNQVLRKYGFVHPDLLNSSLVTPLPFDYP  433



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 7/216 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++ ++ SWT +NAGVFLIRNCQW++DFMDVWASMGP SP Y+ WG  LR TFK K+ P+S
Sbjct  226  LVKKEHSWTGLNAGVFLIRNCQWSLDFMDVWASMGPNSPEYEKWGERLRATFKTKVVPDS  285

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D +   Y  IEK   G  LR
Sbjct  286  DDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYDKMGKKYDEIEKRVEG--LR  343

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y E  +E+++N G      RRPFITHFTGCQPC+G HN MY+ + C + M
Sbjct  344  RRHAEKVSERYGEMREEYVKNLGDM----RRPFITHFTGCQPCNGHHNPMYAADDCWNGM  399

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  400  ERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 160/220 (73%), Gaps = 3/220 (1%)
 Frame = -1

Query  859  LNMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFP  680
             NMI+EK+SWT++NAGVFLIRNCQW+MD +D W  MGP  P Y  WG   R  FKDK+FP
Sbjct  219  FNMIYEKQSWTALNAGVFLIRNCQWSMDLIDTWKEMGPVGPEYAKWGEIQRSVFKDKLFP  278

Query  679  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  500
            ESDDQ+ LIYL+ K ++ + +KIY+E +YY +GYW+ +V    N+T+ YL +E+     +
Sbjct  279  ESDDQTALIYLLYKHKDVYYDKIYLEGEYYLQGYWIGVVDGFGNVTERYLEMEREDV--R  336

Query  499  LRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +Y G+ C 
Sbjct  337  LRRRHAEKVSEGYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPIYDGDKCW  396

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            + M +ALNF DNQV+R YG++H DL  T+ +VPLP+D+P+
Sbjct  397  NEMIRALNFGDNQVMRVYGYVHSDLSKTSPLVPLPFDYPD  436



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 7/216 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++ ++ SWT +NAGVFLIRNCQW++DFMDVWASMGP SP Y+ WG  LR TFK K+ P+S
Sbjct  226  LVKKEHSWTGLNAGVFLIRNCQWSLDFMDVWASMGPNSPEYEKWGERLRATFKTKVVPDS  285

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D +   Y  IEK   G  LR
Sbjct  286  DDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYDKMGKKYDEIEKRVEG--LR  343

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y E  +E+++N G      RRPFITHFTGCQPC+G HN MY+ + C + M
Sbjct  344  RRHAEKVSERYGEMREEYVKNLGD----MRRPFITHFTGCQPCNGHHNPMYAADDCWNGM  399

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  400  ERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 165/222 (74%), Gaps = 4/222 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I++++SWT+VNAGVFLIRNCQW+MD +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  218  SIIYDQQSWTAVNAGVFLIRNCQWSMDLIDTWKSMGPVSPDYAKWGPIQRSIFKDKLFPE  277

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGK-LDNITDMYLGIEKTAAGEK  500
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +E+  A   
Sbjct  278  SDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEMEREDA--T  335

Query  499  LRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN  Y G+TC 
Sbjct  336  LRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPSYDGDTCW  395

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  197
            + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  396  NEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 165/222 (74%), Gaps = 4/222 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I++++SWT+VNAGVFLIRNCQW+MD +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  218  SIIYDQQSWTAVNAGVFLIRNCQWSMDLIDTWKSMGPVSPDYAKWGPIQRSIFKDKLFPE  277

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGK-LDNITDMYLGIEKTAAGEK  500
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +E+  A   
Sbjct  278  SDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEMEREDA--T  335

Query  499  LRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN  Y G+TC 
Sbjct  336  LRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPSYDGDTCW  395

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  197
            + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  396  NEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW  +NAGVFLIRNCQW++DFM  WA  GPQ P Y+ WG+ L+  FKDK+F E
Sbjct  252  HLVFQQKSWVGLNAGVFLIRNCQWSLDFMARWARFGPQDPEYEQWGHRLKNEFKDKLFVE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L++L+  E+++W +K+++E  +YFEGYW+EIVG+  N+T+ YL +E+      L
Sbjct  312  SDDQSALVHLLNAERDRWADKVFLEDAFYFEGYWIEIVGRFGNMTEKYLAMERKVP--PL  369

Query  496  RRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRRHAEKV+  Y       L   G   G +GWRRPF+THFTGCQPCSGDHN+ YSGE C 
Sbjct  370  RRRHAEKVAGVYGRMRDGELEREGAETGPTGWRRPFMTHFTGCQPCSGDHNKKYSGENCY  429

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            + M +ALNFAD+QV R+YGF H + L    V PLP+D+P
Sbjct  430  EGMLRALNFADDQVSRDYGFRHTE-LGGYDVKPLPFDYP  467



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            N+I++K SWT++NAGVFLIRNCQW+MD +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  217  NIIYDKPSWTALNAGVFLIRNCQWSMDLIDTWKSMGPVSPDYKKWGPIQRSIFKDKLFPE  276

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +V    N+T+ YL +E+    + L
Sbjct  277  SDDQTALIYLLYKHKELYYPKIYLEGEYYLQGYWIGVVDGFANVTERYLEMER--EDDTL  334

Query  496  RRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
            RRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN  Y G+TC +
Sbjct  335  RRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPSYDGDTCWN  394

Query  319  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             + +ALNFADNQV+R YG +H DL  T+ + PLP+D+PN
Sbjct  395  EIIRALNFADNQVMRVYGHVHSDLSKTSPLQPLPFDYPN  433



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 4/222 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I++++SWT+VNAGVFLIRNCQW+M+ +D W SMGP SP Y  WG   R  FKDK+FPE
Sbjct  218  SIIYDQQSWTAVNAGVFLIRNCQWSMELIDTWKSMGPVSPDYAKWGPIQRSIFKDKLFPE  277

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGK-LDNITDMYLGIEKTAAGEK  500
            SDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +E+  A   
Sbjct  278  SDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEMEREDA--T  335

Query  499  LRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN  Y G+TC 
Sbjct  336  LRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPSYDGDTCW  395

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  197
            + M +ALNFADNQV+R YG++H DL  T+ + PLP+ +P+ T
Sbjct  396  NEMIRALNFADNQVMRAYGYVHSDLSKTSPLQPLPFGYPDET  437



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 161/225 (72%), Gaps = 9/225 (4%)
 Frame = -1

Query  856  NMIFEKK--SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIF  683
            +++FE +  SWTS+NAGVFLIRNCQW++DFMD WA+MGP SP Y  WG+ L+ TFKDK+F
Sbjct  214  SLVFEAQASSWTSLNAGVFLIRNCQWSLDFMDAWAAMGPDSPDYQRWGSVLKSTFKDKVF  273

Query  682  PESDDQSGLIYLILKEQE---KWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTA  512
             ESDDQS L+Y++L++++    W +K+++ESDYYFEGYW EIVG+L N+T+ Y  +E+  
Sbjct  274  DESDDQSALVYMLLQKEKGSRPWRDKVFLESDYYFEGYWAEIVGRLGNMTERYEAMERRP  333

Query  511  AGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  341
                LRRRHAE+      +  +        A  G  GWRRPF+THFTGCQPCSG  NE Y
Sbjct  334  GAAALRRRHAEREHAEYAAARDAALAGAGLAETGVHGWRRPFVTHFTGCQPCSGQRNEHY  393

Query  340  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            SG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  394  SGDSCDQGMRRALNFADDQVLRAYGFRHAGPL-SDDVEPLPFDYP  437



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 158/216 (73%), Gaps = 7/216 (3%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            ++  + SWT +NAGVFL+RNCQW++DFMDVWASMGP SP Y+ WG  LR TFK K+  +S
Sbjct  226  LVKTEHSWTGLNAGVFLMRNCQWSLDFMDVWASMGPNSPEYEKWGERLRETFKTKVVRDS  285

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D + + Y  IEK   G  LR
Sbjct  286  DDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWLEISKMYDKMGERYDEIEKRVEG--LR  343

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVSE Y E  +E+++N G      RRPFITHFTGCQPC+G HN +Y+ + C + M
Sbjct  344  RRHAEKVSERYGEMREEYVKNLGDM----RRPFITHFTGCQPCNGHHNPIYAADDCWNGM  399

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  400  ERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|NP_001068066.1| Os11g0546500 [Oryza sativa Japonica Group]
 gb|ABA94224.1| Glycosyltransferase 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28429.1| Os11g0546500 [Oryza sativa Japonica Group]
Length=483

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 160/222 (72%), Gaps = 8/222 (4%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++ ++SW  +NAGVFLIRNCQW++DFMD WA MGP SP Y  WG+ L  T + K   ESD
Sbjct  260  VYGERSWVGLNAGVFLIRNCQWSLDFMDAWARMGPASPEYARWGSVLHDTLRGKSDKESD  319

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK--TAAGEKL  497
            DQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I   Y   E+  +AA   L
Sbjct  320  DQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDIAARYEAAERRPSAAAAHL  379

Query  496  RRRHAEKVSESYAEKWKEHLR-----NAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGE  332
            RRRHAE+  E YA      +R      AG G+SGWRRPF+THFTGCQPC G+ N++YS +
Sbjct  380  RRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTHFTGCQPCGGEPNKIYSKK  439

Query  331  TCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            +CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  440  SCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 160/221 (72%), Gaps = 6/221 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++++ +SW S+N+GVFLIRNCQW++DFM VWA M P SP YD WG  L    KDK+F  
Sbjct  210  HLVYDARSWVSLNSGVFLIRNCQWSLDFMKVWAVMSPLSPDYDRWGQVLAAELKDKLFNV  269

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+YL+LK +++WG+K+++ESDY  E YWV IV +L+N+T  Y  +E+   G  L
Sbjct  270  SDDQSALVYLLLKHRDQWGDKVFLESDYDLEAYWVAIVDRLENMTAKYAEVERRVDG--L  327

Query  496  RRRHAEKVSESYAEKWKEHL---RNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRRHAE VS  Y    +E L     A  G +GW RPF+THFTGCQPC+G HN+MY+ ++C
Sbjct  328  RRRHAEVVSGGYGRLREEQLATEEGAVSGPNGWHRPFMTHFTGCQPCNGAHNKMYTWKSC  387

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
             + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  388  WEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  427



>gb|EAY81250.1| hypothetical protein OsI_36429 [Oryza sativa Indica Group]
Length=483

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 160/222 (72%), Gaps = 8/222 (4%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++ ++SW  +NAGVFLIRNCQW++DFMD WA MGP SP Y  WG+ L  T + K   ESD
Sbjct  260  VYGERSWVGLNAGVFLIRNCQWSLDFMDSWARMGPASPEYARWGSVLHDTLRGKSDKESD  319

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK--TAAGEKL  497
            DQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I   Y   E+  +AA   L
Sbjct  320  DQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDIAARYEAAERRPSAAAAHL  379

Query  496  RRRHAEKVSESYAEKWKEHLR-----NAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGE  332
            RRRHAE+  E YA      +R      AG G+SGWRRPF+THFTGCQPC G+ N++YS +
Sbjct  380  RRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTHFTGCQPCGGEPNKIYSKK  439

Query  331  TCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            +CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  440  SCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   255 bits (651),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 152/220 (69%), Gaps = 8/220 (4%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +M++EKKSW S+N G F  RNCQW++DF+DVWA M P+SP Y  W  TL  T  DK+FP 
Sbjct  220  DMVYEKKSWVSLNTGSFFTRNCQWSLDFLDVWARMSPRSPDYKFWSETLMSTLSDKMFPG  279

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  T      EK      L
Sbjct  280  ADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKFTRTEADAEKNLP--LL  337

Query  496  RRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRR AE VSES  E W+++L N  A +G    +RPFITHFTGCQPCSG H+  Y G TC 
Sbjct  338  RRRRAEVVSESVGEVWEKYLENNTASEG----KRPFITHFTGCQPCSGSHDPSYVGNTCW  393

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            DAM + LN+ADNQVLRN GF HRD+   + V PL +DFP+
Sbjct  394  DAMERTLNYADNQVLRNLGFAHRDISHGSYVSPLAFDFPS  433



>ref|XP_006663513.1| PREDICTED: putative glycosyltransferase 7-like [Oryza brachyantha]
Length=332

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 156/222 (70%), Gaps = 8/222 (4%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++ ++SW  +NAGVFLIRNCQW++DFMD WA MGP SP Y  WGN L  T + K   ESD
Sbjct  109  VYGERSWVGLNAGVFLIRNCQWSLDFMDAWARMGPASPEYAKWGNVLHDTLQGKSDHESD  168

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKT--AAGEKL  497
            DQS L+YL+ + +EKWG+K  +E  YYF+GYWVEIV +LD I   Y   E+   AA + L
Sbjct  169  DQSALVYLLSEHEEKWGSKTILELGYYFQGYWVEIVDRLDGIAARYESAERRPGAAAKAL  228

Query  496  RRRHAEKVSESYAEKWKEHLRN-----AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGE  332
            RRRHAE+    YAE     +R+     AG G++GWRRP +THFTG QPC G  N++YS +
Sbjct  229  RRRHAEREHLRYAEARNAAMRSAIPGPAGGGQTGWRRPVMTHFTGGQPCGGKPNKIYSKK  288

Query  331  TCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            +CAD M++ALNFAD+QVLR YGF H+D L +  V PLP+D+P
Sbjct  289  SCADGMNRALNFADDQVLRAYGFRHKDPL-SDEVRPLPFDYP  329



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 153/220 (70%), Gaps = 8/220 (4%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +M++EKKSW S+N G F  RNCQW++DF+D WA M P+SP Y  W  TL  T  DK+FP 
Sbjct  220  DMVYEKKSWVSLNTGSFFTRNCQWSLDFLDAWARMSPRSPDYKFWSETLMSTLSDKMFPG  279

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  T      EK      L
Sbjct  280  ADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKFTRTEADAEKNLP--LL  337

Query  496  RRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRR AE V ES  E W+++L N  A +G    +RPFITHFTGCQPCSG+H+  Y G TC 
Sbjct  338  RRRRAEVVGESVGEVWEKYLENNTASEG----KRPFITHFTGCQPCSGNHDPSYVGNTCW  393

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            DAM + LN+ADNQVLRN GF+HRD+   + V+PL +DFP+
Sbjct  394  DAMERTLNYADNQVLRNLGFVHRDISRGSYVLPLAFDFPS  433



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 155/211 (73%), Gaps = 10/211 (5%)
 Frame = -1

Query  835  SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSGL  656
            SWT +NAGVFLIRNCQW+++FMDVW SMGPQ+P Y+ WG  LR TFKDK+ P+SDDQ+ L
Sbjct  232  SWTGLNAGVFLIRNCQWSLEFMDVWVSMGPQTPEYEKWGERLRETFKDKVLPDSDDQTAL  291

Query  655  IYLILKE-QEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAE  479
             YLI  + ++ W  KI++ES+YYFEGYW+EIV   +NI++ Y  +E+   G  LRRRHAE
Sbjct  292  AYLIATDNKDTWREKIFLESEYYFEGYWLEIVKTYENISERYDEVERKVEG--LRRRHAE  349

Query  478  KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALN  299
            KVSE Y    +E+L++        RRPFITHFTGCQPC+G HN  Y+   C + M +ALN
Sbjct  350  KVSEKYGAMREEYLKDNK------RRPFITHFTGCQPCNGHHNPAYNANDCWNGMERALN  403

Query  298  FADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            FADNQ+LR YG+  ++LLD  SV PLP+ +P
Sbjct  404  FADNQILRTYGYHRQNLLD-KSVSPLPFGYP  433



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 158/212 (75%), Gaps = 4/212 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F+KKSWT +NAGVFL+RNCQW+MD +D WA  GP SP Y+ WG+ L+  F DK++PE
Sbjct  222  DLVFKKKSWTGLNAGVFLLRNCQWSMDLLDKWAQFGPISPDYEKWGDILKSVFTDKLYPE  281

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+G+ YL++KE E W +KIY+E DYYFEGYWVEIVG  +N+T  Y  IEK     +L
Sbjct  282  SDDQTGIAYLMVKEGENWKDKIYLEKDYYFEGYWVEIVGNYENVTAHYSKIEKKER--RL  339

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEK  E Y  +W+ +L    +     +RPFITHFTGC+PCSG HNEMY+ E+C   
Sbjct  340  RRRHAEKAGEDYRAQWEYNLERENEKLM--KRPFITHFTGCEPCSGKHNEMYNLESCFKG  397

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPL  221
            M+KALNFADNQVLRN+G+   +L +++ V PL
Sbjct  398  MNKALNFADNQVLRNFGYFRPNLDNSSWVQPL  429



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 155/215 (72%), Gaps = 11/215 (5%)
 Frame = -1

Query  856  NMIF---EKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKI  686
            NM++     KSWT +NAGV LIRNCQW+MD +D WAS+GPQ+P +++WG  L   FKDK 
Sbjct  216  NMVYGDIYNKSWTGLNAGVLLIRNCQWSMDLIDEWASIGPQTPDFENWGRILTSVFKDKP  275

Query  685  FPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAG  506
            FP  DDQS LIYL+  ++E+WG K Y+E +YY E YW+ +VGK DN T+ Y   E+  +G
Sbjct  276  FPLPDDQSALIYLLFTDEERWGKKTYLEWEYYLEAYWIGVVGKYDNFTESYAETERNDSG  335

Query  505  EKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
              LRRRHAEKV+E Y  K + +++    GR   RRPF+THFTGCQPCSG+HN  Y+G++C
Sbjct  336  --LRRRHAEKVNEWYGAKRETYIK----GRV--RRPFVTHFTGCQPCSGEHNPQYTGDSC  387

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  221
             D M++ALNFADNQVLRNYGF+H DL  +   V L
Sbjct  388  WDEMNRALNFADNQVLRNYGFVHPDLSSSTVSVLL  422



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 158/220 (72%), Gaps = 4/220 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE +SWTS+NAGVFLIRNCQW++DFMD WA+MGP SP Y  WG  L+ TFKDK+F E
Sbjct  207  SLVFEARSWTSLNAGVFLIRNCQWSLDFMDAWAAMGPDSPDYRRWGTVLKSTFKDKVFDE  266

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+Y++L+    W  K+++ESDYYFEGYW+EIVG+L N+T+ Y  +E+      L
Sbjct  267  SDDQSALVYMLLQSGSPWREKVFLESDYYFEGYWLEIVGRLGNVTERYEAMERRPGSAAL  326

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRS---GWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRR AE    ++A      L  AG   +   GWRRPF+THFTGCQPCSG  NE YSG +C
Sbjct  327  RRRRAEAEHVAHAAARNAALAGAGLAEAGVRGWRRPFVTHFTGCQPCSGHRNEHYSGASC  386

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             + M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  387  DEGMRRALNFADDQVLRAYGFRHAGPL-SDDVQPLPFDYP  425



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 148/215 (69%), Gaps = 6/215 (3%)
 Frame = -1

Query  835  SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSGL  656
            SWT +NAGVFL+RNCQW++DFMD WA+MGP SP Y+ WG  L  TF+DK+F ESDDQS L
Sbjct  208  SWTGLNAGVFLVRNCQWSLDFMDAWAAMGPDSPDYERWGAVLTSTFRDKLFNESDDQSAL  267

Query  655  IYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTA-AGEKLRRRHAE  479
            +Y++      W  K+++E+ YYF+GYWVEIVG+L  I   Y  IE+ A A   LRRRHA 
Sbjct  268  VYMLQHRGSPWREKVFLENGYYFQGYWVEIVGRLGGIAARYEAIERRAPAVALLRRRHAA  327

Query  478  K-VSESYAEK---WKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                E YA+           A  G  GWRRPF+THFTGCQPCSG+ N  YSG++C D M 
Sbjct  328  SWEHEGYAQAREAALAGAGLAESGVKGWRRPFVTHFTGCQPCSGNRNRDYSGDSCDDGMR  387

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            +ALNFAD+QVLR+YGF H   L +  V PLP+D+P
Sbjct  388  RALNFADDQVLRDYGFRHAGPL-SDDVRPLPFDYP  421



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 155/213 (73%), Gaps = 11/213 (5%)
 Frame = -1

Query  856  NMIFEKK--SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIF  683
            NM++E+K  SWT +NAGV LIRNCQW+MD +DVW SMGP SP ++ WG  L   FKDK+F
Sbjct  161  NMVYEEKNKSWTGLNAGVLLIRNCQWSMDLIDVWVSMGPLSPDFERWGQILTSVFKDKLF  220

Query  682  PESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGE  503
              SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D + + Y+ +E+     
Sbjct  221  SVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYDTLAESYIKMERNEG--  278

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
             LRRRHAEKV++ YA + +++L    QG    RRPF+THFTGCQPCSG+HN  YS ++C 
Sbjct  279  VLRRRHAEKVNDWYAAEREKYL----QGHE--RRPFVTHFTGCQPCSGEHNPQYSADSCW  332

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  227
            + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  333  NEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  365



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 150/231 (65%), Gaps = 29/231 (13%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++EK+SW  +NAGVFLIRNCQW++DFMD WASMGP SP Y  WG TLR T   K   +SD
Sbjct  225  VYEKRSWVGLNAGVFLIRNCQWSLDFMDEWASMGPASPEYARWGKTLRDTLSKKSDDQSD  284

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L YL+L  +E+WG+K Y+  DYYF+GY+ EIVGKLD I   Y+ +E+      LRR
Sbjct  285  DQSALAYLLLMNRERWGDKTYLGIDYYFQGYFAEIVGKLDAIAARYVAVERKGE-PALRR  343

Query  490  RHAEKVSESYAEKWKEHLRNA---------------GQGRSGWRRPFITHFTGCQPCSGD  356
            RHAE          +EHLR A               G G+SGWRRPF+THFTGC PC G 
Sbjct  344  RHAE----------REHLRYAAARNAAVRAVVPGPDGGGQSGWRRPFVTHFTGCNPCGGK  393

Query  355  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL-DTASVVPLPYDFP  206
             N++YS E C D M +AL FAD+QVLR YGF H   L DT  V  LP+D+P
Sbjct  394  RNKIYSREICEDGMRRALGFADDQVLRAYGFRHAAPLNDTVRV--LPFDYP  442



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 155/213 (73%), Gaps = 11/213 (5%)
 Frame = -1

Query  856  NMIF--EKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIF  683
            NM++  + KSWT +NAGV LIRNCQW+MD +DVWASMGP SP ++ WG  L   FKDK+F
Sbjct  212  NMVYGDKNKSWTGLNAGVLLIRNCQWSMDLIDVWASMGPLSPDFERWGQILTSVFKDKLF  271

Query  682  PESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGE  503
              SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D +T  Y+ +E+     
Sbjct  272  SVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYDTLTASYIKMERNEG--  329

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
             LRRRHAEKV++ Y  + +++L    QGR   RRPF+THFTGCQPCSG+HN  YS ++C 
Sbjct  330  VLRRRHAEKVNDWYDAEREKYL----QGRE--RRPFVTHFTGCQPCSGEHNPQYSADSCW  383

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  227
            + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  384  NEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  416



>gb|AFW64907.1| glycosyltransferase 6 [Zea mays]
Length=479

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 152/230 (66%), Gaps = 16/230 (7%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E++SW  +NAGVFLIRNCQW++D MD WA MGP SP Y  WG TLR   + K   ESD
Sbjct  248  VYEERSWVGLNAGVFLIRNCQWSLDLMDAWARMGPASPEYARWGKTLREELEGKPNDESD  307

Query  670  DQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK-  500
            DQS L+YL+ +  E+E+W N  ++ES YYF+GYW EIV +LD +   Y  +E+  AG + 
Sbjct  308  DQSALVYLLSRHLERERWANATFLESGYYFQGYWAEIVDRLDGVATRYEAVERGRAGGRA  367

Query  499  -LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSGWRRPFITHFTGCQPCSGD  356
             LRRRHAE+    YA   ++ +R             G G+ GWRRPF+THFTGCQPC G 
Sbjct  368  GLRRRHAEREHLLYAAARRQAVRQQRGTGGGVPGPDGGGQKGWRRPFVTHFTGCQPCGGA  427

Query  355  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV PLP+D+P
Sbjct  428  PNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSVTPLPFDYP  476



>ref|NP_001152534.1| glycosyltransferase 6 [Zea mays]
 gb|ACG48084.1| glycosyltransferase 6 [Zea mays]
Length=473

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 151/230 (66%), Gaps = 16/230 (7%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E++SW  +NAGVFLIRNCQW++D MD WA MGP SP Y  WG TLR   + K   ESD
Sbjct  242  VYEERSWVGLNAGVFLIRNCQWSLDLMDAWARMGPASPEYARWGKTLREELEGKPNDESD  301

Query  670  DQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK-  500
            DQS L+YL+ +  E+E+W N  ++ES YYF+G W EIV +LD +   Y  +E+  AG + 
Sbjct  302  DQSALVYLLSRHLERERWANATFLESGYYFQGXWAEIVDRLDGVATRYEAVERGRAGGRA  361

Query  499  -LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSGWRRPFITHFTGCQPCSGD  356
             LRRRHAE+    YA   +E +R             G G+ GWRRPF+THFTGCQPC G 
Sbjct  362  GLRRRHAEREHLLYAAARREXVRQQRGTGGGVPGPDGGGQKGWRRPFVTHFTGCQPCGGA  421

Query  355  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV PLP+D+P
Sbjct  422  PNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSVTPLPFDYP  470



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 145/230 (63%), Gaps = 27/230 (12%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++EK+SW  +NAGVFLIRNCQW++DFMD WASMGP SP Y  WG TLR T   K   +SD
Sbjct  217  VYEKRSWVGLNAGVFLIRNCQWSLDFMDEWASMGPASPEYARWGKTLRDTLSKKFDDQSD  276

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L YL+L  +E+WG K Y+  DYYF+GY+ EIV KLD +   Y   E+      LRR
Sbjct  277  DQSALAYLLLTNRERWGKKTYLGIDYYFQGYFAEIVDKLDGVAARYEAAERK-GDPALRR  335

Query  490  RHAEKVSESYAEKWKEHLRNA---------------GQGRSGWRRPFITHFTGCQPCSGD  356
            RHAE          +EHLR A               G G+SGWRRPF+THFTGC PC G 
Sbjct  336  RHAE----------REHLRYAAARNAAVRAVVPGPDGGGQSGWRRPFVTHFTGCNPCGGK  385

Query  355  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             N +Y+ E C D M +AL FAD+QVLR YGF H   L+  SV  LP+D+P
Sbjct  386  RNSIYTREICEDGMRRALGFADDQVLRAYGFRHAAPLND-SVRALPFDYP  434



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 143/210 (68%), Gaps = 7/210 (3%)
 Frame = -1

Query  835  SWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSGL  656
            SWTS+NAGVFL+RNCQW++D MD WA+MGP SP Y  WG  L +TFKDK F ESDDQS L
Sbjct  212  SWTSLNAGVFLLRNCQWSLDLMDAWAAMGPDSPDYQRWGALLTKTFKDKAFNESDDQSAL  271

Query  655  IYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEK  476
            +YL+ ++   W  K+++E +YYFEGYW+EIV +L NI+     +E+ AA E  +RR   +
Sbjct  272  VYLLQQDGSPWRQKVFLEHEYYFEGYWLEIVPRLGNISKRCEAMERQAAPEMRKRRAERE  331

Query  475  VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNF  296
                  +      R A     GWRRPF+THFTGCQPCSG  NE YSGE+C + M +ALNF
Sbjct  332  ARRGRGD------RAAASRVEGWRRPFVTHFTGCQPCSGHRNEDYSGESCDEGMRRALNF  385

Query  295  ADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            AD+QVLR YGF H   L +  V PLP+ +P
Sbjct  386  ADDQVLRAYGFRHAGPL-SDDVTPLPFGYP  414



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 158/226 (70%), Gaps = 11/226 (5%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK+SW  +NAG+FLIRNC+W+M+FM+ W++MGPQSP Y   G  L +   D+ F  
Sbjct  255  HLVFEKRSWVGLNAGIFLIRNCEWSMEFMERWSAMGPQSPLYISSGKLLSKVLSDRAFNA  314

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L+YL++KE++KW ++IY+E  YY  GYWV+IVG  +NIT+ Y  +EK      L
Sbjct  315  SDDQSALVYLLIKEKDKWADRIYIEHSYYLNGYWVDIVGTYENITEKYEAMEKE--NPML  372

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQPCSGDHNEMYS  338
             +RHAEK++  YAE  + ++R+     S         RRPF+THFTGCQPCSGDHN++Y 
Sbjct  373  NKRHAEKMNRDYAEMREHYIRSDKNFYSDNDDIMVRRRRPFVTHFTGCQPCSGDHNKIYK  432

Query  337  GETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFPN  203
            GE C   M +ALNFAD+QVL++YGF H D L ++ V P+  + FP+
Sbjct  433  GENCWKGMERALNFADDQVLKHYGFRH-DNLQSSHVNPIQSFYFPS  477



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 147/214 (69%), Gaps = 7/214 (3%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHW-GNTLRRTFKDKIFPES  674
            I++K SWTS+N GVFLIRNCQW+M+ ++ W +MGPQ+P Y+ W  N+L    K K    S
Sbjct  171  IYDKXSWTSINTGVFLIRNCQWSMNLIEAWITMGPQTPDYERWMQNSL---IKGKQISNS  227

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQ GLIYL++ +QE W NK YVE DYY  GYW+ IV  LD IT  Y+ IE+    + LR
Sbjct  228  DDQXGLIYLLITQQEGWANKTYVEGDYYQHGYWL-IVDGLDTITKRYMEIEREV--DMLR  284

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
            RRHAEKVS+ Y     +H+++ G      RRPF THFT CQPC+G H+  Y+ E C + M
Sbjct  285  RRHAEKVSQFYGTMRDQHVKDKGYWXDDLRRPFTTHFTXCQPCNGQHSSAYTWEACWNGM  344

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  212
             + LNFADNQVLR + F+H DLL+++ V PLP+D
Sbjct  345  QRGLNFADNQVLRRFAFVHPDLLNSSFVSPLPFD  378



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 147/231 (64%), Gaps = 12/231 (5%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++ +KSW  +NAGVFLIRNCQW++DFMD WA+M P SP YD WG  L    K K   +SD
Sbjct  251  VYGEKSWVGLNAGVFLIRNCQWSLDFMDAWAAMSPTSPDYDEWGKILMDNLKWKSSNDSD  310

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA----GE  503
            DQS L+YL++K + KWG K Y++ DY+F+GYW EIV +LD +   YL  E+ AA      
Sbjct  311  DQSALVYLLMKNRRKWGRKTYLDHDYFFQGYWAEIVDRLDGVAVRYLAAERRAARPGTSA  370

Query  502  KLRRRHAEKVSESYAEKWKEHLRN-----AGQGRSGWRRPFITHFTGCQPCSGDHNEMYS  338
             LRRRHAE     YA      +       AG G++GWRRPFITHF GCQPC G  N ++ 
Sbjct  371  LLRRRHAEAEHALYAAARNAVVGRAVPGPAGGGQTGWRRPFITHFAGCQPCGGTPNVIFP  430

Query  337  GETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSPIR  185
              +CA+ + +ALNFAD+QVLR YGF H   L    V PLP+ +P   SP R
Sbjct  431  NGSCAEGVRRALNFADDQVLRAYGFRHAGPLSDV-VQPLPFGYPR--SPAR  478



>gb|EMS46901.1| Galactomannan galactosyltransferase 1 [Triticum urartu]
Length=316

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 132/204 (65%), Gaps = 11/204 (5%)
 Frame = -1

Query  838  KSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESDDQSG  659
            +SW  +NAGVFLIRNCQW++DFMD WASMGP SP Y  WG TL+ T  DK   ESDDQS 
Sbjct  101  RSWVGLNAGVFLIRNCQWSLDFMDAWASMGPASPQYARWGKTLKATLSDKPDAESDDQSA  160

Query  658  LIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAE  479
            L YL+LK  +KWG + Y+E+ YYF+GYW EIV KLD + + Y   E+   G  LRRRHAE
Sbjct  161  LAYLLLKNPKKWGARTYLENQYYFQGYWAEIVDKLDGVAERYRAAERR-FGPALRRRHAE  219

Query  478  ----------KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGET  329
                        +    +         GQ  S WRRPF+THFTGC PC G  NE+YS E+
Sbjct  220  GEHALYAAARNAALRKKDGGVPGPDGGGQKASAWRRPFVTHFTGCNPCGGRANEIYSNES  279

Query  328  CADAMHKALNFADNQVLRNYGFMH  257
            CA+ M +ALN AD+QVLR YGF H
Sbjct  280  CAEGMRRALNLADDQVLRAYGFRH  303



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 148/220 (67%), Gaps = 12/220 (5%)
 Frame = -1

Query  856  NMIF---EKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKI  686
            NM++   E KSWT +NAG  L+RNCQW+MD + VWA MGP +  Y  WG  L   FKDK 
Sbjct  210  NMVYDDSENKSWTGLNAGSILVRNCQWSMDLLHVWAQMGPLTSNYAKWGKILTSIFKDKP  269

Query  685  FPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAG  506
            FP  DDQS LIYL+ +++ KWG K ++E  Y  EGYW+  +GKL+ I + Y  IEK A  
Sbjct  270  FPLPDDQSSLIYLLSRQRRKWGAKTFLEEGYDLEGYWIATMGKLEGIQNKYDEIEKKA--  327

Query  505  EKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
              LRRRH+EKVS  Y E  + +L+ +       RRPF+ HFTGCQPCSGDHN  Y G+ C
Sbjct  328  RVLRRRHSEKVSVWYGEMREPYLKWSE------RRPFVKHFTGCQPCSGDHNPSYKGDVC  381

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
               M +ALNFADNQVLRNYGF+ ++L+ T+SV  +P+ +P
Sbjct  382  WKEMERALNFADNQVLRNYGFVRKNLM-TSSVYEVPFGYP  420



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 143/217 (66%), Gaps = 38/217 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++I EK+SWT +NAG                                TLR TFKDK FPE
Sbjct  237  HLIHEKRSWTGLNAG--------------------------------TLRSTFKDKFFPE  264

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   NIT+ Y  +EK    ++L
Sbjct  265  SDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFKNITEKYKEMEKGV--QRL  322

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQPCSG +N MYS   C++A
Sbjct  323  RRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQPCSGKYNAMYSPHDCSNA  382

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            MH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  383  MHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  415



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 149/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++EK+SW  +NAGVFLIRNC+W+MDFM+ W+ MGP+SP YD +   L     D+   ESD
Sbjct  271  VYEKRSWLGINAGVFLIRNCEWSMDFMERWSVMGPESPLYDSFAKILSDVLPDRPVTESD  330

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +NI+  Y  +E  A   +L R
Sbjct  331  DQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFENISKRYEAME--AEHTELSR  388

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            R+AEK +  YA K + +L+    G    RRPF+THF GCQPCSG+HN +Y  E C + + 
Sbjct  389  RYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQPCSGNHNPIYKAEDCQNGLQ  447

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPY  215
            ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  448  RSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>ref|XP_004980588.1| PREDICTED: galactomannan galactosyltransferase 1-like, partial 
[Setaria italica]
Length=367

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 142/224 (63%), Gaps = 10/224 (4%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E++SW  +NAGVFLIRNCQW+MD MD WA MGP  P Y  WG TLR   + K   ESD
Sbjct  141  VYEERSWVGLNAGVFLIRNCQWSMDLMDAWARMGPAFPEYAAWGKTLREELEGKPNDESD  200

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE--KTAAGEKL  497
            DQS L+YL+ K   +WGN+  +E+ YYF+GYW EIV +LD +   Y  +E         L
Sbjct  201  DQSALVYLLSKHPARWGNRTLLETGYYFQGYWAEIVDRLDGVAKRYEAVERGGRGGSSGL  260

Query  496  RRRHAEKVSESYAEKWKEHLRN-------AGQGRSGWRRPFITHFTGCQPCSGDHNEMYS  338
            RRRHAE+    YA      +         AG G+ GWRRPF+THFTGCQPC G  +  Y+
Sbjct  261  RRRHAEREHLRYAAARDAAVGRSGTVPGPAGGGQKGWRRPFVTHFTGCQPCGGAPDRKYT  320

Query  337  GETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
               CA+ + +AL FAD+QVLR YGF H   L + SVVPLP+D+P
Sbjct  321  RRRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVVPLPFDYP  363



>gb|EMT11268.1| Putative glycosyltransferase 7 [Aegilops tauschii]
Length=265

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 133/208 (64%), Gaps = 11/208 (5%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E +SW  +NAGVFLIRNCQW++DFMD WASMGP SP Y  WG TL+ T  DK   ESD
Sbjct  46   VYEARSWVGLNAGVFLIRNCQWSLDFMDAWASMGPASPEYARWGKTLKATLSDKPDAESD  105

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L YL+LK  +KWG + Y+E +YYF+GYW EIV +LD +        +   G  LRR
Sbjct  106  DQSALAYLLLKNPKKWGARTYLEHEYYFQGYWAEIVDRLDGVA-ARYRAAERRFGPALRR  164

Query  490  RHAEKVSESYAEKWKEHLRNAG----------QGRSGWRRPFITHFTGCQPCSGDHNEMY  341
            RHAE     YA      LR             Q  S WRRPF+THFTGC PC G  NE+Y
Sbjct  165  RHAEGEHALYAAARNAALRKKAGGVPGPDGGGQKASYWRRPFVTHFTGCNPCGGRPNEIY  224

Query  340  SGETCADAMHKALNFADNQVLRNYGFMH  257
            S E+CA+ M +ALN AD+QVLR YGF H
Sbjct  225  SNESCAEGMRRALNLADDQVLRAYGFPH  252



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F K+SW  +NAGVFL+RNC+W+M FM+ W+ MGPQSP Y+ +   L     D+   ESD
Sbjct  271  VFVKRSWLGINAGVFLMRNCEWSMKFMERWSVMGPQSPLYEPFAKILSDVLPDRALTESD  330

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++KE++KW  KIY+E++Y+F+GYW++IVG  +NIT +Y  +E  A    LRR
Sbjct  331  DQSALIYLMIKEKKKWAGKIYIENEYFFQGYWLDIVGSFENITKIYDAME--AKHPDLRR  388

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            R+AEK +  YA K    L+    G    RRPF+THFTGCQPCSG+HN +Y  E C + M 
Sbjct  389  RYAEKSARLYAGKRDRSLKEIWAGILQ-RRPFVTHFTGCQPCSGNHNPIYKAEDCWNGMA  447

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  212
            ++L+FAD+QVLR YGF  R  L +  V P+ ++
Sbjct  448  RSLDFADDQVLRIYGF-RRHQLQSVVVSPIHFN  479



>ref|XP_004980585.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=312

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 139/220 (63%), Gaps = 6/220 (3%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E + W  +NAGVFLIRNCQW++DF+D WA MGP  P Y  WG  ++    D+    + 
Sbjct  89   VYENRRWLGLNAGVFLIRNCQWSLDFLDEWARMGPAYPDYAAWGKKVKGALTDRDSDVAC  148

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L YL++  +E+WG K Y+ +DYYF+GY+ EIVGKL  +   Y   E+ A    LRR
Sbjct  149  DQSALAYLLITGRERWGEKTYLGTDYYFQGYFAEIVGKLAGVAARYKAAERGAGHAGLRR  208

Query  490  RHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RHAE+    YA      +R A     G G+SGWRRP ITHFTGC PC G  N MYS E C
Sbjct  209  RHAEREHLRYAAARNAAVRAAVPGPDGGGQSGWRRPLITHFTGCNPCGGRRNPMYSRELC  268

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
               M +AL FAD+QVLR YGF H   L+  +V+ LP+D+P
Sbjct  269  EGGMRRALGFADDQVLRAYGFRHAGPLND-TVLQLPFDYP  307



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 133/207 (64%), Gaps = 10/207 (5%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++  +SW  +NAGVFLIRNCQW++DFMD WASMGP SP Y  WG TL  T  DK   ESD
Sbjct  258  VYGARSWVGLNAGVFLIRNCQWSLDFMDAWASMGPASPDYARWGKTLMATLSDKPDAESD  317

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L YL+LK ++KWG + Y+E DYYF+GYW EIV KLD +        +   G  LRR
Sbjct  318  DQSALAYLLLKNRKKWGARTYLEHDYYFQGYWAEIVDKLDGVA-ARYRAAERRFGPALRR  376

Query  490  RHAE---------KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYS  338
            RHAE         + +    +       + G  R+ WRRPF+THFTGC PC G  NE+YS
Sbjct  377  RHAEGEHALYAAARSAALRKKDGGVPGPDGGGQRASWRRPFVTHFTGCNPCGGKPNEIYS  436

Query  337  GETCADAMHKALNFADNQVLRNYGFMH  257
             ETCAD M +ALN AD+QVLR YGF H
Sbjct  437  NETCADGMRRALNLADDQVLRVYGFRH  463



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 149/217 (69%), Gaps = 5/217 (2%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M++E+++W  +NAGVFLIRN QW +DF+D WA +GPQ+P Y  W   L      K   +S
Sbjct  302  MVYEERNWIGLNAGVFLIRNSQWGLDFLDSWARLGPQTPNYKKWTKLLHSEISGKDSGDS  361

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNIT+ Y  +EK    ++LR
Sbjct  362  DDQSALVHLLVKDIKRWGNKVYLENSYDLHGYWEAIIGRLDNITERYKRLEKKE--KELR  419

Query  493  RRHAEKVSESYAEKWKEHL-RNAGQGRS--GWRRPFITHFTGCQPCSGDHNEMYSGETCA  323
            RRHAEK +  +    + +L R  G G +    RRPF+THFTGCQPCS  HN  Y+ E+C 
Sbjct  420  RRHAEKDTVGFGGTREWYLDREVGMGPAERKKRRPFVTHFTGCQPCSAGHNPAYTWESCY  479

Query  322  DAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  212
            + MH+ALNFAD QVLR YGF   D+ + +SV PLP+D
Sbjct  480  EGMHRALNFADGQVLRAYGFGRPDINNISSVQPLPFD  516



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 149/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++EK+SW  +NAGVFLIRNC+W+MDFM+ W+ MGP+SP Y+ +   L     D+   ESD
Sbjct  271  VYEKRSWLGINAGVFLIRNCEWSMDFMERWSVMGPESPLYESFAKILSDVLPDRPVTESD  330

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +NI+  Y  +E  A   +L R
Sbjct  331  DQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFENISKRYEAME--AEHTELSR  388

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            R+AEK +  YA K + +L+    G    RRPF+THF GCQPCSG+HN +Y  E C + + 
Sbjct  389  RYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQPCSGNHNPIYKAEDCQNGLQ  447

Query  310  KALNFADNQVLRNYGFMHRDLLDTASVVPLPY  215
            ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  448  RSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>ref|XP_004980586.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=450

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 144/233 (62%), Gaps = 21/233 (9%)
 Frame = -1

Query  847  FEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE-SD  671
             E KSW ++NAGVFLIRNCQW++DFMD WA MGP  P +  WG  +R    DK      D
Sbjct  228  IEIKSWLAINAGVFLIRNCQWSLDFMDEWARMGPAYPEHARWGKVVRDALADKGDDAWCD  287

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L+YL+L   E+ G K ++E++Y+F+GYW+EIV +LD +   Y  +E+ A    LRR
Sbjct  288  DQSALVYLLLHNWERLGKKAFIETEYFFQGYWLEIVDRLDGVAARYEAVERRAPA--LRR  345

Query  490  RHAEKVSESYAEKWKEHLRNAG----------QGRSGWRRPFITHFTGCQPCSGDHNEMY  341
            RHAE+    YA       RNA            G  GWRRP ITHF GCQPCSG  N MY
Sbjct  346  RHAEREHLRYAAA-----RNAAVSGAVPGPAGGGEKGWRRPLITHFVGCQPCSGGRNPMY  400

Query  340  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSPIRQ  182
            S E+C D M + L FADNQVLR YGF H   L+  SV PLP+D+P   +P R+
Sbjct  401  SRESCEDGMRRTLGFADNQVLRAYGFRHAAPLND-SVRPLPFDYP--AAPARR  450



>ref|XP_008679454.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64906.1| hypothetical protein ZEAMMB73_279475 [Zea mays]
Length=458

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 142/224 (63%), Gaps = 11/224 (5%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDH--WGNTLRRTFKDKIF  683
            +  F +KSW  +NAGVFLIRNCQW++DFMD WA MGP  P  DH  WG  LR T  DK  
Sbjct  232  DKFFVRKSWLGLNAGVFLIRNCQWSLDFMDEWARMGPAYP-EDHARWGEVLRATLSDKDS  290

Query  682  PESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGE  503
              + DQS L+YL+L   E+ G K +VE++Y+F+GYW E+V +LD +   Y  +E+ + G 
Sbjct  291  DVACDQSALVYLLLNNWERPGKKTFVETEYFFQGYWKEVVDRLDGVAARYEAVERRSPG-  349

Query  502  KLRRRHAEKVSESYAEKWKEHLRNAGQGRS-----GWRRPFITHFTGCQPCSGDHNEMYS  338
             LRRRHAE+    YA      LR    G +     GWRRP ITHF GCQPCSG  N MYS
Sbjct  350  -LRRRHAEQEHLRYAGARNAALRGVVPGPAGGGEVGWRRPLITHFVGCQPCSGGRNPMYS  408

Query  337  GETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             E+C D M  AL FAD+QVLR YGF H   L+  SV  LP+D+P
Sbjct  409  RESCDDGMRHALGFADDQVLRAYGFRHAAPLND-SVRGLPFDYP  451



>ref|XP_002450906.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
 gb|EES09894.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
Length=443

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 144/228 (63%), Gaps = 14/228 (6%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++E++SW  +NAGVFLIRNCQW++D MD WA MGP SP Y  WG TLR   + K   ESD
Sbjct  214  VYEERSWVGLNAGVFLIRNCQWSLDLMDAWARMGPASPEYARWGKTLREELEGKPNDESD  273

Query  670  DQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            DQS L+YL+ +  E+ +W N  ++ES YYF+GYW EIV +LD +   Y  +E+   G  L
Sbjct  274  DQSALVYLLSRHPERARWSNATFLESGYYFQGYWAEIVDRLDGVAARYEAVERGGVGRGL  333

Query  496  RRRHAEKVSESY-----------AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHN  350
            RRRHAE+    Y                      G G+ GWRRPF+THFTGCQPC G  N
Sbjct  334  RRRHAEREHLLYAAARREAVRRRDGSGGGVPGPDGGGQKGWRRPFVTHFTGCQPCGGAPN  393

Query  349  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             MY+ + CA+ + +AL FAD+QVLR YGF H   L + SV PLP+D+P
Sbjct  394  RMYTRKRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVAPLPFDYP  440



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M++  + W  +NAGVFL+RN QW +DF+D WASMGPQ+P +  WG  L    + K+   +
Sbjct  257  MVYTARDWVGLNAGVFLLRNSQWGLDFLDAWASMGPQTPHHGKWGRILDAEIRGKLTSFA  316

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS L++L+ KEQ +W +K+++ES Y   GYW  IVG+L+++   Y  +E+  A   LR
Sbjct  317  DDQSALVHLLAKEQRRWRDKVHLESAYDLHGYWEPIVGRLEDVAAAYAEMERRDA--VLR  374

Query  493  RRHAEKVSESYAEKWKEHL------RNAGQGRSGW---RRPFITHFTGCQPCSGDHNEMY  341
            RRHAEK + SY E    +L               W   RR F+THFTGCQPC GDHN  Y
Sbjct  375  RRHAEKEAGSYGETRSRYLDAAAGGGGEKGSGKRWPRKRRSFVTHFTGCQPCGGDHNPAY  434

Query  340  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            + + C D M +ALNFAD+QVLR YGF H +L D+AS+  LP+ +P
Sbjct  435  TWQGCVDGMARALNFADDQVLRAYGFGHTNLNDSASIRSLPFGYP  479



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 149/231 (65%), Gaps = 25/231 (11%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +M++E+K+W  +NAGVFLIRN QW++DF+D WA MGPQ+  ++ WG  L    K K  PE
Sbjct  206  SMVYEEKNWVGLNAGVFLIRNSQWSLDFLDAWARMGPQTTEFEAWGRILASKIKGKAAPE  265

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGI---------  524
            SDDQS L++L++ E+++WG+++Y+E+DY   GYW  ++G+L+  T+ YL +         
Sbjct  266  SDDQSALLHLLVYEKDRWGDRVYLENDYDLHGYWAAVLGRLEKSTEDYLAMERREPPLRR  325

Query  523  ----EKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGD  356
                + T A  ++R R+ ++  E+ A++W++  R         R PF+THFTGCQPC G 
Sbjct  326  RHAEKSTGAHGEMRGRYLDR--EAAADEWEQRRR---------RLPFVTHFTGCQPCGGG  374

Query  355  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  203
            HN  YS E+C  AM +AL+ AD+QVLR YGF   D      V PLPYDFP+
Sbjct  375  HNPAYSRESCLAAMQRALDLADDQVLRAYGFRRVDGCG-GHVRPLPYDFPS  424



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 149/220 (68%), Gaps = 5/220 (2%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +M++E+++W  +NAGVFLIRN QW +DF+D WA +GPQ+P Y  W   L      K   +
Sbjct  315  SMVYEQRNWIGLNAGVFLIRNSQWGLDFLDSWARLGPQTPNYRKWTKILLSEISGKDSGD  374

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNIT+ Y   +     ++L
Sbjct  375  SDDQSALVHLLVKDTKRWGNKVYLENSYDLHGYWEAIMGRLDNITERY--KKLEKKEKEL  432

Query  496  RRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  326
            RRRHAEK + ++ E    HL +    G      RRPF+THFTGCQPC G +N  Y+ E+C
Sbjct  433  RRRHAEKDTVAFGETRLRHLDHEVGVGPQEKKKRRPFVTHFTGCQPCGGGYNPTYTWESC  492

Query  325  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
             + MH+ALNFAD+QVLR YGF   D+ D +SV  LP+D+P
Sbjct  493  YEGMHRALNFADDQVLRAYGFGRPDINDISSVQQLPFDYP  532



>ref|XP_004980587.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=447

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 135/225 (60%), Gaps = 19/225 (8%)
 Frame = -1

Query  847  FEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE-SD  671
             E+KSW  +N GVFL+RNCQW++D +D WA MGP  P +  W   +  +  DK      D
Sbjct  227  IERKSWLGINNGVFLLRNCQWSLDLLDEWARMGPAFPEHGQWAKVVLSSLADKGNSTWFD  286

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L+YL+L   E+ G K ++E+DY+   YW+++V +LD +T  Y  +E+      LRR
Sbjct  287  DQSALVYLLLYNWERLGKKAFIETDYFLMAYWLDVVDRLDGVTARYEAVERRMPW--LRR  344

Query  490  RHAEKVSESYAEKWKEHLRNAGQGR----------SGWRRPFITHFTGCQPCSGDHNEMY  341
            RHAE+    YA       RNA               GWRRP ITHF GCQPC+G+ N MY
Sbjct  345  RHAEREHMRYAAA-----RNAAVSGAVPGPAGGGYKGWRRPLITHFVGCQPCNGERNPMY  399

Query  340  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            S E+C D M +AL FAD+QVLR YGF H   L+  SV PLP+D+P
Sbjct  400  SRESCDDGMRRALGFADDQVLRAYGFRHAAPLND-SVRPLPFDYP  443



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 145/221 (66%), Gaps = 7/221 (3%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +M++E+K+W  +NAGVFLIRN QW +DF+D WA MGPQ+P +  WG TL    K K  P+
Sbjct  214  SMVYEEKNWVGLNAGVFLIRNSQWGLDFLDAWARMGPQTPEFQAWGRTLASEIKGKTTPD  273

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS L++L++ E+++W +++Y+E+DY   GYW  ++G+L+N T+ YL +E+     + 
Sbjct  274  ADDQSALLHLLVYEKDRWADRVYLENDYDLHGYWAAVMGRLENSTEDYLAMERREPPLR-  332

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQG----RSGWRRPFITHFTGCQPCSGDHNEMYSGET  329
             RRHAEK + ++ E     L     G    R   RRPF+ HFTGCQPC G HN  Y+ E+
Sbjct  333  -RRHAEKFTRAHGEMRGRCLDREVAGDEWERRRRRRPFVAHFTGCQPCGGGHNPAYTWES  391

Query  328  CADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  206
            C  A+ +AL+ AD+QVLR YGF  R       V PLPYDFP
Sbjct  392  CFAAIQRALDLADDQVLRAYGF-GRVNGSGGYVRPLPYDFP  431



>tpg|DAA64594.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=173

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 11/175 (6%)
 Frame = -1

Query  706  RTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLG  527
            +   D+ F  SDDQS L+YL+LKE++KW ++I++E  YY  GYW++IVG  +NIT+ Y  
Sbjct  1    KVLYDRAFNSSDDQSALVYLLLKEKDKWADRIFIEHKYYLNGYWLDIVGTYENITEKYEA  60

Query  526  IEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQP  368
            +EK      L +RHAEK++  YAE  + H+R+     S         RRPF+THFTGCQP
Sbjct  61   MEK--ENPMLNKRHAEKMNRDYAEMREHHMRDNKNFYSDNDDIMVRRRRPFVTHFTGCQP  118

Query  367  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFP  206
            CSGDHN++Y GE C   M +ALNFAD+QVL+NYGF H D L ++ V P+  + FP
Sbjct  119  CSGDHNKIYKGENCWKGMERALNFADDQVLKNYGFRH-DNLQSSHVNPIQSFYFP  172



>ref|XP_009379786.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379787.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 114/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IF++ SW  +N G FL+RNCQW++D +D WA MGP+ P  D  G  L  + K +   E
Sbjct  271  DLIFDQHSWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGPVRDEAGKILTASLKGRPAFE  330

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q+KWGNK+++E+ YY  GYW  +V + + + + Y            
Sbjct  331  ADDQSALIYLLLSQQDKWGNKVFIENSYYLHGYWAGLVDRYEEMMEKY------------  378

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  379  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLGS  413

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQ+LR YGF HR L
Sbjct  414  MERAFNFADNQILRIYGFAHRGL  436



>ref|XP_009385087.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 112/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IFEK SW  +N G FL+RNCQW +D +D WA MGP+ P  D  G  L    K +   E
Sbjct  262  DLIFEKHSWIGLNTGSFLLRNCQWILDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  321

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q+KWG+K+Y+E+ YY  GYW  +V +                    
Sbjct  322  ADDQSALIYLLLSQQDKWGDKVYIENSYYLHGYWAGLVDR--------------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                       Y E  ++H  + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  362  -----------YEEMMEKH--HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  404

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H  L
Sbjct  405  MERAFNFADNQVLRMYGFAHGSL  427



>ref|XP_009420521.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 112/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IFEK SW  +N G FL+RNCQW++D +D WA MGP+ P  D  G  L    + +   E
Sbjct  259  DLIFEKHSWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLQGRPAFE  318

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + + + D              
Sbjct  319  ADDQSALIYLVLSQQDRWGDKIYIENSYYLHGYWAGLVDRYEEMMD--------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                            K H    G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ----------------KHH---PGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  401

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H  L
Sbjct  402  MERAFNFADNQVLRMYGFAHGKL  424



>ref|XP_001761988.1| predicted protein [Physcomitrella patens]
 gb|EDQ73092.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 113/203 (56%), Gaps = 34/203 (17%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            + ++EK+SW  +NAGVFLIRNCQW+MD +  WA M P+    D  G  L +   D+   E
Sbjct  166  DAVYEKRSWLGLNAGVFLIRNCQWSMDLLHAWAPMSPKGKIRDDVGKFLSKALPDRGKGE  225

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQSGL+YL++ ++E+WG+K+Y+ES YYF+GYW  +  K +++   Y            
Sbjct  226  ADDQSGLVYLMITDRERWGSKVYLESSYYFQGYWKVLTEKFEDMMAKY------------  273

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                +    G   W  PF+THF GC+ C G  N  Y+ + C   
Sbjct  274  --------------------KPGIYGDDRW--PFVTHFCGCEFCCGAINPEYTVDRCLTQ  311

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A+NFADNQVL  YGF+H+ L
Sbjct  312  MERAVNFADNQVLERYGFIHKSL  334



>ref|XP_009393375.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393376.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 113/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++IFEK SW  +N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  269  DLIFEKHSWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKMLTANLKGRPAFE  328

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + + + + Y            
Sbjct  329  ADDQSALIYLLLSQQDRWGDKIYIENSYYLHGYWAGLVDRYEEMMEKY------------  376

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  + C  +
Sbjct  377  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVKRCLRS  411

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H +L
Sbjct  412  MERAFNFADNQVLRMYGFAHGNL  434



>gb|KHN48702.1| Putative glycosyltransferase 3 [Glycine soja]
Length=251

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  50   DLLFEQKSWIAVNTGSFLFRNCQWSLDLLDDWAPMGPKGPVREEAGKILTANLKGRPAFE  109

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y            
Sbjct  110  ADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY------------  157

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  158  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  192

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  193  MERAFNFADNQVLKLYGFRHRGLL  216



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  253  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  312

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + D Y            
Sbjct  313  ADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIDKY------------  360

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  361  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  395

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVLR YGF HR LL
Sbjct  396  MERAYNFADNQVLRLYGFGHRGLL  419



>gb|KEH31956.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=448

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 115/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  247  DLLFEQKSWIAINTGSFLFRNCQWSLDLLDVWAPMGPKGPVREEAGKILTANLKGRPAFE  306

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  307  ADDQSALIYLLLSKKEKWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY------------  354

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  355  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  389

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  390  MERAFNFADNQVLKLYGFRHRGLL  413



>ref|XP_004987031.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=437

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 113/205 (55%), Gaps = 34/205 (17%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            ++  KSW  +NAG F+IRNC+W++D +D WA MGP+ P  D +G  L +   D+   E+D
Sbjct  237  VYVAKSWLGINAGSFIIRNCRWSLDLLDAWARMGPRGPVRDRYGKVLGKALSDRASYEAD  296

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS L+YL++ ++ +WG K ++ES Y   G+WVEIV       D Y         E++RR
Sbjct  297  DQSALVYLLVTQRGRWGGKTFLESSYSLHGFWVEIV-------DRY---------EEMRR  340

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
            RH      +  E+W                P +THF GC+PC G +   Y    C   M 
Sbjct  341  RH-RTTPVAGGERW----------------PLVTHFVGCKPCGGQYAS-YDAARCRHGME  382

Query  310  KALNFADNQVLRNYGFMHRDLLDTA  236
            +ALNFAD+Q+LR YGF H  L  TA
Sbjct  383  RALNFADDQILRLYGFEHESLNTTA  407



>ref|XP_010678459.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 117/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++E+KSW ++N G FL+RNCQW++D +D+WA MGP+    D  G  L    K +   E
Sbjct  236  DLLYEQKSWIALNTGSFLLRNCQWSLDLLDIWAPMGPKGQVRDEAGKLLTANLKGRPAFE  295

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++EKW NK+YVE+ YY  G+W+ +V K                    
Sbjct  296  ADDQSALIYLLISQKEKWMNKVYVENSYYLHGFWLGLVDKY-------------------  336

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                     E  AEK+     + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  337  ---------EEMAEKY-----HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLKS  378

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  379  MERAFNFADNQVLKLYGFRHRGLL  402



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 114/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++ SW ++N G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  257  DLLFDQHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +QE+WGNK+Y+E+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQQERWGNKVYIENSYYLHGFWAGLVERYEEMMEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLGS  399

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF HR L
Sbjct  400  MERAFNFADNQVLRLYGFGHRGL  422



>gb|KHN18571.1| Putative glycosyltransferase 3 [Glycine soja]
Length=249

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  48   DLLFEQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPVREEAGKILTANLKGRPAFE  107

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW ++ ++E+ +Y  GYW  +V + + + + Y            
Sbjct  108  ADDQSALIYLLLSKKEKWMDRTFLENSFYLHGYWAGLVDRYEEMIEKY------------  155

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  156  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  190

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  191  MERAFNFADNQVLKLYGFRHRGLL  214



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 117/206 (57%), Gaps = 37/206 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N GVFL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  258  DLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIY++L +++KW +K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  318  ADDQSALIYILLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFKS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLLDT  239
            M +A NFADNQVL+ YGF HR LL T
Sbjct  401  MERAFNFADNQVLKLYGFSHRGLLST  426



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  254  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  313

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + + + + Y            
Sbjct  314  ADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYEEMIEKY------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  362  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLKS  396

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  397  MERAFNFADNQVLKLYGFRHRGLL  420



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 116/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N GVFL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  258  DLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  318  ADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFKS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  401  MERAFNFADNQVLKLYGFSHRGLL  424



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  254  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  313

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + + + + Y            
Sbjct  314  ADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYEEMIEKY------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  362  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLKS  396

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  397  MERAFNFADNQVLKLYGFRHRGLL  420



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 116/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N GVFL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  274  DLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  333

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  334  ADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY------------  381

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  382  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFKS  416

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  417  MERAFNFADNQVLKLYGFSHRGLL  440



>ref|XP_010912249.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=451

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 113/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F + SW ++N G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  255  DLLFAQHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  314

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q++WG+K+Y+E+ Y+  G+W  +V + + + D Y            
Sbjct  315  ADDQSALIYLLLSQQDRWGDKVYIENSYFLHGFWTGLVDRYEEMIDKY------------  362

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  363  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLGS  397

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF HR L
Sbjct  398  MERAFNFADNQVLRLYGFGHRGL  420



>ref|XP_001765298.1| predicted protein [Physcomitrella patens]
 gb|EDQ70026.1| predicted protein, partial [Physcomitrella patens]
Length=311

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 121/208 (58%), Gaps = 35/208 (17%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            +++EK+SW  +NAGVFL+RNCQW+MD +  WA M P+    D  G  L +   D+   E+
Sbjct  138  VVYEKRSWLGLNAGVFLLRNCQWSMDMLHAWAPMSPRGKIRDGAGKFLTKALPDRGDSEA  197

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQSGL+YL++ ++E+WG+K+++ES YYF+GYW  +  K +++      +EK   G+   
Sbjct  198  DDQSGLVYLMVTDRERWGSKVFLESSYYFQGYWKVLTEKFEDM------MEKYQPGK---  248

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAM  314
                      Y +                R PF+THF GC+ C G  N  Y+ + C   M
Sbjct  249  ----------YGDD---------------RWPFVTHFCGCEFCCGAINPEYTVDRCLTQM  283

Query  313  HKALNFADNQVLRNYGFMHRDLLDTASV  230
             +A+NFADNQV+  YGF+H+ +L +A V
Sbjct  284  ERAVNFADNQVIGRYGFIHK-MLKSAEV  310



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  257  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDQWMDKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLGS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  258  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPIREEAGKILTANLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  318  ADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  401  MERAFNFADNQVLKLYGFRHRGLL  424



>emb|CDY26738.1| BnaA06g12840D [Brassica napus]
Length=482

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N GVFL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  284  DLLFNQKSWVALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  343

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  344  ADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKY------------  391

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C   
Sbjct  392  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAEERCFKG  426

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF H  LL
Sbjct  427  MERAFNFADNQVLKLYGFSHMGLL  450



>gb|ACN27080.1| unknown [Zea mays]
Length=228

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  31   DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPAFE  90

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                      
Sbjct  91   ADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----------------------  128

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  129  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLRS  173

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  174  MERAFNFADNQVLRLYGFSHKGL  196



>ref|XP_010030248.1| PREDICTED: putative glycosyltransferase 5 [Eucalyptus grandis]
 gb|KCW83656.1| hypothetical protein EUGRSUZ_B00540 [Eucalyptus grandis]
Length=449

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 115/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  250  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  309

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ +++KW +K++VE+ YY  GYW+ +V + + + + Y            
Sbjct  310  ADDQSALIYLLISQKDKWMDKVFVENSYYLHGYWLGLVERYEEMIEKY------------  357

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  358  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLGS  392

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  393  MERAFNFADNQVLKLYGFRHRGLL  416



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  257  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_008788330.1| PREDICTED: putative glycosyltransferase 5 [Phoenix dactylifera]
Length=454

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 114/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++ SW ++N G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  258  DLLFDQHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q++WG+K+Y+E+ YY  G+W  +V + + + + Y            
Sbjct  318  ADDQSALIYLLLSQQDRWGDKVYIENSYYLHGFWAGLVERYEEMMEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLGS  400

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF HR L
Sbjct  401  MERAFNFADNQVLRLYGFGHRGL  423



>ref|XP_009764347.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=455

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 112/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW +VN G FL RNCQW++D +D WA MGP+ P  D  G  L    KD+   E
Sbjct  258  DLLFDQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKDRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL + +++KW  K++VE+ YY  GYW  +V + + + + Y            
Sbjct  318  ADDQSALIYLFVSQKDKWMQKVFVENSYYLHGYWAGLVDRYEEMIEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLKS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF H+ LL
Sbjct  401  MERAFNFADNQVLNLYGFRHKGLL  424



>gb|KFK25153.1| hypothetical protein AALP_AA8G072800 [Arabis alpina]
Length=454

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  316  ADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PFITHF GC+PC G + + Y+ E C  +
Sbjct  364  ---------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>gb|KJB50959.1| hypothetical protein B456_008G195000 [Gossypium raimondii]
Length=460

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 115/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  259  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  318

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  319  ADDQSALIYLLLSQKDQWMDKVFIENQYYLHGYWAGLVDRYEEMMEKY------------  366

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + YS E C  +
Sbjct  367  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YSVERCLRS  401

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  402  MQRAFNFADNQVLKLYGFRHRGLL  425



>ref|XP_008393187.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=460

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  258  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPIREEAGKILTANLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  318  ADDQSALIYLLLSQKDXWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  401  MERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_006307492.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
 gb|EOA40390.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
Length=451

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 116/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G+FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  253  DLLFNQKSWIALNTGIFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTAYLKGRPAFE  312

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V + + + + Y            
Sbjct  313  ADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDRYEEMIEKY------------  360

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  361  ---------------------HPGLGDERW--PFVTHFVGCKPC-GKYAD-YAVDRCFKS  395

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  396  MERAFNFADNQVLKLYGFSHRGLL  419



>ref|XP_008783986.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
5 [Phoenix dactylifera]
Length=452

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 113/203 (56%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F + SW ++N G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFGQHSWIALNTGSFLLRNCQWSLDLLDTWAPMGPKGPIREEAGRILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +Q++WG+++Y+E+ YY  G+W  +V + + + D Y            
Sbjct  316  ADDQSALIYLLLSQQDRWGDRVYIENSYYLHGFWTGLVERYEEMMDKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLGS  398

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF HR L
Sbjct  399  MERAFNFADNQVLRLYGFGHRGL  421



>ref|XP_009606203.1| PREDICTED: putative glycosyltransferase 3 [Nicotiana tomentosiformis]
Length=462

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 111/204 (54%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW SVN G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  265  DLLFDQKSWISVNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  324

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL + +++KW  K++VE+ YY  GYW  +V + + + + Y            
Sbjct  325  ADDQSALIYLFISQKDKWMRKVFVENSYYLHGYWAGLVDRYEEMIEKY------------  372

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  373  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPAERCLKS  407

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF H+ LL
Sbjct  408  MERAFNFADNQVLNLYGFRHKGLL  431



>ref|XP_012080311.1| PREDICTED: putative glycosyltransferase 5 [Jatropha curcas]
Length=457

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMIEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCLRS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  221  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  280

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  281  ADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMIEKY------------  328

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  329  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCLRS  363

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  364  MERAFNFADNQVLKLYGFGHRGLL  387



>ref|XP_003549688.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  246  DLLFEQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPVREEAGKILTANLKGRPAFE  305

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K ++E+ +Y  GYW  +V + + + + Y            
Sbjct  306  ADDQSALIYLLLSKKEKWMDKTFLENSFYLHGYWAGLVDRYEEMIEKY------------  353

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  354  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  388

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  389  MERAFNFADNQVLKLYGFRHRGLL  412



>ref|XP_003524717.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  246  DLLFEQKSWIAVNTGSFLFRNCQWSLDLLDDWAPMGPKGPVREEAGKILTANLKGRPAFE  305

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y            
Sbjct  306  ADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY------------  353

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  354  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  388

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  389  MERAFNFADNQVLKLYGFRHRGLL  412



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFRHRGLL  422



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  245  DLLFDQKSWIAINTGSFLFRNCQWSLDLLDEWAPMGPKGPVREEAGKVLTANLKGRPAFE  304

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+++E+ YY  GYW  +V + + + + Y            
Sbjct  305  ADDQSALIYLLLSKKEKWMGKVFLENSYYLHGYWAGLVDRYEEMIEKY------------  352

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  353  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  387

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  388  MERAFNFADNQVLKLYGFRHRGLL  411



>ref|XP_010537379.1| PREDICTED: putative glycosyltransferase 5 [Tarenaya hassleriana]
Length=455

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 44/221 (20%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  257  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIY++L +++KW  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYILLSQKDKWMEKVFVENQYYLHGFWEGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  215
            M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  400  MERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  440



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  258  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  317

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y            
Sbjct  318  ADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY------------  365

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  366  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  400

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  401  MERAFNFADNQVLKLYGFRHRGLL  424



>emb|CDX85826.1| BnaC06g23080D [Brassica napus]
 emb|CDX68187.1| BnaA07g22270D [Brassica napus]
Length=223

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 109/205 (53%), Gaps = 37/205 (18%)
 Frame = -1

Query  859  LNMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFP  680
            L +   +KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   
Sbjct  21   LMLSHPEKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAF  80

Query  679  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  500
            E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V K + + + Y           
Sbjct  81   EADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDKYEEMMEKY-----------  129

Query  499  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
                                  + G G   W  PF+THF GC+PC    +  Y+ E C  
Sbjct  130  ----------------------HPGLGDERW--PFVTHFVGCKPCGSYAD--YAVERCLK  163

Query  319  AMHKALNFADNQVLRNYGFMHRDLL  245
            +M +A NFADNQVL+ YGF HR LL
Sbjct  164  SMERAFNFADNQVLKLYGFGHRGLL  188



>emb|CAI11456.1| putative glycosyltransferase [Lotus japonicus]
Length=443

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  242  DLLFEQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPVREEAGKVLTANLKGRPAFE  301

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K ++E+ +Y  GYW  +V + + + + Y            
Sbjct  302  ADDQSALIYLLLSKKDKWMDKTFLENSFYLHGYWAGLVDRYEEMIEKY------------  349

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  350  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLSS  384

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  385  MERAFNFADNQVLKLYGFRHRGLL  408



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  251  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++++W NK+YVE+ Y+  GYW  +V + + + + Y            
Sbjct  311  ADDQSALIYLLISKKDQWMNKVYVENSYFLHGYWAGLVDRYEEMMEKY------------  358

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  359  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YAVDRCLKS  393

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF HR LL
Sbjct  394  MERAFNFADNQVLNLYGFSHRGLL  417



>ref|XP_011075649.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=443

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 117/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FLIRNCQW+++ +D WA MGP+    D  G  L    K +   E
Sbjct  242  SLLFKEKSWIALNTGSFLIRNCQWSLNLLDSWAPMGPKGRVRDEAGKILTANLKGRPTFE  301

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++  +++W +K+++E+ YY  GYWV +V       D Y            
Sbjct  302  ADDQSALIYLLISRKDEWMDKVFLENSYYLHGYWVGLV-------DRY------------  342

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                     E Y E++     + G G   W  PF+THF GC+PC G  +  YS E C  +
Sbjct  343  ---------EEYIERY-----HPGLGDERW--PFVTHFVGCKPCGGYGD--YSLERCLQS  384

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M KA NFADNQ+L++YGF HR LL
Sbjct  385  MEKAFNFADNQLLKSYGFSHRGLL  408



>ref|XP_002318600.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
 gb|EEE96820.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
Length=452

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 118/221 (53%), Gaps = 44/221 (20%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  251  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  311  ADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMIEKY------------  358

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  359  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLRS  393

Query  316  MHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  215
            M +A NFADNQVL  YGF HR LL          +V PL Y
Sbjct  394  MERAFNFADNQVLNLYGFGHRGLLSPKIKRIRNETVTPLEY  434



>gb|EYU35800.1| hypothetical protein MIMGU_mgv1a006038mg [Erythranthe guttata]
Length=460

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  259  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPIREETGRILTANLKGRPAFE  318

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++E+W NK++VE+ +Y  G+W  +V + + + + Y            
Sbjct  319  ADDQSALIYLLISQKERWMNKVFVENSFYLHGFWEGLVDRYEEMIEKY------------  366

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  367  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLKS  401

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF HR L+
Sbjct  402  MERAFNFADNQVLNLYGFRHRGLV  425



>ref|NP_001047014.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAD25434.1| putative galactomannan galactosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08928.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73308.1| hypothetical protein OsI_07488 [Oryza sativa Indica Group]
 gb|EEE57116.1| hypothetical protein OsJ_06989 [Oryza sativa Japonica Group]
Length=480

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  283  DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDEAGKILTANLKGRPAFE  342

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW NK+++E+ YY  G+W  +V                      
Sbjct  343  ADDQSALIYLLLSQKEKWMNKVFIENSYYLHGFWAGLV----------------------  380

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  381  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLRS  425

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  426  MERAFNFADNQVLRLYGFAHKGL  448



>emb|CDX96540.1| BnaA07g31510D [Brassica napus]
 emb|CDX73082.1| BnaC06g35300D [Brassica napus]
Length=222

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 109/205 (53%), Gaps = 37/205 (18%)
 Frame = -1

Query  859  LNMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFP  680
            L +   +KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   
Sbjct  21   LMLSHPEKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAF  80

Query  679  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  500
            E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y           
Sbjct  81   EADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMMEKY-----------  129

Query  499  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  320
                                  + G G   W  PF+THF GC+PC    +  Y+ E C  
Sbjct  130  ----------------------HPGLGDERW--PFVTHFVGCKPCGSYAD--YAVERCLK  163

Query  319  AMHKALNFADNQVLRNYGFMHRDLL  245
            +M +A NFADNQVL+ YGF HR LL
Sbjct  164  SMERAFNFADNQVLKLYGFGHRGLL  188



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 112/201 (56%), Gaps = 37/201 (18%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            + E++SW ++N G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E+D
Sbjct  259  LLEQQSWIALNTGSFLLRNCQWSLDLLDTWAPMGPKGPVREEAGRILTANLKGRPAFEAD  318

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++ +Q++W +K+Y+E+ Y+  G+WV +V K + + D                
Sbjct  319  DQSALIYLLISQQDRWSDKVYIENSYFLHGFWVGLVDKYEEMMD----------------  362

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                          K H    G G   W  PF+THF GC+PC G + + Y  E C  +M 
Sbjct  363  --------------KHH---PGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLGSME  401

Query  310  KALNFADNQVLRNYGFMHRDL  248
            +A NFADNQVLR YGF HR L
Sbjct  402  RAFNFADNQVLRLYGFGHRGL  422



>ref|XP_007155288.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
 gb|ESW27282.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
Length=445

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW +VN G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  244  DLLFDQKSWIAVNTGSFLFRNCQWSLDLLDDWAPMGPKGPVREEAGKILTANLKGRPAFE  303

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y            
Sbjct  304  ADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY------------  351

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  352  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  386

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  387  MERAYNFADNQVLKLYGFRHRGLL  410



>ref|XP_009761185.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=453

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FLIRNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  252  DLLFDQKSWIALNTGSFLIRNCQWSLDLLDVWAPMGPKGPVREEAGKVLTANLKGRPAFE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++++W +++++E+ YY  GYW  +V + + + + Y            
Sbjct  312  ADDQSALIYLLMSQKDQWMDQVFIENSYYLHGYWAGLVDRYEEMIEKY------------  359

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  360  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCMKS  394

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF H+ LL
Sbjct  395  MERAFNFADNQVLKLYGFRHKGLL  418



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 118/221 (53%), Gaps = 44/221 (20%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+    +  G  L    K +   E
Sbjct  252  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGAIREEAGKILTANLKGRPAFE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  312  ADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY------------  359

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  360  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCMRS  394

Query  316  MHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  215
            M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  395  MERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>ref|XP_009149356.1| PREDICTED: putative glycosyltransferase 4 [Brassica rapa]
Length=503

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F + SW ++N GVFL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  305  DLLFNQMSWVALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIREEAGKVLTAYLKGRPAFE  364

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  365  ADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKY------------  412

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  413  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAEERCFKS  447

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF H  LL
Sbjct  448  MERAFNFADNQVLKLYGFSHMGLL  471



>ref|XP_001781241.1| predicted protein [Physcomitrella patens]
 gb|EDQ53939.1| predicted protein, partial [Physcomitrella patens]
Length=309

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 113/203 (56%), Gaps = 34/203 (17%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            + +++K+SW  +NAGVFLIRNCQW+MDF+  WA M P+    D  G  L +   D+   E
Sbjct  136  DAVYDKRSWLGLNAGVFLIRNCQWSMDFLHAWAPMSPKGKIRDGAGEFLTKALPDRGKGE  195

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQSG++YL++ ++E+WG+KI++E+ YYF+GYW  +  K                    
Sbjct  196  ADDQSGIVYLMITDRERWGSKIFLENSYYFQGYWRVLTDKF-------------------  236

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                     E    K+K  L     G   W  PF+THF GC+ C G  N  Y+ + C   
Sbjct  237  ---------EEMMAKYKPGL----YGDDRW--PFVTHFCGCEFCCGSINPEYTRDQCLVH  281

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A+NFADNQV+  YGF H+ L
Sbjct  282  MERAINFADNQVIGRYGFRHKSL  304



>ref|NP_196389.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LF80.1|GT3_ARATH RecName: Full=Putative glycosyltransferase 3; Short=AtGT3 [Arabidopsis 
thaliana]
 emb|CAC01676.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 dbj|BAB11451.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AAQ56808.1| At5g07720 [Arabidopsis thaliana]
 dbj|BAE99734.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AED91197.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38639.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++E W  K++VE+ YY  G+W  +V K + + + Y            
Sbjct  316  ADDQSALIYLLLSQKETWMEKVFVENQYYLHGFWEGLVDKYEEMMEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PFITHF GC+PC G + + Y+ E C  +
Sbjct  364  ---------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>gb|EAY89696.1| hypothetical protein OsI_11232 [Oryza sativa Indica Group]
Length=448

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 109/205 (53%), Gaps = 39/205 (19%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F++KSW  VN G FLIRNCQW++D +D WA MGP+ P  D +G         +   E+D
Sbjct  250  VFDEKSWIGVNTGSFLIRNCQWSLDLLDAWAPMGPRGPVRDRYGELFAEELSGRPPFEAD  309

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++ ++++WG+K+++ES Y   G+W       + I D Y              
Sbjct  310  DQSALIYLLVTQRQRWGDKVFIESSYDLNGFW-------EGIVDRY--------------  348

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                           E LR AG+    W  PF+THF GC+PC   + + Y  E C   M 
Sbjct  349  ---------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRRGME  390

Query  310  KALNFADNQVLRNYGFMHRDLLDTA  236
            +A NFAD+Q+L+ YGF H  L  TA
Sbjct  391  RAFNFADDQILKLYGFAHESLNTTA  415



>ref|NP_001173389.1| Os03g0306100 [Oryza sativa Japonica Group]
 dbj|BAH92117.1| Os03g0306100 [Oryza sativa Japonica Group]
Length=449

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 39/205 (19%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F++KSW  VN G FLIRNCQW++D +D WA MGP+ P  D +G         +   E+D
Sbjct  251  VFDEKSWIGVNTGSFLIRNCQWSLDLLDAWAPMGPRGPVRDRYGELFAEELSGRPPFEAD  310

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++ ++++WG+K+++ES Y   G+W  IV K                      
Sbjct  311  DQSALIYLLVTQRQRWGDKVFIESSYDLNGFWEGIVDKY---------------------  349

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                           E LR AG+    W  PF+THF GC+PC   + + Y  E C   M 
Sbjct  350  ---------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRRGME  391

Query  310  KALNFADNQVLRNYGFMHRDLLDTA  236
            +A NFAD+Q+L+ YGF H  L  TA
Sbjct  392  RAFNFADDQILKLYGFAHESLNTTA  416



>emb|CDY19235.1| BnaC05g14360D [Brassica napus]
Length=452

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 112/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N GVFL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  254  DLLFNQKSWVALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRNEAGKVLTAYLKGRPAFE  313

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++  +EKW  K+YVE+ YY  G+W  +V K + + + Y            
Sbjct  314  ADDQSTLIYLLISHKEKWMEKVYVENQYYLHGFWEGLVDKYEEMMERY------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF++HF GC+PC G + + Y+ E C   
Sbjct  362  ---------------------HPGLGDERW--PFVSHFVGCKPC-GSYAD-YAEERCFKG  396

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF HR LL
Sbjct  397  MERAFNFADNQVLELYGFSHRGLL  420



>gb|ABF95527.1| Glycosyltransferase 3, putative [Oryza sativa Japonica Group]
 gb|EAZ26652.1| hypothetical protein OsJ_10556 [Oryza sativa Japonica Group]
Length=448

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 39/205 (19%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F++KSW  VN G FLIRNCQW++D +D WA MGP+ P  D +G         +   E+D
Sbjct  250  VFDEKSWIGVNTGSFLIRNCQWSLDLLDAWAPMGPRGPVRDRYGELFAEELSGRPPFEAD  309

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++ ++++WG+K+++ES Y   G+W  IV K                      
Sbjct  310  DQSALIYLLVTQRQRWGDKVFIESSYDLNGFWEGIVDKY---------------------  348

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                           E LR AG+    W  PF+THF GC+PC   + + Y  E C   M 
Sbjct  349  ---------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRRGME  390

Query  310  KALNFADNQVLRNYGFMHRDLLDTA  236
            +A NFAD+Q+L+ YGF H  L  TA
Sbjct  391  RAFNFADDQILKLYGFAHESLNTTA  415



>ref|XP_003558113.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Brachypodium 
distachyon]
Length=445

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 110/204 (54%), Gaps = 41/204 (20%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M+++ K+W  +N G FL+RNCQW++DF+D WA MGP+ P     G  L +  KD+   E+
Sbjct  245  MVYDDKNWIGLNTGSFLVRNCQWSLDFLDTWAPMGPKGPVRIEAGRVLTKHLKDRPVFEA  304

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V                       
Sbjct  305  DDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-----------------------  341

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCAD  320
                        ++++E L N   G    R P +THF GC+PCS  GD    Y  E C  
Sbjct  342  ------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCSKFGD----YPVERCLK  385

Query  319  AMHKALNFADNQVLRNYGFMHRDL  248
             M +A NF DNQVL+ YGF H+ L
Sbjct  386  QMDRAFNFGDNQVLQMYGFEHKSL  409



>ref|XP_006390433.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
 gb|ESQ27719.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
Length=456

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>ref|XP_010523024.1| PREDICTED: putative glycosyltransferase 3 [Tarenaya hassleriana]
Length=454

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (57%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  253  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFE  312

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K++VE+ YY  G+W                          
Sbjct  313  ADDQSALIYLLLSQKDQWMDKVFVENQYYLHGFW--------------------------  346

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                 E + + Y E  +++    G GR  W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  347  -----EGLVDRYEEMMEKYHPGLGDGR--W--PFVTHFVGCKPC-GSYAD-YAVERCLKS  395

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  396  MERAFNFADNQVLKLYGFGHRGLL  419



>ref|XP_004952632.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=475

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  278  DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPAFE  337

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW +K+++E+ YY  G+W  +V                      
Sbjct  338  ADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLV----------------------  375

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  376  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLKS  420

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  421  MERAFNFADNQVLRLYGFSHKGL  443



>ref|XP_006300466.1| hypothetical protein CARUB_v10020269mg [Capsella rubella]
 gb|EOA33364.1| hypothetical protein CARUB_v10020269mg [Capsella rubella]
Length=457

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  257  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFGHRGLL  423



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 117/221 (53%), Gaps = 44/221 (20%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+KSW ++N G FL RNCQW++D +D WA MGP+    +  G  L    K +   E
Sbjct  252  DLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGAIREEAGKILTANLKGRPAFE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++ +W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  312  ADDQSALIYLLLSQKAQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY------------  359

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  360  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCMRS  394

Query  316  MHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  215
            M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  395  MERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>ref|XP_002887538.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63797.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  257  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFSHRGLL  423



>ref|XP_010428421.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010428422.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Camelina 
sativa]
Length=459

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  259  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  318

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  319  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY------------  366

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  367  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  401

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  402  MERAFNFADNQVLKLYGFGHRGLL  425



>ref|NP_177578.1| xyloglucan xylosyltransferase 5 [Arabidopsis thaliana]
 sp|Q9CA75.1|GT5_ARATH RecName: Full=Putative glycosyltransferase 5; Short=AtGT5 [Arabidopsis 
thaliana]
 gb|AAG52374.1|AC011765_26 putative alpha galactosyltransferase; 16168-17541 [Arabidopsis 
thaliana]
 gb|AAM13174.1| putative alpha galactosyltransferase [Arabidopsis thaliana]
 gb|AAP81802.1| At1g74380 [Arabidopsis thaliana]
 gb|AEE35584.1| xyloglucan xylosyltransferase 5 [Arabidopsis thaliana]
 gb|AHL38876.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  257  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFSHRGLL  423



>ref|XP_010471529.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=460

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  260  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  319

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  320  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY------------  367

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  368  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  402

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  403  MERAFNFADNQVLKLYGFGHRGLL  426



>emb|CDX69995.1| BnaA10g23440D [Brassica napus]
Length=455

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++++KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  254  DLLYDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPIREEAGKVLTAFLKGRPAFE  313

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L E++ W  K++VE+ YY  G+W  +V + + + D Y            
Sbjct  314  ADDQSALIYLLLSEKDTWMGKVFVENQYYLHGFWEGLVDRYEEMMDKY------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  362  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVEHCLKS  396

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  397  MERAYNFADNQVLKLYGFGHRGLL  420



>gb|KFK41883.1| hypothetical protein AALP_AA2G184600 [Arabis alpina]
Length=460

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  259  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  318

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  319  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMMEKY------------  366

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  367  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  401

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  402  MERAFNFADNQVLKLYGFSHRGLL  425



>ref|XP_002442801.1| hypothetical protein SORBIDRAFT_08g003090 [Sorghum bicolor]
 gb|EES16639.1| hypothetical protein SORBIDRAFT_08g003090 [Sorghum bicolor]
Length=465

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 115/209 (55%), Gaps = 38/209 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK+SW ++NAG+FL+RNCQW++D +D W  MGP+ P     G  L  +   +   E
Sbjct  268  DLLFEKRSWIALNAGIFLLRNCQWSLDLLDAWVPMGPRGPSRVEAGKLLTASLTGRPAFE  327

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LI+L+L ++E+W +K++VE+++Y  G+W  +V +                    
Sbjct  328  ADDQSALIHLLLMQKERWMDKVHVETEFYLHGFWTGLVDR--------------------  367

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                       Y E  +EH  + G G   W  PFITHF GC+ C     E Y  + C   
Sbjct  368  -----------YEEMMEEH--HPGLGDDRW--PFITHFVGCKTCG--RYEDYPLDRCVGG  410

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTASV  230
            M +A NFADNQVLR YGF HR  L TA V
Sbjct  411  MERAFNFADNQVLRLYGFRHRS-LTTAKV  438



>ref|XP_010416293.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=457

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  257  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFGHRGLL  423



>ref|XP_009122397.1| PREDICTED: putative glycosyltransferase 3 [Brassica rapa]
Length=455

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            ++++++KSW ++N G FL RNCQW++D +DVWA MGP+ P  +  G  L    K +   E
Sbjct  254  DLLYDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPIREEAGKVLTAFLKGRPAFE  313

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L E++ W  K++VE+ YY  G+W  +V + + + D Y            
Sbjct  314  ADDQSALIYLLLSEKDTWMGKVFVENQYYLHGFWEGLVDRYEEMMDKY------------  361

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  362  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVEHCLKS  396

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  397  MERAYNFADNQVLKLYGFGHRGLL  420



>ref|XP_004301136.1| PREDICTED: putative glycosyltransferase 5 [Fragaria vesca subsp. 
vesca]
Length=456

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 112/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKVLTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  GYW  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDLWMEKVFVENSYYLHGYWAGLVDRYEEMIEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFRHRGLL  422



>ref|XP_004138178.1| PREDICTED: putative glycosyltransferase 5 [Cucumis sativus]
 gb|KGN63689.1| hypothetical protein Csa_1G009930 [Cucumis sativus]
Length=460

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  257  DLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMVEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_002871288.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47547.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++E W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKETWMEKVFVENQYYLHGFWEGLVDRYEEMIEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PFITHF GC+PC G + + Y+ E C  +
Sbjct  364  ---------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>ref|NP_173304.2| putative glycosyltransferase 4 [Arabidopsis thaliana]
 sp|Q9M9U0.1|GT4_ARATH RecName: Full=Putative glycosyltransferase 4; Short=AtGT4 [Arabidopsis 
thaliana]
 gb|AAF27110.1|AC011809_19 Similar to galactosyltransferase [Arabidopsis thaliana]
 gb|AEE29746.1| putative glycosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38941.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=513

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G+FL+RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  315  DLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGKIRDETGKILTAYLKGRPAFE  374

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V + + + + Y            
Sbjct  375  ADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKY------------  422

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  423  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFKS  457

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  458  MERAFNFADNQVLKLYGFSHRGLL  481



>ref|XP_009106103.1| PREDICTED: putative glycosyltransferase 5 [Brassica rapa]
Length=456

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL+RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMMEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLL  422



>gb|KEH33442.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=453

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 112/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FE+ SW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  252  DLLFEQNSWIAINTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  311

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW  K+++E+ +Y  GYW  +V + + + + Y            
Sbjct  312  ADDQSALIYLLLSKKDKWMEKVFLENSFYLHGYWAGLVDRYEEMMEKY------------  359

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  360  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  394

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  395  MERAFNFADNQVLKLYGFRHRGLL  418



>ref|XP_004138179.1| PREDICTED: putative glycosyltransferase 5 [Cucumis sativus]
 gb|KGN63690.1| hypothetical protein Csa_1G010930 [Cucumis sativus]
Length=460

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  257  DLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  316

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  317  ADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY------------  364

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  365  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  399

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  400  MERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_010683109.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 110/204 (54%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEKKSW ++N G  L RNCQW +D +D WA MGP+ P  D  G  +      +   E
Sbjct  250  DLLFEKKSWIALNTGSVLFRNCQWTLDLLDTWAPMGPKGPTRDEAGRLVTAFLSGRPAFE  309

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++E W NK++VE+ YY  G+W  +V K + + + Y            
Sbjct  310  ADDQSALIYLLISQKEVWMNKVFVENSYYLHGFWTGLVDKYEEMLEKY------------  357

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  358  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YPVEKCLKS  392

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  393  MERAFNFADNQVLKLYGFRHRGLL  416



>ref|XP_006287623.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
 gb|EOA20521.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
Length=485

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  284  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFE  343

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++ W  K+YVE+ YY  G+W  +V + + + + Y            
Sbjct  344  ADDQSALIYLLLSQKDTWMKKVYVENQYYLHGFWEGLVDRYEEMIEKY------------  391

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PFITHF GC+PC G + + Y+ E C  +
Sbjct  392  ---------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLKS  426

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  427  MERAFNFADNQVLKLYGFGHRGLL  450



>dbj|BAD43079.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01601.1| hypothetical protein [Arabidopsis thaliana]
Length=513

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G+FL+RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  315  DLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGKIRDETGKILTAYLKGRPAFE  374

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V + + + + Y            
Sbjct  375  ADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKY------------  422

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y+ + C  +
Sbjct  423  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFKS  457

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  458  MERAFNFADNQVLKLYGFSHRGLL  481



>ref|XP_006651308.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Oryza brachyantha]
Length=366

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 110/205 (54%), Gaps = 39/205 (19%)
 Frame = -1

Query  850  IFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPESD  671
            +F++KSW  VN G FLIRNCQW++D +D WA MGP+ P  D +G+        +   E+D
Sbjct  168  VFDEKSWVGVNTGSFLIRNCQWSLDLLDAWAPMGPRGPVRDRYGHLFAEELSGRPPFEAD  227

Query  670  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  491
            DQS LIYL++ ++E+WG+K+++ES Y   G+W       + I D Y         E+LRR
Sbjct  228  DQSALIYLLVTQRERWGDKVFLESSYDLNGFW-------EGIVDRY---------EELRR  271

Query  490  RHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMH  311
                                   GR   R P ITHF GC+PC   + + Y  E C   M 
Sbjct  272  ----------------------TGRDDGRWPLITHFVGCKPCR-RYADSYPAERCRLGME  308

Query  310  KALNFADNQVLRNYGFMHRDLLDTA  236
            +A NFAD+Q+L+ YGF H  L  TA
Sbjct  309  RAFNFADDQILKLYGFAHESLNTTA  333



>ref|XP_010318819.1| PREDICTED: putative glycosyltransferase 5 [Solanum lycopersicum]
Length=450

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 112/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW +VN G FL+RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  249  DLLFDQKSWVAVNTGSFLVRNCQWSLDLLDAWAPMGPKGPVREEAGKVLTANLKGRPAFE  308

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+  ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  309  ADDQSALIYLLTSQKDQWMDKVFIENSYYLHGYWAGLVDRYEEMIEKY------------  356

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G + W  PF+THF GC+PC G + + Y  E C   
Sbjct  357  ---------------------HPGLGDARW--PFVTHFVGCKPC-GSYGD-YPAERCLKN  391

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL  YGF H  LL
Sbjct  392  MERAFNFADNQVLNLYGFRHEGLL  415



>ref|XP_004500012.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=452

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++ SW ++N G FL RNCQW++D +D WA MGP+ P  +  G  L    K +   E
Sbjct  251  DLLFQQNSWIAINTGSFLFRNCQWSLDLLDEWAPMGPKGPIREEAGKILTANLKGRPAFE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  311  ADDQSALIYLLLSKKDKWMDKVFLENSYYLHGYWAGLVDRYEEMMEKY------------  358

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  359  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLSS  393

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  394  MERAFNFADNQVLKLYGFRHRGLL  417



>ref|NP_001049853.1| Os03g0300000 [Oryza sativa Japonica Group]
 dbj|BAF11767.1| Os03g0300000, partial [Oryza sativa Japonica Group]
Length=348

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 109/204 (53%), Gaps = 41/204 (20%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M+++ K+W  +N G FL+RNCQW++DF+D WA MGP+ P     G  L +  KD+   E+
Sbjct  147  MVYDDKNWIGLNTGSFLLRNCQWSLDFLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVFEA  206

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS ++Y++  E+EKWG+K+Y+E+ YY  GYW  +V                       
Sbjct  207  DDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILV-----------------------  243

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCAD  320
                        ++++E L N   G    R P +THF GC+PC   GD    Y  E C  
Sbjct  244  ------------DRYEEMLENYHPGLGDHRWPLVTHFVGCKPCGKFGD----YPVERCLK  287

Query  319  AMHKALNFADNQVLRNYGFMHRDL  248
             M +A NF DNQ+L+ YGF H+ L
Sbjct  288  QMERAFNFGDNQILQMYGFTHKSL  311



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 118/221 (53%), Gaps = 44/221 (20%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F++KSW ++N G FL RNCQW++D +D WA MGP+    +  G  L    K +   E
Sbjct  256  DLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGTIREEAGKILTANLKGRPAFE  315

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y            
Sbjct  316  ADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY------------  363

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  364  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLKS  398

Query  316  MHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  215
            M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  399  MERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  439



>ref|XP_002284667.1| PREDICTED: putative glycosyltransferase 5 [Vitis vinifera]
Length=450

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  251  DLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  311  ADDQSALIYLLISKKDEWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY------------  358

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  359  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLRS  393

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  394  MERAFNFADNQVLKLYGFRHRGLL  417



>emb|CAN80739.1| hypothetical protein VITISV_027037 [Vitis vinifera]
Length=450

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 37/204 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++F +KSW ++N G FL RNCQW++D +D WA MGP+ P  D  G  L    K +   E
Sbjct  251  DLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLKGRPAFE  310

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL++ ++++W +K+++E+ YY  GYW  +V + + + + Y            
Sbjct  311  ADDQSALIYLLISKKDEWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY------------  358

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                                 + G G   W  PF+THF GC+PC G + + Y  E C  +
Sbjct  359  ---------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLRS  393

Query  316  MHKALNFADNQVLRNYGFMHRDLL  245
            M +A NFADNQVL+ YGF HR LL
Sbjct  394  MERAFNFADNQVLKLYGFRHRGLL  417



>gb|ACF82576.1| unknown [Zea mays]
Length=279

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 109/204 (53%), Gaps = 41/204 (20%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M+++ K+W  +N G FL+RNCQW++D +D WA MGP+ P     G  L ++ KD+   E+
Sbjct  79   MVYDDKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKDRPVFEA  138

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS ++Y++  ++EKWG+K+Y+E+ YY  GYW  +V                       
Sbjct  139  DDQSAMVYILATQREKWGDKVYLENGYYLHGYWGILV-----------------------  175

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCAD  320
                        ++++E L N   G    R P +THF GC+PC   GD    Y  E C  
Sbjct  176  ------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCGKFGD----YPVERCLK  219

Query  319  AMHKALNFADNQVLRNYGFMHRDL  248
             M +A NF DNQ+L+ YGF H+ L
Sbjct  220  NMDRAFNFGDNQILQMYGFTHKSL  243



>gb|AFW71661.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  281  DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPAFE  340

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                      
Sbjct  341  ADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----------------------  378

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  379  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLRS  423

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  424  MERAFNFADNQVLRLYGFSHKGL  446



>ref|NP_001105849.1| putative glycosyltransferase [Zea mays]
 emb|CAJ57382.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  281  DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPAFE  340

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                      
Sbjct  341  ADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----------------------  378

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  379  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLRS  423

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  424  MERAFNFADNQVLRLYGFSHKGL  446



>ref|XP_002453927.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
 gb|EES06903.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
Length=480

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 111/203 (55%), Gaps = 37/203 (18%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            +++FEK SW ++N G FL RNCQW++D +D WA MGP+    D  G  L    K +   E
Sbjct  283  DLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPAFE  342

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                      
Sbjct  343  ADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----------------------  380

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
                         +K++E + N   G    R PF+THF GC+PC G + + Y  E C  +
Sbjct  381  -------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLRS  425

Query  316  MHKALNFADNQVLRNYGFMHRDL  248
            M +A NFADNQVLR YGF H+ L
Sbjct  426  MERAFNFADNQVLRLYGFSHKGL  448



>ref|XP_002465378.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
 gb|EER92376.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
Length=446

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 108/207 (52%), Gaps = 33/207 (16%)
 Frame = -1

Query  856  NMIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPE  677
            + ++  KSW  +NAG F+IRNCQW++D +D WA MGP+ P    +G  L +   D+   E
Sbjct  240  DKVYAAKSWLGINAGSFIIRNCQWSLDLLDAWARMGPRGPVRYEYGKVLGKALSDRPSYE  299

Query  676  SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKL  497
            +DDQS L+YL++ E+ +WG+K ++E  Y   G+W+ IV       D Y         E +
Sbjct  300  ADDQSALVYLLVTERGRWGDKTFLEGSYSLHGFWLAIV-------DRY---------EDM  343

Query  496  RRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADA  317
            RR           E+W                P +THF GC+PC G +   Y    C   
Sbjct  344  RRDATATPGGGGGERW----------------PLVTHFVGCKPCGGQYAS-YEASRCRRG  386

Query  316  MHKALNFADNQVLRNYGFMHRDLLDTA  236
            M +ALNFAD+Q+LR YGF H  L  TA
Sbjct  387  MERALNFADDQILRLYGFEHESLNTTA  413



>gb|EMS58373.1| Putative glycosyltransferase 2 [Triticum urartu]
Length=378

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 109/204 (53%), Gaps = 41/204 (20%)
 Frame = -1

Query  853  MIFEKKSWTSVNAGVFLIRNCQWAMDFMDVWASMGPQSPPYDHWGNTLRRTFKDKIFPES  674
            M+++ K+W  +N G FL+RNCQW++D++D WA MGP+ P     G  L +  KD+   E+
Sbjct  178  MVYDDKNWIGLNTGSFLLRNCQWSLDYLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVFEA  237

Query  673  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  494
            DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V                       
Sbjct  238  DDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-----------------------  274

Query  493  RRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCAD  320
                        ++++E L N   G    R P +THF GC+PCS  GD    Y  E C  
Sbjct  275  ------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCSKFGD----YPVERCLK  318

Query  319  AMHKALNFADNQVLRNYGFMHRDL  248
             M +A NF DNQVL  YGF H+ L
Sbjct  319  QMDRAFNFGDNQVLHMYGFEHKSL  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554