BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4136

Length=921
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008363346.1|  PREDICTED: NAD(H) kinase 1 isoform X2              357   2e-116   
ref|XP_009374927.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         356   7e-116   
ref|XP_008363343.1|  PREDICTED: NAD(H) kinase 1 isoform X1              357   8e-116   
ref|XP_008349859.1|  PREDICTED: NAD(H) kinase 1-like                    345   1e-115   
emb|CDP09273.1|  unnamed protein product                                355   2e-115   Coffea canephora [robusta coffee]
ref|XP_007214444.1|  hypothetical protein PRUPE_ppa024717mg             352   2e-115   
ref|XP_008227335.1|  PREDICTED: NAD(H) kinase 1 isoform X1              355   2e-115   Prunus mume [ume]
ref|XP_008227336.1|  PREDICTED: NAD(H) kinase 1 isoform X2              355   2e-115   Prunus mume [ume]
ref|XP_009374926.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         355   6e-115   
ref|XP_009618540.1|  PREDICTED: NAD(H) kinase 1                         353   1e-114   Nicotiana tomentosiformis
ref|XP_008227337.1|  PREDICTED: NAD(H) kinase 1 isoform X3              351   2e-114   Prunus mume [ume]
ref|XP_011080363.1|  PREDICTED: NAD(H) kinase 1                         353   2e-114   Sesamum indicum [beniseed]
dbj|BAK22410.1|  NAD kinase                                             344   3e-114   Nicotiana benthamiana
ref|XP_009775830.1|  PREDICTED: NAD(H) kinase 1                         351   1e-113   Nicotiana sylvestris
gb|ACU17681.1|  unknown                                                 340   1e-113   Glycine max [soybeans]
ref|XP_011459496.1|  PREDICTED: NAD(H) kinase 1                         349   3e-113   Fragaria vesca subsp. vesca
ref|XP_009366085.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         348   6e-113   Pyrus x bretschneideri [bai li]
ref|XP_004228514.1|  PREDICTED: NAD(H) kinase 1                         349   7e-113   Solanum lycopersicum
ref|XP_002513516.1|  poly(p)/ATP NAD kinase, putative                   348   8e-113   Ricinus communis
ref|XP_006365622.1|  PREDICTED: probable NAD kinase 1-like              348   1e-112   Solanum tuberosum [potatoes]
gb|KHG26120.1|  NAD (H) kinase 1 -like protein                          345   1e-112   Gossypium arboreum [tree cotton]
ref|XP_008450412.1|  PREDICTED: NAD(H) kinase 1                         348   1e-112   Cucumis melo [Oriental melon]
ref|XP_004505640.1|  PREDICTED: NAD(H) kinase 1-like                    347   2e-112   Cicer arietinum [garbanzo]
ref|XP_004139039.1|  PREDICTED: NAD(H) kinase 1                         347   2e-112   Cucumis sativus [cucumbers]
gb|AFN88238.1|  NADH kinase                                             337   2e-112   Vigna luteola
ref|XP_009366086.1|  PREDICTED: probable NAD kinase 1 isoform X3        345   3e-112   
ref|XP_009366084.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         348   3e-112   Pyrus x bretschneideri [bai li]
gb|KJB35763.1|  hypothetical protein B456_006G127100                    343   7e-112   Gossypium raimondii
ref|XP_002314082.2|  ATP-NAD kinase family protein                      346   7e-112   Populus trichocarpa [western balsam poplar]
ref|XP_007015104.1|  NAD kinase 1 isoform 3                             343   8e-112   
ref|XP_011032051.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         346   9e-112   Populus euphratica
ref|XP_003540253.1|  PREDICTED: NAD(H) kinase 1-like                    345   1e-111   Glycine max [soybeans]
gb|KJB35767.1|  hypothetical protein B456_006G127100                    345   1e-111   Gossypium raimondii
gb|KJB35761.1|  hypothetical protein B456_006G127100                    344   1e-111   Gossypium raimondii
gb|KHN05513.1|  NAD(H) kinase 1                                         345   1e-111   Glycine soja [wild soybean]
ref|XP_003537731.1|  PREDICTED: NAD(H) kinase 1                         345   2e-111   Glycine max [soybeans]
gb|KHN20637.1|  NAD(H) kinase 1                                         344   2e-111   Glycine soja [wild soybean]
ref|XP_007015102.1|  NAD kinase 1 isoform 1                             345   2e-111   
ref|XP_007015105.1|  NAD(H) kinase 1 isoform 4                          342   3e-111   
gb|KJB35768.1|  hypothetical protein B456_006G127100                    344   4e-111   Gossypium raimondii
gb|KJB35762.1|  hypothetical protein B456_006G127100                    344   5e-111   Gossypium raimondii
ref|XP_011032050.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         345   5e-111   Populus euphratica
gb|KJB35765.1|  hypothetical protein B456_006G127100                    344   6e-111   Gossypium raimondii
gb|AFS49950.1|  NADH kinase                                             343   1e-110   Vigna luteola
ref|XP_010102369.1|  NAD(H) kinase 1                                    343   1e-110   
ref|XP_010545595.1|  PREDICTED: NAD(H) kinase 1 isoform X2              343   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010545596.1|  PREDICTED: NAD(H) kinase 1 isoform X3              340   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010031772.1|  PREDICTED: NAD(H) kinase 1                         342   2e-110   Eucalyptus grandis [rose gum]
ref|XP_010673682.1|  PREDICTED: NAD(H) kinase 1                         342   2e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006844879.1|  PREDICTED: putative NAD kinase 3                   342   2e-110   Amborella trichopoda
gb|KJB35764.1|  hypothetical protein B456_006G127100                    344   3e-110   Gossypium raimondii
ref|XP_007131550.1|  hypothetical protein PHAVU_011G022700g             340   4e-110   Phaseolus vulgaris [French bean]
gb|EYU46237.1|  hypothetical protein MIMGU_mgv1a004572mg                341   5e-110   Erythranthe guttata [common monkey flower]
ref|XP_012090710.1|  PREDICTED: NAD(H) kinase 1-like                    333   5e-110   
ref|XP_010246730.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         340   8e-110   Nelumbo nucifera [Indian lotus]
gb|KJB55385.1|  hypothetical protein B456_009G073700                    337   9e-110   Gossypium raimondii
gb|KJB55387.1|  hypothetical protein B456_009G073700                    339   1e-109   Gossypium raimondii
ref|XP_010545594.1|  PREDICTED: NAD(H) kinase 1 isoform X1              342   1e-109   Tarenaya hassleriana [spider flower]
gb|KJB55384.1|  hypothetical protein B456_009G073700                    337   1e-109   Gossypium raimondii
ref|XP_002285357.1|  PREDICTED: NAD(H) kinase 1 isoform X3              340   1e-109   Vitis vinifera
ref|XP_010269765.1|  PREDICTED: putative NAD kinase 3 isoform X1        340   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010246729.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         339   3e-109   Nelumbo nucifera [Indian lotus]
gb|KJB55386.1|  hypothetical protein B456_009G073700                    339   3e-109   Gossypium raimondii
ref|XP_007131551.1|  hypothetical protein PHAVU_011G022700g             340   4e-109   Phaseolus vulgaris [French bean]
gb|KFK39415.1|  hypothetical protein AALP_AA3G241900                    338   6e-109   Arabis alpina [alpine rockcress]
ref|XP_010651223.1|  PREDICTED: NAD(H) kinase 1 isoform X4              337   6e-109   Vitis vinifera
ref|XP_002885418.1|  hypothetical protein ARALYDRAFT_342253             338   6e-109   
ref|XP_002298393.2|  hypothetical protein POPTR_0001s26330g             336   7e-109   
ref|XP_003607363.1|  NAD(H) kinase                                      338   7e-109   Medicago truncatula
ref|XP_012090029.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         338   8e-109   
ref|XP_010651218.1|  PREDICTED: NAD(H) kinase 1 isoform X2              339   1e-108   Vitis vinifera
ref|XP_006446153.1|  hypothetical protein CICLE_v10014881mg             332   1e-108   
ref|XP_010651217.1|  PREDICTED: NAD(H) kinase 1 isoform X1              339   1e-108   Vitis vinifera
ref|XP_011045416.1|  PREDICTED: NAD(H) kinase 1-like isoform X3         337   2e-108   Populus euphratica
gb|KDP22112.1|  hypothetical protein JCGZ_25943                         338   2e-108   Jatropha curcas
ref|XP_011013831.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         337   2e-108   Populus euphratica
ref|XP_012090028.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         338   2e-108   Jatropha curcas
ref|XP_011045414.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         338   2e-108   Populus euphratica
ref|XP_011045415.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         337   3e-108   Populus euphratica
ref|XP_011013830.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         337   3e-108   Populus euphratica
ref|XP_010938543.1|  PREDICTED: probable NAD kinase 1                   335   1e-107   Elaeis guineensis
ref|XP_008782033.1|  PREDICTED: probable NAD kinase 1                   335   2e-107   Phoenix dactylifera
gb|EMT15186.1|  Putative NAD kinase 1                                   333   2e-107   
ref|XP_010509651.1|  PREDICTED: NAD(H) kinase 1-like                    335   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010488093.1|  PREDICTED: NAD(H) kinase 1                         334   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006470641.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         335   2e-107   Citrus sinensis [apfelsine]
ref|XP_010466324.1|  PREDICTED: NAD(H) kinase 1-like                    334   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006446154.1|  hypothetical protein CICLE_v10014881mg             334   4e-107   
gb|EMS47657.1|  putative NAD kinase 1                                   333   1e-106   Triticum urartu
ref|XP_006297412.1|  hypothetical protein CARUB_v10013436mg             332   2e-106   Capsella rubella
ref|XP_006470640.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         333   2e-106   Citrus sinensis [apfelsine]
ref|XP_006646694.1|  PREDICTED: probable NAD kinase 1-like              333   2e-106   Oryza brachyantha
dbj|BAD94003.1|  hypothetical protein                                   322   4e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37318.1|  BnaA01g25380D                                          331   5e-106   Brassica napus [oilseed rape]
ref|XP_009109957.1|  PREDICTED: NAD(H) kinase 1-like                    331   6e-106   Brassica rapa
emb|CDY27547.1|  BnaC01g32300D                                          330   7e-106   Brassica napus [oilseed rape]
ref|NP_001045444.2|  Os01g0957000                                       330   1e-105   
dbj|BAB01450.1|  unnamed protein product                                328   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|ACG29339.1|  NAD kinase 1                                            331   1e-105   Zea mays [maize]
ref|NP_001278550.1|  NAD kinase 1                                       331   1e-105   Zea mays [maize]
gb|EEC72189.1|  hypothetical protein OsI_05264                          331   2e-105   Oryza sativa Indica Group [Indian rice]
gb|EEE56031.1|  hypothetical protein OsJ_04817                          331   2e-105   Oryza sativa Japonica Group [Japonica rice]
ref|NP_188744.3|  NAD(H) kinase 1                                       329   2e-105   
ref|NP_974347.1|  NAD(H) kinase 1                                       329   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567496.2|  PREDICTED: probable NAD kinase 1                   330   3e-105   Brachypodium distachyon [annual false brome]
ref|XP_004971313.1|  PREDICTED: probable NAD kinase 1-like              330   5e-105   Setaria italica
dbj|BAJ98826.1|  predicted protein                                      332   5e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM13987.1|  unknown protein                                         329   6e-105   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71079.1|  hypothetical protein M569_03679                         327   7e-105   Genlisea aurea
ref|XP_009391539.1|  PREDICTED: putative NAD kinase 3                   328   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA55769.1|  TPA: NAD kinase 1                                      328   1e-104   
ref|XP_006406326.1|  hypothetical protein EUTSA_v10020469mg             327   2e-104   
ref|XP_002459132.1|  hypothetical protein SORBIDRAFT_03g046360          325   2e-104   
ref|XP_006406328.1|  hypothetical protein EUTSA_v10020469mg             326   5e-104   
ref|NP_001151954.1|  NAD kinase 1                                       327   7e-104   Zea mays [maize]
ref|XP_004962206.1|  PREDICTED: putative NAD kinase 3-like isofor...    324   3e-103   Setaria italica
emb|CDY32402.1|  BnaC03g41860D                                          324   3e-103   Brassica napus [oilseed rape]
ref|XP_004962207.1|  PREDICTED: putative NAD kinase 3-like isofor...    323   4e-103   Setaria italica
emb|CDX82219.1|  BnaA03g36020D                                          323   6e-103   
ref|XP_009145525.1|  PREDICTED: NAD(H) kinase 1                         322   1e-102   Brassica rapa
gb|EEC79147.1|  hypothetical protein OsI_19811                          318   3e-102   Oryza sativa Indica Group [Indian rice]
gb|AAV31342.1|  unknown protein                                         318   3e-102   Oryza sativa Japonica Group [Japonica rice]
emb|CDY06405.1|  BnaC05g31250D                                          321   3e-102   
ref|XP_009135723.1|  PREDICTED: NAD(H) kinase 1-like                    320   8e-102   Brassica rapa
sp|Q60E60.2|NADK3_ORYSJ  RecName: Full=Putative NAD kinase 3            318   2e-101   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60742.1|  Putative NAD kinase 3                                   318   2e-101   Triticum urartu
ref|XP_010231463.1|  PREDICTED: putative NAD kinase 3 isoform X1        320   3e-101   Brachypodium distachyon [annual false brome]
ref|XP_003568558.1|  PREDICTED: putative NAD kinase 3 isoform X2        319   4e-101   Brachypodium distachyon [annual false brome]
ref|XP_006655275.1|  PREDICTED: putative NAD kinase 3-like              317   8e-101   Oryza brachyantha
gb|EMT20687.1|  Putative NAD kinase 3                                   317   1e-99    
ref|XP_002439730.1|  hypothetical protein SORBIDRAFT_09g019130          310   3e-98    
emb|CAN64916.1|  hypothetical protein VITISV_023722                     280   2e-86    Vitis vinifera
ref|XP_001762814.1|  predicted protein                                  274   2e-84    
ref|XP_001765616.1|  predicted protein                                  266   4e-81    
gb|KCW51159.1|  hypothetical protein EUGRSUZ_J00751                     246   2e-75    Eucalyptus grandis [rose gum]
ref|XP_002965137.1|  hypothetical protein SELMODRAFT_83370              242   2e-73    
ref|XP_002962223.1|  hypothetical protein SELMODRAFT_76799              241   3e-73    
ref|XP_001758345.1|  predicted protein                                  244   4e-73    
ref|XP_010031773.1|  PREDICTED: putative NAD kinase 3 isoform X1        248   1e-72    Eucalyptus grandis [rose gum]
ref|XP_010031774.1|  PREDICTED: putative NAD kinase 3 isoform X2        248   1e-72    Eucalyptus grandis [rose gum]
gb|KCW51160.1|  hypothetical protein EUGRSUZ_J00752                     237   2e-72    Eucalyptus grandis [rose gum]
gb|EYU31388.1|  hypothetical protein MIMGU_mgv1a004907mg                242   6e-72    Erythranthe guttata [common monkey flower]
ref|XP_002963632.1|  hypothetical protein SELMODRAFT_80525              234   9e-71    
ref|XP_010034271.1|  PREDICTED: NAD(H) kinase 1-like                    238   1e-70    
ref|XP_002949486.1|  hypothetical protein VOLCADRAFT_59341              229   2e-70    Volvox carteri f. nagariensis
ref|XP_001703150.1|  hypothetical protein CHLREDRAFT_123446             227   3e-70    Chlamydomonas reinhardtii
ref|NP_001174403.1|  Os05g0388400                                       189   4e-56    
gb|KIZ05631.1|  NAD+ kinase                                             204   6e-56    Monoraphidium neglectum
ref|XP_005709105.1|  NAD+ kinase                                        196   1e-54    Galdieria sulphuraria
ref|XP_011401621.1|  putative NAD kinase 1                              196   3e-53    Auxenochlorella protothecoides
ref|XP_005708614.1|  NAD+ kinase                                        195   6e-53    Galdieria sulphuraria
gb|KDD75385.1|  ATP-NAD kinase                                          183   1e-52    Helicosporidium sp. ATCC 50920
ref|XP_005714258.1|  unnamed protein product                            189   1e-52    Chondrus crispus [carageen]
ref|XP_005715738.1|  unnamed protein product                            193   2e-52    Chondrus crispus [carageen]
ref|XP_004997035.1|  poly(p)/ATP nad kinase                             191   1e-51    Salpingoeca rosetta
ref|XP_001637014.1|  predicted protein                                  184   3e-51    Nematostella vectensis
gb|KFM72467.1|  hypothetical protein X975_06244                         185   3e-51    Stegodyphus mimosarum
ref|XP_001654785.1|  AAEL000278-PA                                      184   7e-51    
ref|XP_001995437.1|  GH22631                                            184   1e-50    Drosophila grimshawi
ref|XP_011876642.1|  PREDICTED: NAD kinase-like isoform X9              183   1e-50    Vollenhovia emeryi
gb|EFX83515.1|  hypothetical protein DAPPUDRAFT_187852                  182   1e-50    Daphnia pulex
ref|XP_011876641.1|  PREDICTED: NAD kinase-like isoform X8              183   1e-50    Vollenhovia emeryi
ref|XP_006564945.1|  PREDICTED: NAD kinase-like isoform X10             183   1e-50    
ref|XP_006564943.1|  PREDICTED: NAD kinase-like isoform X8              184   1e-50    Apis mellifera [bee]
ref|XP_011876640.1|  PREDICTED: NAD kinase-like isoform X7              184   1e-50    Vollenhovia emeryi
ref|XP_011876637.1|  PREDICTED: NAD kinase-like isoform X4              184   2e-50    Vollenhovia emeryi
ref|XP_006564944.1|  PREDICTED: NAD kinase-like isoform X9              183   2e-50    
ref|XP_011876639.1|  PREDICTED: NAD kinase-like isoform X6              184   2e-50    Vollenhovia emeryi
ref|XP_002058882.1|  GJ19672                                            184   2e-50    Drosophila virilis
ref|XP_629620.1|  NAD+ kinase family protein                            188   2e-50    Dictyostelium discoideum AX4
ref|XP_006564942.1|  PREDICTED: NAD kinase-like isoform X7              183   2e-50    
ref|XP_392018.3|  PREDICTED: NAD kinase-like isoformX1                  183   2e-50    Apis mellifera [bee]
ref|XP_002006911.1|  GI21327                                            183   2e-50    
ref|XP_008470542.1|  PREDICTED: NAD kinase-like isoform X12             182   2e-50    
ref|XP_011058884.1|  PREDICTED: NAD kinase-like isoform X6              182   3e-50    Acromyrmex echinatior
ref|XP_001868717.1|  poly(p)/ATP NAD kinase                             184   3e-50    Culex quinquefasciatus
ref|XP_011876638.1|  PREDICTED: NAD kinase-like isoform X5              183   3e-50    Vollenhovia emeryi
ref|XP_006564937.1|  PREDICTED: NAD kinase-like isoform X2              184   3e-50    
ref|XP_011253171.1|  PREDICTED: NAD kinase isoform X9                   181   3e-50    
ref|XP_011696113.1|  PREDICTED: NAD kinase-like isoform X10             181   3e-50    Wasmannia auropunctata
ref|XP_011161171.1|  PREDICTED: NAD kinase-like isoform X7              181   4e-50    Solenopsis invicta [imported red fire ant]
ref|XP_002424361.1|  NADH kinase, putative                              183   4e-50    Pediculus humanus corporis [human body lice]
ref|XP_012139742.1|  PREDICTED: NAD kinase-like isoform X9              181   4e-50    Megachile rotundata
ref|XP_012139743.1|  PREDICTED: NAD kinase-like isoform X10             181   4e-50    Megachile rotundata
ref|XP_011058883.1|  PREDICTED: NAD kinase-like isoform X5              182   4e-50    Acromyrmex echinatior
ref|XP_011058880.1|  PREDICTED: NAD kinase-like isoform X3              183   4e-50    Acromyrmex echinatior
ref|XP_004517712.1|  PREDICTED: NAD kinase-like isoform X5              182   5e-50    Ceratitis capitata [medfly]
ref|XP_004517709.1|  PREDICTED: NAD kinase-like isoform X2              186   5e-50    
ref|XP_008470541.1|  PREDICTED: NAD kinase-like isoform X11             181   5e-50    
ref|XP_011058881.1|  PREDICTED: NAD kinase-like isoform X4              182   5e-50    Acromyrmex echinatior
ref|XP_012060592.1|  PREDICTED: NAD kinase-like isoform X2              182   5e-50    Atta cephalotes
ref|XP_006564938.1|  PREDICTED: NAD kinase-like isoform X3              183   6e-50    Apis mellifera [bee]
ref|XP_011253170.1|  PREDICTED: NAD kinase isoform X8                   181   6e-50    
gb|EFZ17327.1|  hypothetical protein SINV_04986                         181   7e-50    
ref|XP_006615106.1|  PREDICTED: NAD kinase-like isoform X2              182   7e-50    Apis dorsata [rock honeybee]
ref|XP_011876633.1|  PREDICTED: NAD kinase-like isoform X1              183   7e-50    Vollenhovia emeryi
ref|XP_011161170.1|  PREDICTED: NAD kinase-like isoform X6              181   7e-50    Solenopsis invicta [imported red fire ant]
ref|XP_008470539.1|  PREDICTED: NAD kinase-like isoform X9              182   7e-50    
ref|XP_011876636.1|  PREDICTED: NAD kinase-like isoform X3              182   7e-50    Vollenhovia emeryi
ref|XP_003488899.1|  PREDICTED: NAD kinase-like                         182   8e-50    Bombus impatiens
ref|XP_011161169.1|  PREDICTED: NAD kinase-like isoform X5              182   8e-50    Solenopsis invicta [imported red fire ant]
ref|XP_012139741.1|  PREDICTED: NAD kinase-like isoform X8              181   8e-50    Megachile rotundata
ref|XP_011696112.1|  PREDICTED: NAD kinase-like isoform X9              181   8e-50    Wasmannia auropunctata
ref|XP_008470540.1|  PREDICTED: NAD kinase-like isoform X10             181   8e-50    Diaphorina citri
ref|XP_011696109.1|  PREDICTED: NAD kinase-like isoform X6              182   8e-50    Wasmannia auropunctata
ref|XP_011634034.1|  PREDICTED: NAD kinase-like isoform X6              182   8e-50    Pogonomyrmex barbatus
ref|XP_011253167.1|  PREDICTED: NAD kinase isoform X5                   182   8e-50    
ref|XP_002590542.1|  hypothetical protein BRAFLDRAFT_124524             181   8e-50    Branchiostoma floridae
ref|XP_011253168.1|  PREDICTED: NAD kinase isoform X6                   181   8e-50    
ref|XP_008470538.1|  PREDICTED: NAD kinase-like isoform X8              182   9e-50    Diaphorina citri
ref|XP_008206815.1|  PREDICTED: NAD kinase-like isoform X10             180   9e-50    Nasonia vitripennis
gb|KFB51324.1|  AGAP011122-PA-like protein                              185   9e-50    Anopheles sinensis
ref|XP_011634031.1|  PREDICTED: NAD kinase-like isoform X4              182   9e-50    Pogonomyrmex barbatus
ref|XP_011634036.1|  PREDICTED: NAD kinase-like isoform X7              181   1e-49    Pogonomyrmex barbatus
ref|XP_011161167.1|  PREDICTED: NAD kinase-like isoform X3              182   1e-49    Solenopsis invicta [imported red fire ant]
ref|XP_011161168.1|  PREDICTED: NAD kinase-like isoform X4              181   1e-49    Solenopsis invicta [imported red fire ant]
ref|XP_011495464.1|  PREDICTED: NAD kinase-like isoform X8              180   1e-49    Ceratosolen solmsi marchali
ref|XP_012139740.1|  PREDICTED: NAD kinase-like isoform X7              181   1e-49    Megachile rotundata
ref|XP_011696110.1|  PREDICTED: NAD kinase-like isoform X7              181   1e-49    Wasmannia auropunctata
ref|XP_011148641.1|  PREDICTED: NAD kinase-like isoform X8              180   1e-49    Harpegnathos saltator
ref|XP_011253169.1|  PREDICTED: NAD kinase isoform X7                   181   1e-49    
ref|XP_011148643.1|  PREDICTED: NAD kinase-like isoform X10             180   1e-49    Harpegnathos saltator
ref|XP_012139737.1|  PREDICTED: NAD kinase-like isoform X5              181   1e-49    Megachile rotundata
ref|XP_011696111.1|  PREDICTED: NAD kinase-like isoform X8              181   1e-49    Wasmannia auropunctata
ref|XP_011253165.1|  PREDICTED: NAD kinase isoform X3                   182   1e-49    
ref|XP_003291185.1|  hypothetical protein DICPUDRAFT_155765             186   1e-49    Dictyostelium purpureum
ref|XP_011696106.1|  PREDICTED: NAD kinase-like isoform X4              182   1e-49    Wasmannia auropunctata
ref|XP_012139738.1|  PREDICTED: NAD kinase-like isoform X6              181   1e-49    Megachile rotundata
ref|XP_011696107.1|  PREDICTED: NAD kinase-like isoform X5              181   1e-49    Wasmannia auropunctata
ref|XP_011253166.1|  PREDICTED: NAD kinase isoform X4                   181   1e-49    
ref|XP_011634032.1|  PREDICTED: NAD kinase-like isoform X5              181   1e-49    Pogonomyrmex barbatus
ref|XP_002063997.1|  GK15608                                            182   1e-49    
ref|XP_003702819.1|  PREDICTED: NAD kinase-like isoform X4              181   1e-49    Megachile rotundata
ref|XP_005537945.1|  hypothetical protein, conserved                    183   1e-49    Cyanidioschyzon merolae strain 10D
ref|XP_011297427.1|  PREDICTED: NAD kinase-like isoform X2              181   1e-49    Fopius arisanus
ref|XP_003426645.1|  PREDICTED: NAD kinase-like isoform X9              180   2e-49    Nasonia vitripennis
ref|XP_011058878.1|  PREDICTED: NAD kinase-like isoform X1              181   2e-49    Acromyrmex echinatior
dbj|BAM19258.1|  poly(p)/ATP NAD kinase                                 181   2e-49    Papilio polytes
ref|XP_012060591.1|  PREDICTED: NAD kinase-like isoform X1              181   2e-49    Atta cephalotes
ref|XP_011436211.1|  PREDICTED: NAD kinase-like isoform X4              179   2e-49    Crassostrea gigas
ref|XP_011346933.1|  PREDICTED: NAD kinase-like isoform X7              180   2e-49    Ooceraea biroi
ref|XP_008550791.1|  PREDICTED: NAD kinase isoform X6                   179   2e-49    Microplitis demolitor
ref|XP_004517711.1|  PREDICTED: NAD kinase-like isoform X4              182   2e-49    Ceratitis capitata [medfly]
ref|XP_004517710.1|  PREDICTED: NAD kinase-like isoform X3              182   2e-49    Ceratitis capitata [medfly]
ref|XP_011148640.1|  PREDICTED: NAD kinase-like isoform X7              179   2e-49    
ref|XP_012139732.1|  PREDICTED: NAD kinase-like isoform X1              181   2e-49    Megachile rotundata
ref|XP_011253163.1|  PREDICTED: NAD kinase isoform X1                   181   2e-49    
ref|XP_011346928.1|  PREDICTED: NAD kinase-like isoform X6              180   2e-49    Ooceraea biroi
ref|XP_008470537.1|  PREDICTED: NAD kinase-like isoform X7              181   2e-49    Diaphorina citri
ref|XP_003426644.1|  PREDICTED: NAD kinase-like isoform X5              180   3e-49    Nasonia vitripennis
gb|AHK10563.1|  NADK protein 1                                          179   3e-49    Bombyx mori [silk moth]
ref|XP_008206813.1|  PREDICTED: NAD kinase-like isoform X7              180   3e-49    Nasonia vitripennis
ref|XP_008470536.1|  PREDICTED: NAD kinase-like isoform X6              181   3e-49    
ref|XP_003426643.1|  PREDICTED: NAD kinase-like isoform X3              181   3e-49    Nasonia vitripennis
ref|XP_011495448.1|  PREDICTED: NAD kinase-like isoform X6              180   3e-49    Ceratosolen solmsi marchali
ref|XP_008550793.1|  PREDICTED: NAD kinase isoform X7                   179   3e-49    Microplitis demolitor
ref|XP_011161165.1|  PREDICTED: NAD kinase-like isoform X1              181   3e-49    Solenopsis invicta [imported red fire ant]
ref|XP_008470535.1|  PREDICTED: NAD kinase-like isoform X5              181   3e-49    Diaphorina citri
ref|XP_011495457.1|  PREDICTED: NAD kinase-like isoform X7              180   3e-49    Ceratosolen solmsi marchali
ref|XP_011148639.1|  PREDICTED: NAD kinase-like isoform X6              179   3e-49    Harpegnathos saltator
ref|XP_011346905.1|  PREDICTED: NAD kinase-like isoform X3              181   3e-49    Ooceraea biroi
ref|XP_012139734.1|  PREDICTED: NAD kinase-like isoform X3              181   3e-49    Megachile rotundata
ref|XP_011696104.1|  PREDICTED: NAD kinase-like isoform X3              181   3e-49    Wasmannia auropunctata
ref|XP_011148637.1|  PREDICTED: NAD kinase-like isoform X5              179   3e-49    
ref|XP_011495423.1|  PREDICTED: NAD kinase-like isoform X3              180   3e-49    Ceratosolen solmsi marchali
dbj|GAM20126.1|  hypothetical protein SAMD00019534_033010               181   3e-49    Acytostelium subglobosum LB1
ref|XP_011297432.1|  PREDICTED: NAD kinase-like isoform X5              180   4e-49    Fopius arisanus
gb|EKC35723.1|  NAD kinase                                              179   4e-49    Crassostrea gigas
ref|XP_008206812.1|  PREDICTED: NAD kinase-like isoform X6              179   4e-49    Nasonia vitripennis
ref|XP_011297438.1|  PREDICTED: NAD kinase-like isoform X11             178   4e-49    Fopius arisanus
ref|XP_011297437.1|  PREDICTED: NAD kinase-like isoform X10             178   4e-49    Fopius arisanus
ref|XP_011436210.1|  PREDICTED: NAD kinase-like isoform X3              179   4e-49    Crassostrea gigas
ref|XP_008470534.1|  PREDICTED: NAD kinase-like isoform X4              181   4e-49    Diaphorina citri
ref|XP_004347505.2|  poly(p)/ATP nad kinase                             183   4e-49    Capsaspora owczarzaki ATCC 30864
ref|XP_008206814.1|  PREDICTED: NAD kinase-like isoform X8              179   4e-49    Nasonia vitripennis
ref|XP_011148636.1|  PREDICTED: NAD kinase-like isoform X4              179   5e-49    Harpegnathos saltator
ref|XP_011346919.1|  PREDICTED: NAD kinase-like isoform X5              179   5e-49    
ref|XP_011495441.1|  PREDICTED: NAD kinase-like isoform X5              179   5e-49    Ceratosolen solmsi marchali
ref|XP_011346911.1|  PREDICTED: NAD kinase-like isoform X4              180   5e-49    
ref|XP_008550788.1|  PREDICTED: NAD kinase isoform X3                   179   5e-49    
gb|KJE94057.1|  poly(p)/ATP nad kinase                                  183   5e-49    
ref|XP_008206810.1|  PREDICTED: NAD kinase-like isoform X4              180   6e-49    
ref|XP_008550786.1|  PREDICTED: NAD kinase isoform X1                   179   6e-49    
ref|XP_011634028.1|  PREDICTED: NAD kinase-like isoform X1              181   6e-49    
ref|XP_008550789.1|  PREDICTED: NAD kinase isoform X4                   179   6e-49    
gb|ENN83176.1|  hypothetical protein YQE_00464                          176   6e-49    
ref|XP_011696102.1|  PREDICTED: NAD kinase-like isoform X1              181   6e-49    
ref|XP_011148634.1|  PREDICTED: NAD kinase-like isoform X3              179   6e-49    
gb|EHJ64249.1|  hypothetical protein KGM_07251                          179   6e-49    
ref|XP_008550790.1|  PREDICTED: NAD kinase isoform X5                   179   7e-49    
ref|XP_008197010.1|  PREDICTED: NAD kinase-like isoform X2              180   7e-49    
ref|XP_011634030.1|  PREDICTED: NAD kinase-like isoform X3              180   8e-49    
ref|XP_004926313.1|  PREDICTED: NAD kinase-like isoform X3              179   8e-49    
ref|XP_011297436.1|  PREDICTED: NAD kinase-like isoform X9              178   8e-49    
ref|XP_309524.4|  AGAP011122-PA                                         181   8e-49    
ref|XP_004926311.1|  PREDICTED: NAD kinase-like isoform X1              179   8e-49    
ref|XP_011346883.1|  PREDICTED: NAD kinase-like isoform X1              179   9e-49    
ref|XP_011148630.1|  PREDICTED: NAD kinase-like isoform X1              179   9e-49    
ref|XP_011495407.1|  PREDICTED: NAD kinase-like isoform X1              179   9e-49    
ref|XP_008550787.1|  PREDICTED: NAD kinase isoform X2                   179   9e-49    
ref|XP_011058879.1|  PREDICTED: NAD kinase-like isoform X2              179   9e-49    
gb|ENN83177.1|  hypothetical protein YQE_00464                          176   1e-48    
ref|XP_011297433.1|  PREDICTED: NAD kinase-like isoform X6              179   1e-48    
ref|XP_011436209.1|  PREDICTED: NAD kinase-like isoform X2              180   1e-48    
ref|XP_008470530.1|  PREDICTED: NAD kinase-like isoform X1              181   1e-48    
ref|XP_011297434.1|  PREDICTED: NAD kinase-like isoform X7              178   1e-48    
ref|XP_003400589.1|  PREDICTED: LOW QUALITY PROTEIN: NAD kinase-like    179   1e-48    
ref|XP_011876635.1|  PREDICTED: NAD kinase-like isoform X2              180   1e-48    
ref|XP_011436208.1|  PREDICTED: NAD kinase-like isoform X1              180   1e-48    
ref|XP_001601214.2|  PREDICTED: NAD kinase-like isoform X1              179   1e-48    
ref|XP_011297426.1|  PREDICTED: NAD kinase-like isoform X1              179   1e-48    
ref|XP_011297435.1|  PREDICTED: NAD kinase-like isoform X8              178   1e-48    
ref|XP_011557335.1|  PREDICTED: NAD kinase-like isoform X6              177   1e-48    
ref|XP_012139733.1|  PREDICTED: NAD kinase-like isoform X2              179   1e-48    
ref|XP_011297428.1|  PREDICTED: NAD kinase-like isoform X3              178   1e-48    
gb|EFA08909.1|  hypothetical protein TcasGA2_TC006614                   181   2e-48    
ref|XP_004180404.1|  hypothetical protein TBLA_0D03860                  180   2e-48    
gb|EFN78480.1|  NAD kinase                                              179   2e-48    
ref|XP_004517708.1|  PREDICTED: NAD kinase-like isoform X1              181   2e-48    
ref|XP_008470531.1|  PREDICTED: NAD kinase-like isoform X2              179   2e-48    
ref|XP_011557334.1|  PREDICTED: NAD kinase-like isoform X5              177   3e-48    
ref|XP_011297431.1|  PREDICTED: NAD kinase-like isoform X4              177   3e-48    
ref|XP_011206557.1|  PREDICTED: NAD kinase isoform X3                   179   3e-48    
ref|XP_011557333.1|  PREDICTED: NAD kinase-like isoform X4              177   3e-48    
ref|XP_011634029.1|  PREDICTED: NAD kinase-like isoform X2              178   4e-48    
ref|XP_011206556.1|  PREDICTED: NAD kinase isoform X2                   178   4e-48    
ref|XP_002405188.1|  sugar kinase, putative                             175   4e-48    
ref|XP_011557332.1|  PREDICTED: NAD kinase-like isoform X3              177   4e-48    
ref|XP_011179408.1|  PREDICTED: NAD kinase isoform X2                   178   5e-48    
ref|XP_001421403.1|  predicted protein                                  171   5e-48    
ref|XP_011179409.1|  PREDICTED: NAD kinase isoform X3                   178   5e-48    
ref|XP_007237105.1|  PREDICTED: NAD kinase isoform X3                   176   5e-48    
gb|ENN71205.1|  hypothetical protein YQE_12134                          177   6e-48    
emb|CDQ76872.1|  unnamed protein product                                175   7e-48    
ref|XP_011253164.1|  PREDICTED: NAD kinase isoform X2                   177   7e-48    
ref|XP_004354275.1|  NAD+ kinase family protein                         180   8e-48    
ref|XP_005187084.1|  PREDICTED: NAD kinase-like                         179   8e-48    
ref|XP_011696103.1|  PREDICTED: NAD kinase-like isoform X2              178   9e-48    
ref|XP_011557330.1|  PREDICTED: NAD kinase-like isoform X1              177   1e-47    
ref|XP_011495432.1|  PREDICTED: NAD kinase-like isoform X4              176   1e-47    
ref|XP_005459917.1|  PREDICTED: NAD kinase-like isoform X4              175   1e-47    
ref|XP_001942930.2|  PREDICTED: NAD kinase-like isoform X8              177   1e-47    
gb|KDN46418.1|  hypothetical protein RSAG8_04362                        179   2e-47    
gb|AHK10564.1|  NADK protein 2                                          174   2e-47    
ref|XP_007137471.1|  hypothetical protein PHAVU_009G129600g             172   2e-47    
ref|XP_008470533.1|  PREDICTED: NAD kinase-like isoform X3              177   2e-47    
ref|XP_007237104.1|  PREDICTED: NAD kinase isoform X2                   176   2e-47    
ref|XP_007237103.1|  PREDICTED: NAD kinase isoform X1                   176   2e-47    
ref|XP_006662794.1|  PREDICTED: probable NAD kinase 2, chloroplas...    180   2e-47    
ref|XP_008283302.1|  PREDICTED: NAD kinase isoform X2                   174   2e-47    
ref|XP_011179407.1|  PREDICTED: NAD kinase isoform X1                   178   3e-47    
ref|XP_008316652.1|  PREDICTED: NAD kinase isoform X2                   174   3e-47    
ref|XP_011206555.1|  PREDICTED: NAD kinase isoform X1                   178   3e-47    
ref|XP_005938190.1|  PREDICTED: NAD kinase-like isoform X2              174   3e-47    
ref|XP_004084851.1|  PREDICTED: NAD kinase                              172   3e-47    
ref|XP_011619531.1|  PREDICTED: NAD kinase isoform X2                   174   4e-47    
ref|XP_005459915.1|  PREDICTED: NAD kinase-like isoform X2              175   4e-47    
ref|XP_011495414.1|  PREDICTED: NAD kinase-like isoform X2              175   4e-47    
ref|XP_003426646.1|  PREDICTED: NAD kinase-like isoform X2              175   4e-47    
ref|XP_004926312.1|  PREDICTED: NAD kinase-like isoform X2              174   5e-47    
gb|EUC54932.1|  NAD+ kinase                                             178   5e-47    
ref|XP_002180250.1|  predicted protein                                  169   5e-47    
ref|XP_011346897.1|  PREDICTED: NAD kinase-like isoform X2              175   5e-47    
emb|CDQ59091.1|  unnamed protein product                                174   5e-47    
ref|XP_001421435.1|  predicted protein                                  171   6e-47    
gb|EEC67832.1|  hypothetical protein OsI_35426                          179   6e-47    
emb|CEL54168.1|  hypothetical protein RSOLAG1IB_06879                   178   6e-47    
ref|XP_008283301.1|  PREDICTED: NAD kinase isoform X1                   174   6e-47    
ref|XP_010873682.1|  PREDICTED: NAD kinase isoform X3                   174   6e-47    
ref|XP_003645856.1|  hypothetical protein Ecym_3568                     176   7e-47    
ref|XP_005459914.1|  PREDICTED: NAD kinase-like isoform X1              174   7e-47    
ref|XP_002955100.1|  hypothetical protein VOLCADRAFT_118925             173   8e-47    
ref|XP_008188401.1|  PREDICTED: NAD kinase-like isoform X7              172   8e-47    
gb|EEE51792.1|  hypothetical protein OsJ_33250                          179   9e-47    
ref|XP_008316650.1|  PREDICTED: NAD kinase isoform X1                   174   9e-47    
ref|XP_007408864.1|  hypothetical protein MELLADRAFT_35211              175   9e-47    
ref|XP_010732273.1|  PREDICTED: NAD kinase                              174   9e-47    
emb|CEG73383.1|  Putative NAD kinase                                    176   1e-46    
emb|CEI86482.1|  Putative NAD kinase                                    176   1e-46    
ref|XP_008411301.1|  PREDICTED: NAD kinase isoform X2                   172   1e-46    
ref|XP_003962996.1|  PREDICTED: NAD kinase isoform X1                   174   1e-46    
emb|CDP10994.1|  unnamed protein product                                175   1e-46    
ref|XP_007571273.1|  PREDICTED: NAD kinase isoform X2                   172   1e-46    
ref|XP_004657786.1|  PREDICTED: NAD kinase                              174   1e-46    
ref|XP_006688913.1|  hypothetical protein CANTEDRAFT_115449             176   1e-46    
ref|XP_010270284.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    179   1e-46    
gb|EMS23888.1|  NAD+ kinase                                             178   1e-46    
ref|XP_005800196.1|  PREDICTED: NAD kinase-like                         172   1e-46    
ref|XP_001642637.1|  hypothetical protein Kpol_370p7                    172   1e-46    
ref|XP_010270285.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    179   1e-46    
ref|XP_005938189.1|  PREDICTED: NAD kinase-like isoform X1              174   2e-46    
ref|XP_004571000.1|  PREDICTED: NAD kinase-like                         174   2e-46    
gb|EMS60307.1|  putative NAD kinase 2, chloroplastic                    178   2e-46    
ref|NP_001067415.1|  Os11g0191400                                       179   2e-46    
emb|CEI95497.1|  Putative NAD kinase                                    176   2e-46    
ref|XP_004978898.1|  PREDICTED: probable NAD kinase 2, chloroplas...    178   2e-46    
ref|XP_002506643.1|  nad-k like protein                                 178   2e-46    
ref|XP_004978897.1|  PREDICTED: probable NAD kinase 2, chloroplas...    178   2e-46    
ref|XP_008188400.1|  PREDICTED: NAD kinase-like isoform X6              172   2e-46    
ref|XP_006688912.1|  ATP-NAD kinase                                     176   2e-46    
ref|XP_008669783.1|  PREDICTED: probable NAD kinase 2, chloroplas...    178   3e-46    
ref|XP_008669784.1|  PREDICTED: probable NAD kinase 2, chloroplas...    178   3e-46    
ref|XP_011557331.1|  PREDICTED: NAD kinase-like isoform X2              173   3e-46    
ref|XP_007571271.1|  PREDICTED: NAD kinase isoform X1                   172   3e-46    
ref|XP_007396719.1|  hypothetical protein PHACADRAFT_257583             177   3e-46    
ref|XP_008411300.1|  PREDICTED: NAD kinase isoform X1                   172   3e-46    
gb|EMT29717.1|  Putative NAD kinase 2, chloroplastic                    178   3e-46    
dbj|BAJ87225.1|  predicted protein                                      178   3e-46    
gb|KIP06434.1|  hypothetical protein PHLGIDRAFT_106990                  177   3e-46    
gb|EFA76375.1|  NAD+ kinase family protein                              174   3e-46    
ref|XP_003248159.1|  PREDICTED: NAD kinase-like isoform X4              172   3e-46    
ref|XP_010269059.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    178   3e-46    
ref|XP_008188399.1|  PREDICTED: NAD kinase-like isoform X5              172   3e-46    
ref|XP_011398812.1|  NAD kinase 2, chloroplastic                        170   3e-46    
ref|XP_007225382.1|  hypothetical protein PRUPE_ppa000775mg             178   3e-46    
ref|XP_008219583.1|  PREDICTED: NAD kinase 2, chloroplastic             178   4e-46    
ref|XP_006680098.1|  hypothetical protein BATDEDRAFT_89943              173   4e-46    
ref|XP_007001998.1|  hypothetical protein TREMEDRAFT_70628              176   4e-46    
ref|XP_008346162.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...    177   4e-46    
ref|XP_001700866.1|  ATP-NAD kinase                                     173   4e-46    
ref|XP_010677593.1|  PREDICTED: NAD kinase 2, chloroplastic             177   4e-46    
ref|XP_008188398.1|  PREDICTED: NAD kinase-like isoform X3              172   5e-46    
ref|XP_008197013.1|  PREDICTED: NAD kinase-like isoform X5              171   5e-46    
emb|CCK71819.1|  hypothetical protein KNAG_0I00280                      174   5e-46    
gb|EPQ10808.1|  NAD kinase                                              172   6e-46    
gb|EPZ34265.1|  Inorganic polyphosphate/ATP-NAD kinase 1 domain-c...    171   6e-46    
gb|EMD37768.1|  hypothetical protein CERSUDRAFT_83539                   175   6e-46    
ref|XP_011148633.1|  PREDICTED: NAD kinase-like isoform X2              171   6e-46    
ref|XP_008149931.1|  PREDICTED: NAD kinase                              172   7e-46    
ref|XP_011102264.1|  PREDICTED: NAD kinase 2, chloroplastic             177   7e-46    
ref|XP_011161166.1|  PREDICTED: NAD kinase-like isoform X2              172   7e-46    
ref|XP_008197012.1|  PREDICTED: NAD kinase-like isoform X4              171   7e-46    
gb|ELK23632.1|  NAD kinase                                              172   7e-46    
gb|EYU32502.1|  hypothetical protein MIMGU_mgv1a001318mg                176   7e-46    
gb|KIM37802.1|  hypothetical protein M413DRAFT_448306                   176   7e-46    
ref|XP_009390073.1|  PREDICTED: probable NAD kinase 2, chloroplastic    177   8e-46    
ref|XP_002982512.1|  hypothetical protein SELMODRAFT_50863              174   8e-46    
gb|EIF49238.1|  nad kinase                                              167   8e-46    
gb|EDK41522.2|  hypothetical protein PGUG_05620                         172   8e-46    
ref|XP_009345587.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    177   8e-46    
ref|XP_002981035.1|  hypothetical protein SELMODRAFT_50862              174   8e-46    
ref|XP_009341032.1|  PREDICTED: NAD kinase 2, chloroplastic-like        177   8e-46    
ref|XP_002520312.1|  poly(p)/ATP NAD kinase, putative                   177   9e-46    
ref|XP_010063433.1|  PREDICTED: NAD kinase 2, chloroplastic             177   9e-46    
ref|XP_004292723.2|  PREDICTED: NAD kinase 2, chloroplastic             176   9e-46    
ref|XP_002291199.1|  inorganic polyphosphate/ATP-NAD kinase             166   9e-46    
ref|XP_001880233.1|  predicted protein                                  170   1e-45    
ref|XP_008197011.1|  PREDICTED: NAD kinase-like isoform X3              171   1e-45    
ref|XP_003680355.1|  hypothetical protein TDEL_0C02550                  173   1e-45    
ref|XP_008781613.1|  PREDICTED: probable NAD kinase 2, chloroplas...    176   1e-45    
ref|XP_010534748.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    175   1e-45    
ref|NP_001017580.1|  NAD kinase                                         171   1e-45    
gb|AAI65884.1|  Zgc:110083 protein                                      171   1e-45    
ref|XP_002449145.1|  hypothetical protein SORBIDRAFT_05g005750          176   1e-45    
ref|XP_573007.1|  NAD+ kinase                                           174   1e-45    
gb|KEH35344.1|  NAD/NADH kinase family protein                          175   1e-45    
ref|XP_008781614.1|  PREDICTED: probable NAD kinase 2, chloroplas...    176   1e-45    
ref|XP_008679651.1|  PREDICTED: probable NAD kinase 2, chloroplastic    176   1e-45    
ref|XP_008188396.1|  PREDICTED: NAD kinase-like isoform X1              172   1e-45    
gb|EPT02580.1|  hypothetical protein FOMPIDRAFT_1035802                 176   1e-45    
ref|XP_006642141.1|  PREDICTED: NAD kinase-like                         171   1e-45    
ref|XP_004498361.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    176   1e-45    
ref|XP_005110892.1|  PREDICTED: dentin sialophosphoprotein-like         176   1e-45    
ref|XP_003577753.1|  PREDICTED: probable NAD kinase 2, chloroplastic    176   2e-45    
gb|KIR81309.1|  NAD+ kinase                                             174   2e-45    
gb|AAD41416.1|AC007727_5  Similar to gb|X84260 POS5 gene product ...    175   2e-45    
ref|XP_008466760.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...    176   2e-45    
ref|XP_003195793.1|  NAD+ kinase                                        174   2e-45    
gb|KIR47409.1|  NAD+ kinase                                             174   2e-45    
ref|XP_005871351.1|  PREDICTED: NAD kinase isoform X1                   171   2e-45    
gb|KIR53448.1|  NAD+ kinase                                             174   2e-45    
ref|XP_003542143.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    176   2e-45    
gb|KIR62536.1|  NAD+ kinase                                             174   2e-45    
emb|CEP63099.1|  LALA0S07e02366g1_1                                     172   2e-45    
ref|XP_006772598.1|  PREDICTED: NAD kinase                              171   2e-45    
gb|EKC99604.1|  hypothetical protein A1Q2_06140                         175   2e-45    
ref|XP_007307844.1|  ATP-NAD kinase                                     174   2e-45    
ref|XP_003668400.1|  hypothetical protein NDAI_0B01230                  172   2e-45    
ref|XP_005648089.1|  ATP-NAD kinase                                     170   2e-45    
ref|XP_011403790.1|  PREDICTED: NAD kinase-like                         171   2e-45    
gb|KIR88304.1|  NAD+ kinase                                             174   2e-45    
gb|KHN38981.1|  NAD kinase 2, chloroplastic                             176   2e-45    
ref|XP_008197009.1|  PREDICTED: NAD kinase-like isoform X1              170   2e-45    
ref|XP_003544706.2|  PREDICTED: NAD kinase 2, chloroplastic-like ...    176   3e-45    
ref|XP_010521304.1|  PREDICTED: NAD kinase 2, chloroplastic-like        175   3e-45    
ref|XP_007266875.1|  ATP-NAD kinase                                     173   3e-45    
gb|KFK44265.1|  hypothetical protein AALP_AA1G235800                    175   3e-45    
gb|KIK09382.1|  hypothetical protein K443DRAFT_83514                    170   3e-45    
ref|XP_003677654.1|  hypothetical protein NCAS_0G04160                  171   3e-45    
ref|XP_012078316.1|  PREDICTED: NAD kinase 2, chloroplastic             175   3e-45    
gb|KEH40491.1|  NAD/NADH kinase family protein                          175   3e-45    
gb|KJB59305.1|  hypothetical protein B456_009G248800                    172   3e-45    
ref|XP_007381470.1|  ATP-NAD kinase                                     174   3e-45    
ref|XP_009627123.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    175   3e-45    
ref|XP_010534740.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...    175   4e-45    
ref|XP_009009131.1|  hypothetical protein HELRODRAFT_187858             169   4e-45    
ref|XP_010930698.1|  PREDICTED: probable NAD kinase 2, chloroplas...    175   4e-45    
ref|XP_005833010.1|  hypothetical protein GUITHDRAFT_163085             169   4e-45    
emb|CDO91778.1|  unnamed protein product                                171   4e-45    
ref|XP_010459879.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...    174   4e-45    



>ref|XP_008363346.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Malus domestica]
Length=519

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQGDGLILSTTSG
Sbjct  342  HVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQGDGLILSTTSG  401

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  402  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  461

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLAPGDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPRE+
Sbjct  462  GKDRKRLAPGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPREA  519



>ref|XP_009374927.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Pyrus x bretschneideri]
Length=519

 Score =   356 bits (914),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQGDGLILSTTSG
Sbjct  342  HVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQGDGLILSTTSG  401

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  402  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  461

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLAPGDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRK QSFDGPRE+
Sbjct  462  GKDRKRLAPGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKIQSFDGPREA  519



>ref|XP_008363343.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Malus domestica]
Length=565

 Score =   357 bits (917),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQGDGLILSTTSG
Sbjct  388  HVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQGDGLILSTTSG  447

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  448  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  507

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLAPGDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPRE+
Sbjct  508  GKDRKRLAPGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPREA  565



>ref|XP_008349859.1| PREDICTED: NAD(H) kinase 1-like [Malus domestica]
Length=228

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKN++ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  51   HVIREAAKNKYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  110

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VP NSR HAWASFD
Sbjct  111  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPSNSRSHAWASFD  170

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPR++
Sbjct  171  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPRDA  228



>emb|CDP09273.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +VIRD AK E+E EGP+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  350  YVIRDAAKTEYENEGPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  409

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSRGHAWASFD
Sbjct  410  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRGHAWASFD  469

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  470  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFDGPRDA  527



>ref|XP_007214444.1| hypothetical protein PRUPE_ppa024717mg, partial [Prunus persica]
 gb|EMJ15643.1| hypothetical protein PRUPE_ppa024717mg, partial [Prunus persica]
Length=419

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  242  HVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  301

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  302  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  361

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPR++
Sbjct  362  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPRDA  419



>ref|XP_008227335.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Prunus mume]
Length=520

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  343  HVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  402

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  403  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  462

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPR++
Sbjct  463  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPRDT  520



>ref|XP_008227336.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Prunus mume]
Length=516

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  339  HVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  398

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  399  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  458

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPR++
Sbjct  459  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPRDT  516



>ref|XP_009374926.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Pyrus x bretschneideri]
Length=565

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQGDGLILSTTSG
Sbjct  388  HVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQGDGLILSTTSG  447

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  448  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  507

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLAPGDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRK QSFDGPRE+
Sbjct  508  GKDRKRLAPGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKIQSFDGPREA  565



>ref|XP_009618540.1| PREDICTED: NAD(H) kinase 1 [Nicotiana tomentosiformis]
Length=528

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  351  HVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQGDGLILSTTSG  410

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSRGHAWASFD
Sbjct  411  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRGHAWASFD  470

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTACQ DST+DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  471  GKDRKKLAPGDALVCSMAPWPVPTACQSDSTSDFLRSIHEGLHWNLRKTQSFDGPRET  528



>ref|XP_008227337.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Prunus mume]
Length=487

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  310  HVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  369

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR HAWASFD
Sbjct  370  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSHAWASFD  429

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPR++
Sbjct  430  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPRDT  487



>ref|XP_011080363.1| PREDICTED: NAD(H) kinase 1 [Sesamum indicum]
Length=534

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD AK+E+E EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  357  HIIRDEAKSEYENEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  416

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RVVVPFNSR  AW SFD
Sbjct  417  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVVVPFNSRSQAWVSFD  476

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+LAPGDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQSFDGPR+S
Sbjct  477  GKGRKQLAPGDALVCSMAPWPVPTACQLDSTSDFLRSIHDGLHWNLRKTQSFDGPRDS  534



>dbj|BAK22410.1| NAD kinase [Nicotiana benthamiana]
Length=299

 Score =   344 bits (883),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  122  HVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQGDGLILSTTSG  181

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSRGHAWASFD
Sbjct  182  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRGHAWASFD  241

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTACQ DST+DFL SIH+GLHWNLRKTQSFDGP+E+
Sbjct  242  GKDRKKLAPGDALVCSMAPWPVPTACQSDSTSDFLHSIHEGLHWNLRKTQSFDGPQET  299



>ref|XP_009775830.1| PREDICTED: NAD(H) kinase 1 [Nicotiana sylvestris]
Length=528

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  351  HVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQGDGLILSTTSG  410

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSRGHAWASFD
Sbjct  411  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRGHAWASFD  470

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTACQ DST+DFL SIH+GLHWNLRKTQSFDGPRE+
Sbjct  471  GKDRKKLAPGDALVCSMAPWPVPTACQSDSTSDFLHSIHEGLHWNLRKTQSFDGPRET  528



>gb|ACU17681.1| unknown [Glycine max]
Length=228

 Score =   340 bits (871),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  851  NAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
              HVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT
Sbjct  49   QCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  108

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHVT+RV VPFNSR  AWAS
Sbjct  109  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVTLRVQVPFNSRSPAWAS  168

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            FDGKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  169  FDGKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  228



>ref|XP_011459496.1| PREDICTED: NAD(H) kinase 1 [Fragaria vesca subsp. vesca]
Length=519

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  342  HVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  401

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSR HAWASFD
Sbjct  402  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRSHAWASFD  461

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRKRLA GDAL+CSMAPWPVPTACQVDST DFL SIHDGLHWNLRKTQSFDGPR+
Sbjct  462  GKDRKRLAAGDALVCSMAPWPVPTACQVDSTNDFLTSIHDGLHWNLRKTQSFDGPRD  518



>ref|XP_009366085.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Pyrus x bretschneideri]
Length=519

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  342  HVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  401

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VP NSR HAWASFD
Sbjct  402  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPSNSRSHAWASFD  461

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+LA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPRE+
Sbjct  462  GKGRKQLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPREA  519



>ref|XP_004228514.1| PREDICTED: NAD(H) kinase 1 [Solanum lycopersicum]
Length=531

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD+AK++ ++E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  354  HVIRDSAKSDLDSEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  413

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VTIRV VPFNSRGHAWASFD
Sbjct  414  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTIRVQVPFNSRGHAWASFD  473

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMA WPVPTACQ DST+DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  474  GKDRKKLAPGDALVCSMATWPVPTACQADSTSDFLRSIHEGLHWNLRKTQSFDGPRET  531



>ref|XP_002513516.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
 gb|EEF48919.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
Length=532

 Score =   348 bits (894),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  HVIRDAAKNEVETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSSAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK L PGDAL+CSMAPWPVPTACQVDST DFLRSIH+GLHWNLRKTQSFDGPRE
Sbjct  475  GKDRKLLEPGDALVCSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKTQSFDGPRE  531



>ref|XP_006365622.1| PREDICTED: probable NAD kinase 1-like [Solanum tuberosum]
Length=531

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD+AK++ ++E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  354  HVIRDSAKSDLDSEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  413

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VTIRV VPFNSRGHAWASFD
Sbjct  414  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTIRVQVPFNSRGHAWASFD  473

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMA WPVPTACQ DST+DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  474  GKDRKKLAPGDALVCSMATWPVPTACQADSTSDFLRSIHEGLHWNLRKTQSFDGPRET  531



>gb|KHG26120.1| NAD (H) kinase 1 -like protein [Gossypium arboreum]
Length=451

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  273  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  332

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  333  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  392

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  393  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  448



>ref|XP_008450412.1| PREDICTED: NAD(H) kinase 1 [Cucumis melo]
Length=521

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A+NE+ETE P+LVLNEVTIDRGISS+LTNLECYCD SFVTCVQGDGLILSTTSG
Sbjct  344  HVIRDAARNEYETEEPILVLNEVTIDRGISSYLTNLECYCDRSFVTCVQGDGLILSTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PE+VTIR+ VPFNSRGHAWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEYVTIRIQVPFNSRGHAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  464  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRDA  521



>ref|XP_004505640.1| PREDICTED: NAD(H) kinase 1-like [Cicer arietinum]
Length=524

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNEFET  P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  347  HVIRDAAKNEFETGEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  406

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AWASFD
Sbjct  407  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSPAWASFD  466

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC VDST DFLRSIH+GLHWNLRKTQSFDGPRES
Sbjct  467  GKDRKQLAPGDALVCSMAPWPVPTACLVDSTNDFLRSIHEGLHWNLRKTQSFDGPRES  524



>ref|XP_004139039.1| PREDICTED: NAD(H) kinase 1 [Cucumis sativus]
 gb|KGN66497.1| hypothetical protein Csa_1G615160 [Cucumis sativus]
Length=521

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A+NE+ETE P+LVLNEVTIDRGISS+LTNLECYCD SFVTCVQGDGLILSTTSG
Sbjct  344  HVIRDAARNEYETEEPILVLNEVTIDRGISSYLTNLECYCDRSFVTCVQGDGLILSTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PE+VTIR+ VPFNSRGHAWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEYVTIRIQVPFNSRGHAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  464  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRDA  521



>gb|AFN88238.1| NADH kinase, partial [Vigna luteola]
Length=250

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  851  NAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
              HVIR+ AKNE+ETE PMLVLNEVTIDRGISSFLTNLECYCD+SFVTCVQGDGLILSTT
Sbjct  71   QCHVIREAAKNEYETEEPMLVLNEVTIDRGISSFLTNLECYCDDSFVTCVQGDGLILSTT  130

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRP+I PEHVT+RV VPFNSR  AWAS
Sbjct  131  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPMIFPEHVTLRVQVPFNSRSPAWAS  190

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            FDGKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  191  FDGKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  250



>ref|XP_009366086.1| PREDICTED: probable NAD kinase 1 isoform X3 [Pyrus x bretschneideri]
Length=486

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  309  HVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  368

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VP NSR HAWASFD
Sbjct  369  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPSNSRSHAWASFD  428

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+LA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPRE+
Sbjct  429  GKGRKQLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPREA  486



>ref|XP_009366084.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Pyrus x bretschneideri]
Length=565

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  388  HVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  447

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VP NSR HAWASFD
Sbjct  448  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPSNSRSHAWASFD  507

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+LA GDAL+CSMAPWPVPTACQVDST+DFL SIHDGLHWNLRKTQSFDGPRE+
Sbjct  508  GKGRKQLAAGDALVCSMAPWPVPTACQVDSTSDFLNSIHDGLHWNLRKTQSFDGPREA  565



>gb|KJB35763.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=429

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  251  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  310

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  311  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  370

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  371  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  426



>ref|XP_002314082.2| ATP-NAD kinase family protein [Populus trichocarpa]
 gb|EEE88037.2| ATP-NAD kinase family protein [Populus trichocarpa]
Length=532

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  YVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQ+DST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  475  GKDRKQLAAGDALVCSMAPWPVPTACQIDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  531



>ref|XP_007015104.1| NAD kinase 1 isoform 3 [Theobroma cacao]
 gb|EOY32723.1| NAD kinase 1 isoform 3 [Theobroma cacao]
Length=436

 Score =   343 bits (879),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  260  VVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  319

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  320  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIVVPFNSRSPAWASFDG  379

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  380  KDRKQLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  435



>ref|XP_011032051.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=532

 Score =   346 bits (887),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  YVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQ+DST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  475  GKDRKQLAAGDALVCSMAPWPVPTACQIDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  531



>ref|XP_003540253.1| PREDICTED: NAD(H) kinase 1-like [Glycine max]
Length=521

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  344  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHVT+RV VPFNSR  AWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVTLRVQVPFNSRSPAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  464  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  521



>gb|KJB35767.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=513

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  335  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  394

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  395  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  454

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  455  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  510



>gb|KJB35761.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=487

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  309  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  368

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  369  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  428

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  429  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  484



>gb|KHN05513.1| NAD(H) kinase 1 [Glycine soja]
Length=508

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  331  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  390

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHVT+RV VPFNSR  AWASFD
Sbjct  391  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVTLRVQVPFNSRSPAWASFD  450

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  451  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  508



>ref|XP_003537731.1| PREDICTED: NAD(H) kinase 1 [Glycine max]
Length=521

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  344  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHVT+RV VPFNSR  AWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVTLRVQVPFNSRSPAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  464  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  521



>gb|KHN20637.1| NAD(H) kinase 1 [Glycine soja]
Length=508

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  331  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  390

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHVT+RV VPFNSR  AWASFD
Sbjct  391  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVTLRVQVPFNSRSPAWASFD  450

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  451  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  508



>ref|XP_007015102.1| NAD kinase 1 isoform 1 [Theobroma cacao]
 gb|EOY32721.1| NAD kinase 1 isoform 1 [Theobroma cacao]
Length=537

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  361  VVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  420

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  421  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIVVPFNSRSPAWASFDG  480

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  481  KDRKQLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  536



>ref|XP_007015105.1| NAD(H) kinase 1 isoform 4 [Theobroma cacao]
 gb|EOY32724.1| NAD(H) kinase 1 isoform 4 [Theobroma cacao]
Length=472

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  296  VVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  355

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  356  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIVVPFNSRSPAWASFDG  415

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  416  KDRKQLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  471



>gb|KJB35768.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=537

 Score =   344 bits (883),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  359  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  418

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  419  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  478

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  479  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  534



>gb|KJB35762.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=539

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  361  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  420

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  421  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  480

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  481  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  536



>ref|XP_011032050.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=575

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  398  YVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  457

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  458  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  517

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQ+DST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  518  GKDRKQLAAGDALVCSMAPWPVPTACQIDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  574



>gb|KJB35765.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=541

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  363  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  422

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  423  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  482

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  483  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  538



>gb|AFS49950.1| NADH kinase [Vigna luteola]
Length=522

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETE PMLVLNEVTIDRGISSFLTNLECYCD+SFVTCVQGDGLILSTTSG
Sbjct  345  HVIREAAKNEYETEEPMLVLNEVTIDRGISSFLTNLECYCDDSFVTCVQGDGLILSTTSG  404

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRP+I PEHVT+RV VPFNSR  AWASFD
Sbjct  405  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPMIFPEHVTLRVQVPFNSRSPAWASFD  464

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  465  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  522



>ref|XP_010102369.1| NAD(H) kinase 1 [Morus notabilis]
 gb|EXB93330.1| NAD(H) kinase 1 [Morus notabilis]
Length=538

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P++VLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  362  VLRDAAKNEYETEEPVIVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  421

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR HAW SFDG
Sbjct  422  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSHAWVSFDG  481

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            KDRK+L PGDAL+CSMAPWPVPTAC VDST+DFLRSIH+GLHWNLRKTQSFDGPR++
Sbjct  482  KDRKQLRPGDALVCSMAPWPVPTACLVDSTSDFLRSIHEGLHWNLRKTQSFDGPRDT  538



>ref|XP_010545595.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Tarenaya hassleriana]
Length=533

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  356  HIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  415

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  416  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSSAWVSFD  475

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L PGDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  476  GKDRKQLEPGDALVCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRDT  533



>ref|XP_010545596.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Tarenaya hassleriana]
Length=439

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  262  HIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  321

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  322  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSSAWVSFD  381

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L PGDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  382  GKDRKQLEPGDALVCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRDT  439



>ref|XP_010031772.1| PREDICTED: NAD(H) kinase 1 [Eucalyptus grandis]
 gb|KCW51156.1| hypothetical protein EUGRSUZ_J00748 [Eucalyptus grandis]
Length=524

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HV+RD+A+NE+ETE P+LVLNEVTIDRGISS+LTNLECY DNSFVT VQGDGLILSTTSG
Sbjct  347  HVVRDSARNEYETEEPILVLNEVTIDRGISSYLTNLECYSDNSFVTLVQGDGLILSTTSG  406

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AW SFD
Sbjct  407  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSQAWVSFD  466

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+L  GDALICSMAPWPVPTACQVDST+DFLRSIHDGLHWNLRKTQSFDGPRE
Sbjct  467  GKDRKQLGAGDALICSMAPWPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFDGPRE  523



>ref|XP_010673682.1| PREDICTED: NAD(H) kinase 1 [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR++AK+E++TE P+LVLNEVTIDRGISS+LTNLECYCDN+FVTCVQGDGLILSTTSG
Sbjct  344  HVIRESAKHEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNTFVTCVQGDGLILSTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSPAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+LAPGDALICSMAPWPVPTACQVDST+DFLRSIH+GLHWNLRKTQSFDGP
Sbjct  464  GKDRKQLAPGDALICSMAPWPVPTACQVDSTSDFLRSIHEGLHWNLRKTQSFDGP  518



>ref|XP_006844879.1| PREDICTED: putative NAD kinase 3 [Amborella trichopoda]
 gb|ERN06554.1| hypothetical protein AMTR_s00058p00119830 [Amborella trichopoda]
Length=533

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE PMLVLNEVTIDRG+SSFLT LECYCDNSFVTCVQGDGLILSTTSG
Sbjct  356  HVIRDGAKDELETEEPMLVLNEVTIDRGMSSFLTQLECYCDNSFVTCVQGDGLILSTTSG  415

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRG AWASFD
Sbjct  416  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTVRVQVPFNSRGQAWASFD  475

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+L+ GDALICSMAPWPVPTACQVDST DFL SIH+GLHWNLRKTQSFDGP++
Sbjct  476  GKDRKQLSAGDALICSMAPWPVPTACQVDSTNDFLHSIHEGLHWNLRKTQSFDGPQD  532



>gb|KJB35764.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=587

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  409  VVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  468

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R++VPFNSR  AWASFDG
Sbjct  469  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRIMVPFNSRSPAWASFDG  528

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK LA GDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  529  KDRKLLAAGDALLCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRD  584



>ref|XP_007131550.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
 gb|ESW03544.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
Length=480

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCD+SFVTCVQGDGLILSTTSG
Sbjct  303  HVIREAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDDSFVTCVQGDGLILSTTSG  362

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHV++RV VPFNSR  AWASFD
Sbjct  363  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVSLRVQVPFNSRSPAWASFD  422

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  423  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  480



>gb|EYU46237.1| hypothetical protein MIMGU_mgv1a004572mg [Erythranthe guttata]
Length=520

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD AK+E+E EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  343  HIIRDEAKSEYENEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  402

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RVVVP +SR  AW SFD
Sbjct  403  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVVVPPSSRCQAWVSFD  462

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+L PGDAL+CSMAPWPVPTACQ DSTTDFLRSIHDGLHWNLRKTQSFDGPR+
Sbjct  463  GKGRKQLGPGDALVCSMAPWPVPTACQSDSTTDFLRSIHDGLHWNLRKTQSFDGPRD  519



>ref|XP_012090710.1| PREDICTED: NAD(H) kinase 1-like [Jatropha curcas]
Length=297

 Score =   333 bits (854),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A NE ET+ P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  117  HVIRDAATNEVETDEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  176

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  177  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  236

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIH+GLHWNLRKTQSFDGP
Sbjct  237  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKTQSFDGP  291



>ref|XP_010246730.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Nelumbo nucifera]
Length=503

 Score =   340 bits (872),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE P+L LNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  325  HVIRDAAKDELETEEPILALNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  384

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRGHAW SFD
Sbjct  385  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPENVTVRVQVPFNSRGHAWVSFD  444

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQV+ST DFLRSIH+ LHWNLRKTQSFDGP+E
Sbjct  445  GKDRKQLAAGDALVCSMAPWPVPTACQVNSTHDFLRSIHEDLHWNLRKTQSFDGPKE  501



>gb|KJB55385.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=411

 Score =   337 bits (863),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  229  VIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  288

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  289  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRIVVPFNSRSPAWASFDG  348

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAP PVPTACQVDST+DFL SI DGLHWNLRKTQSFDGPRE
Sbjct  349  KDRKQLAAGDALLCSMAPCPVPTACQVDSTSDFLSSIQDGLHWNLRKTQSFDGPRE  404



>gb|KJB55387.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=486

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
             VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  303  RVIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  362

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFD
Sbjct  363  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRIVVPFNSRSPAWASFD  422

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAP PVPTACQVDST+DFL SI DGLHWNLRKTQSFDGPRE
Sbjct  423  GKDRKQLAAGDALLCSMAPCPVPTACQVDSTSDFLSSIQDGLHWNLRKTQSFDGPRE  479



>ref|XP_010545594.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Tarenaya hassleriana]
Length=576

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  399  HIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  458

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  459  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRSSAWVSFD  518

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L PGDAL+CSMAPWPVPTACQVDST DFLRSIHDGLHWNLRKTQSFDGPR++
Sbjct  519  GKDRKQLEPGDALVCSMAPWPVPTACQVDSTNDFLRSIHDGLHWNLRKTQSFDGPRDT  576



>gb|KJB55384.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=435

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  253  VIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  312

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  313  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRIVVPFNSRSPAWASFDG  372

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAP PVPTACQVDST+DFL SI DGLHWNLRKTQSFDGPRE
Sbjct  373  KDRKQLAAGDALLCSMAPCPVPTACQVDSTSDFLSSIQDGLHWNLRKTQSFDGPRE  428



>ref|XP_002285357.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Vitis vinifera]
Length=522

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQGDGLILSTTSG
Sbjct  345  HVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQGDGLILSTTSG  404

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSRGHAWASFD
Sbjct  405  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRGHAWASFD  464

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDR++LAPGDAL+ SMAP PVPTACQVDST+DFLRSIHDGLHWNLRKTQSF+GPR+
Sbjct  465  GKDRRQLAPGDALVVSMAPCPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFEGPRD  521



>ref|XP_010269765.1| PREDICTED: putative NAD kinase 3 isoform X1 [Nelumbo nucifera]
Length=531

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRDTAK+E ETE P+LVLNEVTIDRGISS+LTNLECYCDNSF+TCVQGDGLI+STTSG
Sbjct  353  HVIRDTAKDELETEDPILVLNEVTIDRGISSYLTNLECYCDNSFMTCVQGDGLIISTTSG  412

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV +PFNSRGHAWASFD
Sbjct  413  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQIPFNSRGHAWASFD  472

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+L  GDAL+CSMAPWPVPTAC VDST DFLRSI +GLHWNLRKTQSFDGPRE
Sbjct  473  GKDRKQLGAGDALVCSMAPWPVPTACLVDSTHDFLRSIQEGLHWNLRKTQSFDGPRE  529



>ref|XP_010246729.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Nelumbo nucifera]
Length=527

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE P+L LNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  349  HVIRDAAKDELETEEPILALNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  408

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRGHAW SFD
Sbjct  409  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPENVTVRVQVPFNSRGHAWVSFD  468

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQV+ST DFLRSIH+ LHWNLRKTQSFDGP+E
Sbjct  469  GKDRKQLAAGDALVCSMAPWPVPTACQVNSTHDFLRSIHEDLHWNLRKTQSFDGPKE  525



>gb|KJB55386.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=538

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSGS
Sbjct  356  VIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGS  415

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+R+VVPFNSR  AWASFDG
Sbjct  416  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRIVVPFNSRSPAWASFDG  475

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LA GDAL+CSMAP PVPTACQVDST+DFL SI DGLHWNLRKTQSFDGPRE
Sbjct  476  KDRKQLAAGDALLCSMAPCPVPTACQVDSTSDFLSSIQDGLHWNLRKTQSFDGPRE  531



>ref|XP_007131551.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
 gb|ESW03545.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
Length=568

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCD+SFVTCVQGDGLILSTTSG
Sbjct  391  HVIREAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDDSFVTCVQGDGLILSTTSG  450

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PEHV++RV VPFNSR  AWASFD
Sbjct  451  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEHVSLRVQVPFNSRSPAWASFD  510

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST DFLRSIH+GLHWNLRKTQSFDGPRE+
Sbjct  511  GKDRKQLAPGDALVCSMAPWPVPTACLDDSTNDFLRSIHEGLHWNLRKTQSFDGPRET  568



>gb|KFK39415.1| hypothetical protein AALP_AA3G241900 [Arabis alpina]
Length=532

 Score =   338 bits (868),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++EFETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  HIIRDKARHEFETEDTMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWN RKTQSFDGPR++
Sbjct  475  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNQRKTQSFDGPRDT  532



>ref|XP_010651223.1| PREDICTED: NAD(H) kinase 1 isoform X4 [Vitis vinifera]
Length=474

 Score =   337 bits (864),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  851  NAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
              HVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQGDGLILSTT
Sbjct  295  QCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQGDGLILSTT  354

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSRGHAWAS
Sbjct  355  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRGHAWAS  414

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            FDGKDR++LAPGDAL+ SMAP PVPTACQVDST+DFLRSIHDGLHWNLRKTQSF+GPR+
Sbjct  415  FDGKDRRQLAPGDALVVSMAPCPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFEGPRD  473



>ref|XP_002885418.1| hypothetical protein ARALYDRAFT_342253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61677.1| hypothetical protein ARALYDRAFT_342253 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   338 bits (866),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A NE+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  327  HIIRDKATNEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  386

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  387  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  446

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPR++
Sbjct  447  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGPRDT  504



>ref|XP_002298393.2| hypothetical protein POPTR_0001s26330g [Populus trichocarpa]
 gb|EEE83198.2| hypothetical protein POPTR_0001s26330g [Populus trichocarpa]
Length=446

 Score =   336 bits (861),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  269  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  328

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  329  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  388

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LA GDAL+CSMAPWPVPTACQ+DST DFLRSIHDGLHWNLRKTQS DGP++
Sbjct  389  GKDRKQLAAGDALVCSMAPWPVPTACQIDSTNDFLRSIHDGLHWNLRKTQSVDGPQD  445



>ref|XP_003607363.1| NAD(H) kinase [Medicago truncatula]
 gb|AES89560.1| NAD/NADH kinase family protein [Medicago truncatula]
Length=523

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNEFETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVT VQGDGLILSTTSG
Sbjct  346  HVIRDAAKNEFETEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTRVQGDGLILSTTSG  405

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV +PFNSRG AWASFD
Sbjct  406  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQIPFNSRGSAWASFD  465

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LAPGDAL+CSMAPWPVPTAC  DST+DFL SIH+GLHWNLRKTQS D PRE+
Sbjct  466  GKDRKQLAPGDALVCSMAPWPVPTACHGDSTSDFLHSIHEGLHWNLRKTQSSDAPREA  523



>ref|XP_012090029.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Jatropha curcas]
Length=525

 Score =   338 bits (867),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A NE ET+ P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  345  HVIRDAATNEVETDEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  404

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  405  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  464

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIH+GLHWNLRKTQSFDGP
Sbjct  465  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKTQSFDGP  519



>ref|XP_010651218.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651219.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651221.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651222.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 emb|CBI16350.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQGDGLILSTTSG
Sbjct  386  HVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQGDGLILSTTSG  445

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSRGHAWASFD
Sbjct  446  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRGHAWASFD  505

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDR++LAPGDAL+ SMAP PVPTACQVDST+DFLRSIHDGLHWNLRKTQSF+GPR+
Sbjct  506  GKDRRQLAPGDALVVSMAPCPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFEGPRD  562



>ref|XP_006446153.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
 gb|ESR59393.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
Length=371

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 165/176 (94%), Gaps = 1/176 (1%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  193  HVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  252

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV +PFNSR  AWASFD
Sbjct  253  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQIPFNSRSPAWASFD  312

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGP  321
            GKDRK+LAPGDAL+CSMAPWPVPTACQVDST DF RSIHDGLHWNLRKTQ SFD P
Sbjct  313  GKDRKQLAPGDALVCSMAPWPVPTACQVDSTDDFFRSIHDGLHWNLRKTQSSFDVP  368



>ref|XP_010651217.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Vitis vinifera]
Length=565

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQGDGLILSTTSG
Sbjct  388  HVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQGDGLILSTTSG  447

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSRGHAWASFD
Sbjct  448  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRGHAWASFD  507

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDR++LAPGDAL+ SMAP PVPTACQVDST+DFLRSIHDGLHWNLRKTQSF+GPR+
Sbjct  508  GKDRRQLAPGDALVVSMAPCPVPTACQVDSTSDFLRSIHDGLHWNLRKTQSFEGPRD  564



>ref|XP_011045416.1| PREDICTED: NAD(H) kinase 1-like isoform X3 [Populus euphratica]
Length=532

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  355  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  415  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LA GDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQS DGPR+
Sbjct  475  GKHRKQLAAGDALVCSMAPWPVPTACQIDSTSDFLRSIHDGLHWNLRKTQSVDGPRD  531



>gb|KDP22112.1| hypothetical protein JCGZ_25943 [Jatropha curcas]
Length=554

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A NE ET+ P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  374  HVIRDAATNEVETDEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  433

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  434  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  493

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIH+GLHWNLRKTQSFDGP
Sbjct  494  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKTQSFDGP  548



>ref|XP_011013831.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=532

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  355  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  415  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LA GDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQS DGPR+
Sbjct  475  GKHRKQLAAGDALVCSMAPWPVPTACQIDSTSDFLRSIHDGLHWNLRKTQSVDGPRD  531



>ref|XP_012090028.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Jatropha curcas]
Length=559

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD A NE ET+ P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  379  HVIRDAATNEVETDEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  438

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  439  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  498

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+LA GDAL+CSMAPWPVPTACQVDST DFLRSIH+GLHWNLRKTQSFDGP
Sbjct  499  GKDRKQLAAGDALVCSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKTQSFDGP  553



>ref|XP_011045414.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=546

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  369  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  428

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  429  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  488

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LA GDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQS DGPR+
Sbjct  489  GKHRKQLAAGDALVCSMAPWPVPTACQIDSTSDFLRSIHDGLHWNLRKTQSVDGPRD  545



>ref|XP_011045415.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=546

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  369  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  428

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  429  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  488

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LA GDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQS DGPR+
Sbjct  489  GKHRKQLAAGDALVCSMAPWPVPTACQIDSTSDFLRSIHDGLHWNLRKTQSVDGPRD  545



>ref|XP_011013830.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=546

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQGDGLILSTTSG
Sbjct  369  HVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQGDGLILSTTSG  428

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSL AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRV VPFNSR  AWASFD
Sbjct  429  STAYSLGAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVQVPFNSRSPAWASFD  488

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LA GDAL+CSMAPWPVPTACQ+DST+DFLRSIHDGLHWNLRKTQS DGPR+
Sbjct  489  GKHRKQLAAGDALVCSMAPWPVPTACQIDSTSDFLRSIHDGLHWNLRKTQSVDGPRD  545



>ref|XP_010938543.1| PREDICTED: probable NAD kinase 1 [Elaeis guineensis]
Length=532

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
             VIR+ AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVT VQGDGLILSTTSG
Sbjct  355  QVIREAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTLVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRGHAWASFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPFNSRGHAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LA GDALICSMAPWPVPTACQVDST DFLRSIH+GLHWNLRK+QSFDGPR+S
Sbjct  475  GKDRKQLAAGDALICSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKSQSFDGPRDS  532



>ref|XP_008782033.1| PREDICTED: probable NAD kinase 1 [Phoenix dactylifera]
Length=534

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
             VIR+ AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVT VQGDGLILSTTSG
Sbjct  357  QVIREAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTLVQGDGLILSTTSG  416

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRGHAWASFD
Sbjct  417  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPFNSRGHAWASFD  476

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+LA GDALICSMAPWPVPTACQVDST DFLRSIH+GLHWNLRK+QSFDGPR+S
Sbjct  477  GKDRKQLAAGDALICSMAPWPVPTACQVDSTNDFLRSIHEGLHWNLRKSQSFDGPRDS  534



>gb|EMT15186.1| Putative NAD kinase 1 [Aegilops tauschii]
Length=497

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  321  HVIRDAAKDEIVTEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  380

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+R+ VP+NSRGHAWASFD
Sbjct  381  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRIQVPYNSRGHAWASFD  440

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LAPGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRKTQ+ DGPR+
Sbjct  441  GKDRKQLAPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKTQTLDGPRD  497



>ref|XP_010509651.1| PREDICTED: NAD(H) kinase 1-like [Camelina sativa]
Length=525

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  348  HIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  407

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  408  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  467

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP+++
Sbjct  468  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGPQDT  525



>ref|XP_010488093.1| PREDICTED: NAD(H) kinase 1 [Camelina sativa]
Length=525

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  348  HIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  407

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  408  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  467

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP+++
Sbjct  468  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGPQDT  525



>ref|XP_006470641.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Citrus sinensis]
 gb|KDO61212.1| hypothetical protein CISIN_1g008048mg [Citrus sinensis]
Length=533

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 165/176 (94%), Gaps = 1/176 (1%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  HVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV +PFNSR  AWASFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQIPFNSRSPAWASFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGP  321
            GKDRK+LAPGDAL+CSMAPWPVPTACQVDST DF RSIHDGLHWNLRKTQ SFD P
Sbjct  475  GKDRKQLAPGDALVCSMAPWPVPTACQVDSTDDFFRSIHDGLHWNLRKTQSSFDVP  530



>ref|XP_010466324.1| PREDICTED: NAD(H) kinase 1-like [Camelina sativa]
Length=526

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  349  HIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  408

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  409  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  468

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP+++
Sbjct  469  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGPQDA  526



>ref|XP_006446154.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
 gb|ESR59394.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
Length=530

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 165/176 (94%), Gaps = 1/176 (1%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV +PFNSR  AWASFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQIPFNSRSPAWASFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGP  321
            GKDRK+LAPGDAL+CSMAPWPVPTACQVDST DF RSIHDGLHWNLRKTQ SFD P
Sbjct  472  GKDRKQLAPGDALVCSMAPWPVPTACQVDSTDDFFRSIHDGLHWNLRKTQSSFDVP  527



>gb|EMS47657.1| putative NAD kinase 1 [Triticum urartu]
Length=554

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  378  HVIRDAAKDEIVTEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  437

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+R+ VP+NSRGHAWASFD
Sbjct  438  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRIQVPYNSRGHAWASFD  497

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LAPGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRKTQ+ DGPR+
Sbjct  498  GKDRKQLAPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKTQTLDGPRD  554



>ref|XP_006297412.1| hypothetical protein CARUB_v10013436mg [Capsella rubella]
 gb|EOA30310.1| hypothetical protein CARUB_v10013436mg [Capsella rubella]
Length=532

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCD+SFVTCVQGDGLILSTTSG
Sbjct  355  HIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDDSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP+++
Sbjct  475  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSTDGPQDT  532



>ref|XP_006470640.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Citrus sinensis]
 gb|KDO61211.1| hypothetical protein CISIN_1g008048mg [Citrus sinensis]
Length=579

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 165/176 (94%), Gaps = 1/176 (1%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  401  HVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  460

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV +PFNSR  AWASFD
Sbjct  461  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQIPFNSRSPAWASFD  520

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGP  321
            GKDRK+LAPGDAL+CSMAPWPVPTACQVDST DF RSIHDGLHWNLRKTQ SFD P
Sbjct  521  GKDRKQLAPGDALVCSMAPWPVPTACQVDSTDDFFRSIHDGLHWNLRKTQSSFDVP  576



>ref|XP_006646694.1| PREDICTED: probable NAD kinase 1-like [Oryza brachyantha]
Length=569

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  393  HLIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  452

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRG AWASFD
Sbjct  453  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGQAWASFD  512

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGPR+
Sbjct  513  GKDRKLLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGPRD  569



>dbj|BAD94003.1| hypothetical protein [Arabidopsis thaliana]
Length=272

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  851  NAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
              H+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTT
Sbjct  96   QCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTT  155

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW S
Sbjct  156  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVS  215

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            FDGKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP
Sbjct  216  FDGKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGP  272



>emb|CDY37318.1| BnaA01g25380D [Brassica napus]
Length=529

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPRE+
Sbjct  472  GKGRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSSDGPRET  529



>ref|XP_009109957.1| PREDICTED: NAD(H) kinase 1-like [Brassica rapa]
Length=529

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPRE+
Sbjct  472  GKGRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSSDGPRET  529



>emb|CDY27547.1| BnaC01g32300D [Brassica napus]
Length=529

 Score =   330 bits (847),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPRE+
Sbjct  472  GKGRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSSDGPRET  529



>ref|NP_001045444.2| Os01g0957000 [Oryza sativa Japonica Group]
 sp|Q5JK52.1|NADK1_ORYSJ RecName: Full=Probable NAD kinase 1 [Oryza sativa Japonica Group]
 dbj|BAD88145.1| ATP-NAD kinase family protein-like [Oryza sativa Japonica Group]
 dbj|BAG94271.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07358.2| Os01g0957000 [Oryza sativa Japonica Group]
Length=532

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  356  HVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  415

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  416  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPHNSRGQAWASFD  475

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGPR+
Sbjct  476  GKDRKLLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGPRD  532



>dbj|BAB01450.1| unnamed protein product [Arabidopsis thaliana]
Length=483

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  309  HIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  368

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  369  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  428

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP
Sbjct  429  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGP  483



>gb|ACG29339.1| NAD kinase 1 [Zea mays]
Length=569

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 170/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  860  IDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLIL  681
            I C  HVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQGDGLI+
Sbjct  390  IQC--HVIRDAAKDEIVTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQGDGLII  447

Query  680  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHA  501
            STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRGHA
Sbjct  448  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGHA  507

Query  500  WASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            WASFDGKDRK+L+PGDALICS++PWPVPTAC VDSTTDF RSIH+GLHWNLRK+QSFDGP
Sbjct  508  WASFDGKDRKQLSPGDALICSISPWPVPTACLVDSTTDFFRSIHEGLHWNLRKSQSFDGP  567

Query  320  RE  315
            R+
Sbjct  568  RD  569



>ref|NP_001278550.1| NAD kinase 1 [Zea mays]
 gb|ACN34598.1| unknown [Zea mays]
 gb|AFW83921.1| NAD kinase 1 [Zea mays]
Length=569

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 170/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  860  IDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLIL  681
            I C  HVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQGDGLI+
Sbjct  390  IQC--HVIRDAAKDEIVTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQGDGLII  447

Query  680  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHA  501
            STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRGHA
Sbjct  448  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGHA  507

Query  500  WASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            WASFDGKDRK+L+PGDALICS++PWPVPTAC VDSTTDF RSIH+GLHWNLRK+QSFDGP
Sbjct  508  WASFDGKDRKQLSPGDALICSISPWPVPTACLVDSTTDFFRSIHEGLHWNLRKSQSFDGP  567

Query  320  RE  315
            R+
Sbjct  568  RD  569



>gb|EEC72189.1| hypothetical protein OsI_05264 [Oryza sativa Indica Group]
Length=571

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  395  HVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  454

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  455  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPHNSRGQAWASFD  514

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGPR+
Sbjct  515  GKDRKLLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGPRD  571



>gb|EEE56031.1| hypothetical protein OsJ_04817 [Oryza sativa Japonica Group]
Length=571

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  395  HVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  454

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  455  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPHNSRGQAWASFD  514

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGPR+
Sbjct  515  GKDRKLLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGPRD  571



>ref|NP_188744.3| NAD(H) kinase 1 [Arabidopsis thaliana]
 gb|AEE76457.1| NAD(H) kinase 1 [Arabidopsis thaliana]
Length=530

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  356  HIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  415

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  416  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  475

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP
Sbjct  476  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGP  530



>ref|NP_974347.1| NAD(H) kinase 1 [Arabidopsis thaliana]
 sp|Q56YN3.2|NADK1_ARATH RecName: Full=NAD(H) kinase 1; Short=AtNADK-1 [Arabidopsis thaliana]
 gb|AAR32133.1| NADK1 [Arabidopsis thaliana]
 dbj|BAD43895.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76456.1| NAD(H) kinase 1 [Arabidopsis thaliana]
Length=524

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  350  HIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  409

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  410  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  469

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP
Sbjct  470  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGP  524



>ref|XP_003567496.2| PREDICTED: probable NAD kinase 1 [Brachypodium distachyon]
Length=573

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            VIRD AK+E ETE P+L LNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSGS
Sbjct  398  VIRDAAKDELETEEPILALNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSGS  457

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRGHAWASFDG
Sbjct  458  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGHAWASFDG  517

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            KDRK+LAPGDALICS++PWPVPTAC VDSTTDFL SIH+GLHWNLRKTQS DGPR+
Sbjct  518  KDRKQLAPGDALICSISPWPVPTACLVDSTTDFLHSIHEGLHWNLRKTQSLDGPRD  573



>ref|XP_004971313.1| PREDICTED: probable NAD kinase 1-like [Setaria italica]
Length=566

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  390  HVIRDAAKDELVTEDPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  449

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRGHAWASFD
Sbjct  450  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGHAWASFD  509

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDR++L+PGDALICS++PWPVPTAC +DSTTDFLRSIH+GLHWNLRK+QS DGPR+
Sbjct  510  GKDRRQLSPGDALICSISPWPVPTACVMDSTTDFLRSIHEGLHWNLRKSQSSDGPRD  566



>dbj|BAJ98826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   332 bits (851),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQGDGLI+STTSG
Sbjct  477  HVIRDAAKDELVTEDPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSG  536

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+R+ VP+NSRGHAWASFD
Sbjct  537  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRIQVPYNSRGHAWASFD  596

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GKDRK+LAPGDALICS++PWPVPTAC VDSTTDF RSIH+GLHWNLRKTQS DGPR+
Sbjct  597  GKDRKQLAPGDALICSISPWPVPTACLVDSTTDFFRSIHEGLHWNLRKTQSLDGPRD  653



>gb|AAM13987.1| unknown protein [Arabidopsis thaliana]
Length=557

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  383  HIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  442

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSR  AW SFD
Sbjct  443  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFD  502

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GKDRK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGP
Sbjct  503  GKDRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSADGP  557



>gb|EPS71079.1| hypothetical protein M569_03679, partial [Genlisea aurea]
Length=506

 Score =   327 bits (839),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 1/176 (1%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGP-MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            H+IRD AK+E+E+EGP MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS
Sbjct  328  HIIRDEAKSEYESEGPPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  387

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE VT+RVVVP+ SR  AW SF
Sbjct  388  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPERVTVRVVVPYGSRSQAWVSF  447

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            DGK RK+L PGDALICSMA WPVPTAC+VDST DFL SIH+GLHWNLRKTQSFDGP
Sbjct  448  DGKGRKQLGPGDALICSMAAWPVPTACRVDSTADFLHSIHEGLHWNLRKTQSFDGP  503



>ref|XP_009391539.1| PREDICTED: putative NAD kinase 3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIR+ AK+E +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQGDGLILSTTSG
Sbjct  357  HVIREAAKDELDTEEPILVLNEVTIDRGMSSYLTFLECYCDSSFVTCVQGDGLILSTTSG  416

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLI PE+VT+RV VPFNSRGHAWASFD
Sbjct  417  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIFPEYVTLRVQVPFNSRGHAWASFD  476

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+LAPGDALICSMA WPVPTAC VDST DFLRSIH+GLHWNLRK+QSFDGPR+
Sbjct  477  GKGRKQLAPGDALICSMATWPVPTACLVDSTNDFLRSIHEGLHWNLRKSQSFDGPRD  533



>tpg|DAA55769.1| TPA: NAD kinase 1 [Zea mays]
Length=565

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 2/182 (1%)
 Frame = -2

Query  860  IDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLIL  681
            I C  HVIRD AK+E  +E P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQGDGLI+
Sbjct  386  IQC--HVIRDEAKDEIVSEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQGDGLII  443

Query  680  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHA  501
            STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VPFNSRG+A
Sbjct  444  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPFNSRGNA  503

Query  500  WASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            WASFDGKDR++L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  504  WASFDGKDRQQLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  563

Query  320  RE  315
            R+
Sbjct  564  RD  565



>ref|XP_006406326.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 ref|XP_006406327.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47779.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47780.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
Length=531

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  355  HIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  414

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  415  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  474

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQ+ DGPR+
Sbjct  475  GKGRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQNSDGPRD  531



>ref|XP_002459132.1| hypothetical protein SORBIDRAFT_03g046360 [Sorghum bicolor]
 gb|EES04252.1| hypothetical protein SORBIDRAFT_03g046360 [Sorghum bicolor]
Length=462

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  860  IDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLIL  681
            I C  HVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQGDGLI+
Sbjct  283  IQC--HVIRDAAKDEIMTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQGDGLII  340

Query  680  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHA  501
            STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP+NSRG A
Sbjct  341  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPYNSRGAA  400

Query  500  WASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            WASFDGKDR++L+PGDALICS++PWPVPTAC VDSTTDF RSIH+GLHWNLRK+QSFDGP
Sbjct  401  WASFDGKDRQQLSPGDALICSISPWPVPTACLVDSTTDFFRSIHEGLHWNLRKSQSFDGP  460

Query  320  RE  315
            R+
Sbjct  461  RD  462



>ref|XP_006406328.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47781.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
Length=542

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  366  HIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  425

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  426  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  485

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRE  315
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWNLRKTQ+ DGPR+
Sbjct  486  GKGRKQLEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQNSDGPRD  542



>ref|NP_001151954.1| NAD kinase 1 [Zea mays]
 gb|ACG45132.1| NAD kinase 1 [Zea mays]
Length=565

 Score =   327 bits (837),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  860  IDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLIL  681
            I C  HVIRD AK+E  +E P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQGDGLI+
Sbjct  386  IQC--HVIRDEAKDEIVSEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQGDGLII  443

Query  680  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHA  501
            STTSGSTAYSLAAGGSMVHPQVPGILFTPICPH LSFRPLILPE+VT+RV VPFNSRG+A
Sbjct  444  STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHXLSFRPLILPEYVTLRVQVPFNSRGNA  503

Query  500  WASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            WASFDGKDR++L+PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  504  WASFDGKDRQQLSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  563

Query  320  RE  315
            R+
Sbjct  564  RD  565



>ref|XP_004962206.1| PREDICTED: putative NAD kinase 3-like isoform X1 [Setaria italica]
Length=529

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 175/198 (88%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C  HV+RD AK+E E+E P+LVLNEVTIDRG+SS+LT LE
Sbjct  334  LGNVLKRPFSITLRSR--LKC--HVVRDAAKDEVESEEPILVLNEVTIDRGMSSYLTYLE  389

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  390  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  449

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV VPFNSRG AWASFDGK R +L PGDALICS++PWPVPTAC VDSTTDFLRS
Sbjct  450  PEYVTLRVQVPFNSRGQAWASFDGKGRIQLGPGDALICSISPWPVPTACLVDSTTDFLRS  509

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+QSFDGP
Sbjct  510  IHEGLHWNLRKSQSFDGP  527



>emb|CDY32402.1| BnaC03g41860D [Brassica napus]
Length=536

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE   LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  354  HIIRDKARHDYETEENTLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  413

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  414  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  473

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRESL  309
            GK RK+L  GDAL+CS+APWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPR+++
Sbjct  474  GKGRKQLEAGDALVCSIAPWPVSTACQVESTHDFLRSIHDGLHWNLRKTQSSDGPRDTI  532



>ref|XP_004962207.1| PREDICTED: putative NAD kinase 3-like isoform X2 [Setaria italica]
Length=527

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 175/198 (88%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C  HV+RD AK+E E+E P+LVLNEVTIDRG+SS+LT LE
Sbjct  332  LGNVLKRPFSITLRSR--LKC--HVVRDAAKDEVESEEPILVLNEVTIDRGMSSYLTYLE  387

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  388  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  447

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV VPFNSRG AWASFDGK R +L PGDALICS++PWPVPTAC VDSTTDFLRS
Sbjct  448  PEYVTLRVQVPFNSRGQAWASFDGKGRIQLGPGDALICSISPWPVPTACLVDSTTDFLRS  507

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+QSFDGP
Sbjct  508  IHEGLHWNLRKSQSFDGP  525



>emb|CDX82219.1| BnaA03g36020D [Brassica napus]
Length=529

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE   LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HIIRDKARHDYETEENTLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+L  GDAL+CS+APWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPR++
Sbjct  472  GKGRKQLEAGDALVCSIAPWPVSTACQVESTHDFLRSIHDGLHWNLRKTQSSDGPRDT  529



>ref|XP_009145525.1| PREDICTED: NAD(H) kinase 1 [Brassica rapa]
 emb|CDY61515.1| BnaAnng17540D [Brassica napus]
Length=528

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  353  HIIRDKARHDYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  412

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSRG AW SFD
Sbjct  413  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRGSAWVSFD  472

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPR  318
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIHDGLHWN RK QS DGP+
Sbjct  473  GKGRKQLEAGDALVCSMAPWPVSTACQVESTHDFLRSIHDGLHWNQRKIQSSDGPQ  528



>gb|EEC79147.1| hypothetical protein OsI_19811 [Oryza sativa Indica Group]
Length=442

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+STTSG
Sbjct  266  HVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIISTTSG  325

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  326  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPINSRGQAWASFD  385

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GK RK+L PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  386  GKGRKQLGPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  440



>gb|AAV31342.1| unknown protein [Oryza sativa Japonica Group]
Length=419

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+STTSG
Sbjct  243  HVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIISTTSG  302

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  303  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPINSRGQAWASFD  362

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GK RK+L PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  363  GKGRKQLGPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  417



>emb|CDY06405.1| BnaC05g31250D [Brassica napus]
Length=529

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  354  HIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  413

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSRG AW SFD
Sbjct  414  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRGSAWVSFD  473

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPR  318
            GK RK+L  GDAL+CSMAPWPV TACQV+ST DFLRSIH+GLHWN RK QS DGP+
Sbjct  474  GKGRKQLEAGDALVCSMAPWPVSTACQVESTHDFLRSIHEGLHWNQRKIQSSDGPQ  529



>ref|XP_009135723.1| PREDICTED: NAD(H) kinase 1-like [Brassica rapa]
Length=529

 Score =   320 bits (820),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H+IRD A++++ETE   LVLNE TI+RGISS+LTNLECYCDNSFVTCVQGDGLILSTTSG
Sbjct  352  HIIRDKARHDYETEENTLVLNEATIERGISSYLTNLECYCDNSFVTCVQGDGLILSTTSG  411

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVT+RV VPFNSR  AW SFD
Sbjct  412  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTVRVQVPFNSRSSAWVSFD  471

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPRES  312
            GK RK+L  GDAL+CS+APWPV TACQV+ST DFLRSIHDGLHWNLRKTQS DGPR++
Sbjct  472  GKGRKQLEAGDALVCSIAPWPVSTACQVESTHDFLRSIHDGLHWNLRKTQSSDGPRDT  529



>sp|Q60E60.2|NADK3_ORYSJ RecName: Full=Putative NAD kinase 3 [Oryza sativa Japonica Group]
Length=494

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+STTSG
Sbjct  318  HVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIISTTSG  377

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  378  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPINSRGQAWASFD  437

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GK RK+L PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  438  GKGRKQLGPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  492



>gb|EMS60742.1| Putative NAD kinase 3 [Triticum urartu]
Length=505

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C  HVIRD AK+E ET  P+LVLNEVTIDRG+SS+LT LE
Sbjct  311  LGNVLKRPFTITLRSR--LQC--HVIRDAAKDEVETGEPILVLNEVTIDRGMSSYLTYLE  366

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  367  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  426

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV VPFNSRG AWASFDGK R +L PGDALICS++PWP+PTAC VDSTTDFLRS
Sbjct  427  PEYVTLRVQVPFNSRGQAWASFDGKGRIQLGPGDALICSVSPWPLPTACLVDSTTDFLRS  486

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+Q+ DGP
Sbjct  487  IHEGLHWNLRKSQALDGP  504



>ref|XP_010231463.1| PREDICTED: putative NAD kinase 3 isoform X1 [Brachypodium distachyon]
Length=583

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C   VIRD AK+E ETE P++VLNE+TIDRG+SS+LT LE
Sbjct  388  LGNVLKRPFTITLRSR--LQC--QVIRDAAKDEVETEEPIIVLNEITIDRGMSSYLTYLE  443

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  444  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  503

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV +PFNSRG AWASFDGK R +L PGDALICS++PWPVPTAC VDSTTDFLRS
Sbjct  504  PEYVTLRVQIPFNSRGQAWASFDGKGRIQLGPGDALICSISPWPVPTACLVDSTTDFLRS  563

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+QS DGP
Sbjct  564  IHEGLHWNLRKSQSLDGP  581



>ref|XP_003568558.1| PREDICTED: putative NAD kinase 3 isoform X2 [Brachypodium distachyon]
Length=548

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C   VIRD AK+E ETE P++VLNE+TIDRG+SS+LT LE
Sbjct  353  LGNVLKRPFTITLRSR--LQC--QVIRDAAKDEVETEEPIIVLNEITIDRGMSSYLTYLE  408

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  409  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  468

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV +PFNSRG AWASFDGK R +L PGDALICS++PWPVPTAC VDSTTDFLRS
Sbjct  469  PEYVTLRVQIPFNSRGQAWASFDGKGRIQLGPGDALICSISPWPVPTACLVDSTTDFLRS  528

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+QS DGP
Sbjct  529  IHEGLHWNLRKSQSLDGP  546



>ref|XP_006655275.1| PREDICTED: putative NAD kinase 3-like [Oryza brachyantha]
Length=520

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVI D+AKNE ETE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+STTSG
Sbjct  344  HVICDSAKNEVETEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIISTTSG  403

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFD
Sbjct  404  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPINSRGQAWASFD  463

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            GK RK+L PGDALICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  464  GKGRKQLGPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  518



>gb|EMT20687.1| Putative NAD kinase 3 [Aegilops tauschii]
Length=622

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            +GN   + F + L S   + C  HVIRD AK+E ET  P+LVLNEVTIDRG+SS+LT LE
Sbjct  428  LGNVLKRPFAITLRSR--LQC--HVIRDAAKDEVETGEPILVLNEVTIDRGMSSYLTYLE  483

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+SFVTCVQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  484  CYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  543

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+RV VPFNSRG AWASFDGK R +L PGDALICS++PWP+PTAC VDSTTDFLRS
Sbjct  544  PEYVTLRVQVPFNSRGQAWASFDGKGRIQLGPGDALICSVSPWPLPTACLVDSTTDFLRS  603

Query  374  IHDGLHWNLRKTQSFDGP  321
            IH+GLHWNLRK+Q+ DGP
Sbjct  604  IHEGLHWNLRKSQALDGP  621



>ref|XP_002439730.1| hypothetical protein SORBIDRAFT_09g019130 [Sorghum bicolor]
 gb|EES18160.1| hypothetical protein SORBIDRAFT_09g019130 [Sorghum bicolor]
Length=498

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 168/198 (85%), Gaps = 4/198 (2%)
 Frame = -2

Query  914  IGNT*VQFFEVPLTSH*GIDCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLE  735
            + N   Q F + L S   + C  HVIRD AK + E E P+LVLNEVTIDRG+SS+LT LE
Sbjct  303  LSNVLKQPFSITLRSR--LQC--HVIRDAAKEQVENEQPILVLNEVTIDRGMSSYLTYLE  358

Query  734  CYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  555
            CYCD+S+VT VQGDGLI+STTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL
Sbjct  359  CYCDSSYVTRVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLIL  418

Query  554  PEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRS  375
            PE+VT+ V VP NSRGHAWASFDGK R +L  GDALICS++PWPVPTAC  DSTTDFLRS
Sbjct  419  PEYVTLCVQVPLNSRGHAWASFDGKGRIQLGRGDALICSISPWPVPTACLADSTTDFLRS  478

Query  374  IHDGLHWNLRKTQSFDGP  321
            IHDGLHWNLRK+QSFDGP
Sbjct  479  IHDGLHWNLRKSQSFDGP  496



>emb|CAN64916.1| hypothetical protein VITISV_023722 [Vitis vinifera]
Length=500

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            HVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQGDGLILSTTSG
Sbjct  232  HVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQGDGLILSTTSG  291

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVT+RV VPFNSRGHAWASFD
Sbjct  292  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTLRVQVPFNSRGHAWASFD  351

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQV  402
            GKDR++LAPGDAL+ SMAP PVPTACQ+
Sbjct  352  GKDRRQLAPGDALVVSMAPCPVPTACQI  379



>ref|XP_001762814.1| predicted protein [Physcomitrella patens]
 gb|EDQ72315.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E   LVLNE+ IDRG+SSFLTNLECYCD+ F+T VQGDGLILST SGSTAYSLAAGGSMV
Sbjct  320  EETHLVLNEIAIDRGMSSFLTNLECYCDDIFLTSVQGDGLILSTPSGSTAYSLAAGGSMV  379

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HPQVPGILFTPICPHSLSFRPLILPE+VTIRV VP NSRG AWASFDGKDR++L  GDAL
Sbjct  380  HPQVPGILFTPICPHSLSFRPLILPEYVTIRVQVPRNSRGQAWASFDGKDRQQLNEGDAL  439

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            +C M+ WPVP AC ++STTDFL+S+ DGLHWNLRK Q  +GP
Sbjct  440  LCHMSAWPVPAACDIESTTDFLQSVRDGLHWNLRKRQGSEGP  481



>ref|XP_001765616.1| predicted protein [Physcomitrella patens]
 gb|EDQ69666.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV I RG+SS L+NLECYCD +FVT VQGDGLILST SGSTAYSLAAGGSMVHPQV
Sbjct  352  LVLNEVAIHRGMSSNLSNLECYCDGNFVTSVQGDGLILSTPSGSTAYSLAAGGSMVHPQV  411

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            PGILFTPICPHSLSFRPLILPE+VTIRV VP  SRG AW SFDGKDR++L+ GDALIC M
Sbjct  412  PGILFTPICPHSLSFRPLILPEYVTIRVQVPHESRGQAWVSFDGKDREQLSGGDALICRM  471

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            A WPVP AC+ +STTDFLRS+ +GLHWNLRK Q  DGP
Sbjct  472  AAWPVPAACEQESTTDFLRSVREGLHWNLRKRQLSDGP  509



>gb|KCW51159.1| hypothetical protein EUGRSUZ_J00751 [Eucalyptus grandis]
Length=342

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 145/193 (75%), Gaps = 5/193 (3%)
 Frame = -2

Query  881  PLTSH*GIDCNAHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTC  705
            P+T    + C  HV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T 
Sbjct  134  PITLRRRLQC--HVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITT  191

Query  704  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVV  525
            VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVTI+V V
Sbjct  192  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTIQVEV  251

Query  524  PFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTT--DFLRSIHDGLHWN  351
            P  SRG AW SFDG+ R+ L   D LICSMA WPV TAC   ST+  DFL  I +GLHWN
Sbjct  252  PLGSRGSAWVSFDGQKREELKAEDKLICSMAQWPVLTACPDGSTSTRDFLIGIREGLHWN  311

Query  350  LRKTQSFDGPRES  312
            LRK Q  DGP++ 
Sbjct  312  LRKPQLPDGPQKQ  324



>ref|XP_002965137.1| hypothetical protein SELMODRAFT_83370 [Selaginella moellendorffii]
 gb|EFJ33975.1| hypothetical protein SELMODRAFT_83370 [Selaginella moellendorffii]
Length=376

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E   +VLNEV IDRG+SSFLTNLECYCDN FVT VQGDGLILST SGSTAYSL+AGGSMV
Sbjct  211  EEVYIVLNEVAIDRGMSSFLTNLECYCDNIFVTNVQGDGLILSTPSGSTAYSLSAGGSMV  270

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HPQV  +LFTPICPHSLSFRPLILPEHVT+RV VP  SRG AW SFDG++R +L  GDAL
Sbjct  271  HPQVAAMLFTPICPHSLSFRPLILPEHVTLRVQVPEKSRGDAWVSFDGRERLQLGCGDAL  330

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            +C ++ WPVPTAC ++ST  FL  + +GL+WN+RK Q
Sbjct  331  VCHLSSWPVPTACTLESTNAFLEGVKEGLYWNMRKLQ  367



>ref|XP_002962223.1| hypothetical protein SELMODRAFT_76799 [Selaginella moellendorffii]
 gb|EFJ37483.1| hypothetical protein SELMODRAFT_76799 [Selaginella moellendorffii]
Length=378

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E   +VLNEV IDRG+SSFLTNLECYCDN FVT VQGDGLILST SGSTAYSL+AGGSMV
Sbjct  213  EEVYIVLNEVAIDRGMSSFLTNLECYCDNIFVTNVQGDGLILSTPSGSTAYSLSAGGSMV  272

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HPQV  +LFTPICPHSLSFRPLILPEHVT+RV VP  SRG AW SFDG++R +L  GDAL
Sbjct  273  HPQVAAMLFTPICPHSLSFRPLILPEHVTLRVQVPEKSRGDAWVSFDGRERLQLGCGDAL  332

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            +C ++ WPVPTAC ++ST  FL  + +GL+WN+RK Q
Sbjct  333  VCHLSSWPVPTACTLESTNAFLEGVKEGLYWNMRKLQ  369



>ref|XP_001758345.1| predicted protein [Physcomitrella patens]
 gb|EDQ76747.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = -2

Query  836  RDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            R+T  N        LVLNEV+IDRG+SS L+NLEC+CD  FVT VQGDGLI+S+ SGSTA
Sbjct  287  RETDDNTSSESAEYLVLNEVSIDRGMSSALSNLECFCDGHFVTIVQGDGLIISSPSGSTA  346

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            YSLAAGGS+VHPQVPGILFTPICPHSLSFRPLILP++VT+RV +P N RG AWASFDGK 
Sbjct  347  YSLAAGGSVVHPQVPGILFTPICPHSLSFRPLILPDYVTLRVQLPLNCRGQAWASFDGKG  406

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFD  327
            R++L  GDALI  M+ WPVP  C+ +S+ DFLRS+ + LHWN R  Q  D
Sbjct  407  RQQLWGGDALIVRMSEWPVPAVCEKESSGDFLRSVRESLHWNRRNIQLAD  456



>ref|XP_010031773.1| PREDICTED: putative NAD kinase 3 isoform X1 [Eucalyptus grandis]
Length=674

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 145/193 (75%), Gaps = 5/193 (3%)
 Frame = -2

Query  881  PLTSH*GIDCNAHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTC  705
            P+T    + C  HV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T 
Sbjct  466  PITLRRRLQC--HVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITT  523

Query  704  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVV  525
            VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVTI+V V
Sbjct  524  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTIQVEV  583

Query  524  PFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTT--DFLRSIHDGLHWN  351
            P  SRG AW SFDG+ R+ L   D LICSMA WPV TAC   ST+  DFL  I +GLHWN
Sbjct  584  PLGSRGSAWVSFDGQKREELKAEDKLICSMAQWPVLTACPDGSTSTRDFLIGIREGLHWN  643

Query  350  LRKTQSFDGPRES  312
            LRK Q  DGP++ 
Sbjct  644  LRKPQLPDGPQKQ  656



>ref|XP_010031774.1| PREDICTED: putative NAD kinase 3 isoform X2 [Eucalyptus grandis]
Length=672

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 145/193 (75%), Gaps = 5/193 (3%)
 Frame = -2

Query  881  PLTSH*GIDCNAHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTC  705
            P+T    + C  HV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T 
Sbjct  464  PITLRRRLQC--HVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITT  521

Query  704  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVV  525
            VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILP+HVTI+V V
Sbjct  522  VQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPDHVTIQVEV  581

Query  524  PFNSRGHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTT--DFLRSIHDGLHWN  351
            P  SRG AW SFDG+ R+ L   D LICSMA WPV TAC   ST+  DFL  I +GLHWN
Sbjct  582  PLGSRGSAWVSFDGQKREELKAEDKLICSMAQWPVLTACPDGSTSTRDFLIGIREGLHWN  641

Query  350  LRKTQSFDGPRES  312
            LRK Q  DGP++ 
Sbjct  642  LRKPQLPDGPQKQ  654



>gb|KCW51160.1| hypothetical protein EUGRSUZ_J00752 [Eucalyptus grandis]
Length=304

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 139/195 (71%), Gaps = 18/195 (9%)
 Frame = -2

Query  845  HVIRD-TAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
             ++RD  A+NE  T   + VLNEVTIDRG S +LTNL+CYCD+ +VT VQGDGLILSTTS
Sbjct  110  QIVRDLAAENENATAKKIFVLNEVTIDRGQSPYLTNLKCYCDDKYVTSVQGDGLILSTTS  169

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSR-------  510
            GSTAYSLAAGGSMVHPQVPGI+ TPICPHSLSFRPLILP+HV I V V   ++       
Sbjct  170  GSTAYSLAAGGSMVHPQVPGIVLTPICPHSLSFRPLILPDHVVIGVKVSDGAQRSSPLSP  229

Query  509  ----------GHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGL  360
                        A  SFDGK R+ L  G+ L CSMAPWPVPT C  DST DFL SI +GL
Sbjct  230  SPSPRTPSRHSSASVSFDGKGRQELTAGNKLKCSMAPWPVPTICLNDSTRDFLCSILEGL  289

Query  359  HWNLRKTQSFDGPRE  315
            HWN RKTQS DGP +
Sbjct  290  HWNQRKTQSSDGPTQ  304



>gb|EYU31388.1| hypothetical protein MIMGU_mgv1a004907mg [Erythranthe guttata]
Length=505

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = -2

Query  845  HVIR-DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            H+IR D AK    +EGP+LVLNEVTIDRG+S FLT L+CY D +FVT VQGDGLILSTTS
Sbjct  332  HIIRRDAAK----SEGPILVLNEVTIDRGVSPFLTYLKCYWDGTFVTDVQGDGLILSTTS  387

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAYS+AAGGSMVHPQVPGILFTPICPHSLSFRPL+LPE+V++RVVVP  SR  AW SF
Sbjct  388  GSTAYSVAAGGSMVHPQVPGILFTPICPHSLSFRPLMLPENVSVRVVVPVGSRSSAWVSF  447

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGPR  318
            DGK RK LAPGDA++CSM+  PVP A Q D T+DFLRSI   L WNLR+TQ  DGPR
Sbjct  448  DGKGRKELAPGDAIVCSMSRCPVPIASQSDPTSDFLRSIKSLLKWNLRETQLSDGPR  504



>ref|XP_002963632.1| hypothetical protein SELMODRAFT_80525, partial [Selaginella moellendorffii]
 ref|XP_002974720.1| hypothetical protein SELMODRAFT_101714, partial [Selaginella 
moellendorffii]
 gb|EFJ24240.1| hypothetical protein SELMODRAFT_101714, partial [Selaginella 
moellendorffii]
 gb|EFJ35503.1| hypothetical protein SELMODRAFT_80525, partial [Selaginella moellendorffii]
Length=345

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV+IDRG+SS LTNLECYCDN F+T VQGDGLILSTTSGSTAYSLAAGGSMVHP V
Sbjct  198  LVLNEVSIDRGMSSCLTNLECYCDNVFLTSVQGDGLILSTTSGSTAYSLAAGGSMVHPHV  257

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P ILFTPICPHSLSFRPLILP +VT++V VP     +AWASFDGKDR  L+PGD LIC M
Sbjct  258  PAILFTPICPHSLSFRPLILPGYVTLKVQVPLQ---NAWASFDGKDRVELSPGDQLICQM  314

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRK  342
            APWPVPTA   ++T  FL S+ + LHWNLRK
Sbjct  315  APWPVPTASLEEATHHFLCSVRERLHWNLRK  345



>ref|XP_010034271.1| PREDICTED: NAD(H) kinase 1-like [Eucalyptus grandis]
Length=472

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 139/195 (71%), Gaps = 18/195 (9%)
 Frame = -2

Query  845  HVIRD-TAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
             ++RD  A+NE  T   + VLNEVTIDRG S +LTNL+CYCD+ +VT VQGDGLILSTTS
Sbjct  278  QIVRDLAAENENATAKKIFVLNEVTIDRGQSPYLTNLKCYCDDKYVTSVQGDGLILSTTS  337

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSR-------  510
            GSTAYSLAAGGSMVHPQVPGI+ TPICPHSLSFRPLILP+HV I V V   ++       
Sbjct  338  GSTAYSLAAGGSMVHPQVPGIVLTPICPHSLSFRPLILPDHVVIGVKVSDGAQRSSPLSP  397

Query  509  ----------GHAWASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGL  360
                        A  SFDGK R+ L  G+ L CSMAPWPVPT C  DST DFL SI +GL
Sbjct  398  SPSPRTPSRHSSASVSFDGKGRQELTAGNKLKCSMAPWPVPTICLNDSTRDFLCSILEGL  457

Query  359  HWNLRKTQSFDGPRE  315
            HWN RKTQS DGP +
Sbjct  458  HWNQRKTQSSDGPTQ  472



>ref|XP_002949486.1| hypothetical protein VOLCADRAFT_59341 [Volvox carteri f. nagariensis]
 gb|EFJ49505.1| hypothetical protein VOLCADRAFT_59341 [Volvox carteri f. nagariensis]
Length=231

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            +VLNEV IDRGISSFLTNLECYCD +FVT VQGDGLI++T +GSTAY+LAAGGSMVHPQV
Sbjct  74   VVLNEVVIDRGISSFLTNLECYCDGTFVTHVQGDGLIVATPTGSTAYNLAAGGSMVHPQV  133

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            PGILFTPICPHSLSFRPLI P+HV++ V VP NSR   W SFDGKDR+ L  GDA++  M
Sbjct  134  PGILFTPICPHSLSFRPLIFPDHVSLCVQVPANSRAQMWCSFDGKDRQALNAGDAVVIRM  193

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDG  324
            + WPVPT C  D++ D+   + +GLHWN+R+ Q+  G
Sbjct  194  SAWPVPTVCSKDASRDWFSGVREGLHWNMRRLQAGAG  230



>ref|XP_001703150.1| hypothetical protein CHLREDRAFT_123446 [Chlamydomonas reinhardtii]
 gb|EDO96615.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=160

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            +VLNEV IDRGIS FLTNLECYCD S VT VQGDGLI++T +GSTAY+LAAGGSMVHPQV
Sbjct  3    VVLNEVVIDRGISPFLTNLECYCDGSLVTHVQGDGLIVATPTGSTAYNLAAGGSMVHPQV  62

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            PGILFTPICPHSLSFRPLI P++V + V VP NSRG  W SFDGKDR+ L  GDA++  M
Sbjct  63   PGILFTPICPHSLSFRPLIFPDYVQLCVQVPANSRGQMWCSFDGKDRQALNAGDAVMIRM  122

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDG  324
            + WPVPT C  D++ D+   + +GLHWN+R+ Q+  G
Sbjct  123  SAWPVPTVCSSDASRDWFSGVREGLHWNMRRLQAGAG  159



>ref|NP_001174403.1| Os05g0388400 [Oryza sativa Japonica Group]
 dbj|BAH93131.1| Os05g0388400, partial [Oryza sativa Japonica Group]
Length=115

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -2

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            H QVPGILFTPICPHSLSFRPLILPE+VT+RV VP NSRG AWASFDGK RK+L PGDAL
Sbjct  12   HAQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPINSRGQAWASFDGKGRKQLGPGDAL  71

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSFDGP  321
            ICS++PWPVPTAC VDSTTDFLRSIH+GLHWNLRK+QSFDGP
Sbjct  72   ICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSFDGP  113



>gb|KIZ05631.1| NAD+ kinase [Monoraphidium neglectum]
Length=938

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            +VLNEV +DRGIS FLTNLE YCD +FVT VQGDGLI++T +GSTAYSLAAGGSMVHPQV
Sbjct  780  VVLNEVVLDRGISPFLTNLETYCDGNFVTHVQGDGLIVATPTGSTAYSLAAGGSMVHPQV  839

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P +LFTPICPHSLSFRPL+ P+HV + + VP   R   W SFDGK+R  L PGDA++  +
Sbjct  840  PCVLFTPICPHSLSFRPLMFPDHVVLCIRVPPGIRSQVWCSFDGKERTELRPGDAVLIRL  899

Query  434  APWPVPTACQV-DSTTDFLRSIHDGLHWNLRKTQSFDG  324
            + WP+PT     DS+TD+  S+   L WN RK Q   G
Sbjct  900  SKWPLPTVTSANDSSTDWFVSVRQNLGWNARKVQGGAG  937



>ref|XP_005709105.1| NAD+ kinase [Galdieria sulphuraria]
 gb|EME32585.1| NAD+ kinase [Galdieria sulphuraria]
Length=481

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGS  663
            + +  A ++++    + VLN+V IDRG + FL+NL CYCD   VT +Q DG+I++T +GS
Sbjct  250  ICQANASSKYKKVAQLHVLNDVVIDRGPAPFLSNLLCYCDEHPVTRIQADGIIIATPTGS  309

Query  662  TAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDG  483
            TAYSL++GGSMVHP VPGILFTPICPHSLSFRP+I P++VT+R+ VP  +RG AW SFDG
Sbjct  310  TAYSLSSGGSMVHPAVPGILFTPICPHSLSFRPVIFPDYVTLRIKVPHRARGDAWISFDG  369

Query  482  KDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS-FD  327
            + R  L  GD++   ++ WPV T C+V+ T D+  ++   LHWN R+ Q  FD
Sbjct  370  RKRMELFKGDSVCVRVSKWPVTTFCKVNQTRDWFSAVTRCLHWNDRQEQKPFD  422



>ref|XP_011401621.1| putative NAD kinase 1 [Auxenochlorella protothecoides]
 gb|KFM28585.1| putative NAD kinase 1 [Auxenochlorella protothecoides]
Length=717

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            +VLNE+ IDRG +  LTNL  Y D +FVT VQGDGLI++T +GSTAY+LAAGGSMVHP V
Sbjct  556  MVLNELVIDRGTAPSLTNLHVYADGAFVTVVQGDGLIVATPTGSTAYNLAAGGSMVHPGV  615

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P +LFTPICPH+LS RPL+ PEHV + +VVP  +R   +ASFDGK R  LAPGD +    
Sbjct  616  PCLLFTPICPHTLSSRPLVFPEHVALTIVVPREARAGVYASFDGKHRVLLAPGDGVAVRA  675

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            + +PVPT C +D++ D+ RS+ DGL+WN R  Q
Sbjct  676  SQFPVPTVCNLDASNDWFRSVRDGLNWNARVVQ  708



>ref|XP_005708614.1| NAD+ kinase [Galdieria sulphuraria]
 gb|EME32094.1| NAD+ kinase [Galdieria sulphuraria]
Length=738

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 117/164 (71%), Gaps = 6/164 (4%)
 Frame = -2

Query  824  KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLA  645
            K EF+      +LNEV +DRG S +L NL+C+CDN ++T VQ DG+I+ST +GSTAYS++
Sbjct  576  KKEFQ------ILNEVVVDRGASPYLCNLDCFCDNKYITTVQADGIIMSTPTGSTAYSMS  629

Query  644  AGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRL  465
            AGGSMVHP VP ILFTPICPHSLSFRP+I P+ V +RV +  N+R H+WASFDGK R++L
Sbjct  630  AGGSMVHPSVPAILFTPICPHSLSFRPIIFPDSVQLRVDISENARSHSWASFDGKFRQQL  689

Query  464  APGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
              G+ L+  M+P+P PT  + D T D+   +    H+N R  Q 
Sbjct  690  KRGEGLLIRMSPYPFPTINKTDHTGDWFAGLDRSFHFNNRTIQK  733



>gb|KDD75385.1| ATP-NAD kinase, partial [Helicosporidium sp. ATCC 50920]
Length=217

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            +VLNE+ IDRG ++ LT LE Y D  FVT + GDGLI++T +GSTAY+LAAGGSM+HP V
Sbjct  54   VVLNELVIDRGQATSLTCLEVYADRHFVTVIAGDGLIVATPTGSTAYNLAAGGSMIHPGV  113

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P +LFTPICPH+L+ RPL+ P++VT+ + V  +SR  A+  FDGK+R  L PGD L+  +
Sbjct  114  PAMLFTPICPHTLASRPLVFPDNVTLSIRVSLDSRAGAYCGFDGKNRMHLRPGDGLVIKL  173

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            + WPVPT C +D++ D+  +  DGL+WN+R  Q
Sbjct  174  SQWPVPTVCNLDASHDWFLAARDGLNWNVRHAQ  206



>ref|XP_005714258.1| unnamed protein product [Chondrus crispus]
 emb|CDF34439.1| unnamed protein product [Chondrus crispus]
Length=423

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPML----VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILS  678
            H   D A N+   E  +     VLNE+ IDRG + +L+NLE  CDN  VT VQ DG+I++
Sbjct  244  HNFEDNALNDETREASVTEEHHVLNELVIDRGPAPYLSNLEVLCDNCPVTRVQADGIIVA  303

Query  677  TTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAW  498
            T +GSTAYSL++GGSMVHP VP ILFTPICPHSLSFRP++ P++VT+ + VP +SR  AW
Sbjct  304  TPTGSTAYSLSSGGSMVHPSVPAILFTPICPHSLSFRPVLFPDYVTLEIKVPQDSRASAW  363

Query  497  ASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
             SFDG+ R  L  GD ++ +++PW VPT  + D+T D+ +S+   L WN R  Q
Sbjct  364  VSFDGRHRMELMKGDKVVVTVSPWSVPTFSRADTTNDWFKSVSHCLRWNERVVQ  417



>ref|XP_005715738.1| unnamed protein product [Chondrus crispus]
 emb|CDF35919.1| unnamed protein product [Chondrus crispus]
Length=738

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 6/167 (4%)
 Frame = -2

Query  833  DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAY  654
            D  + EFE      VLNEV +DRG S +L NL+C+CD  ++T VQ DG+I+ST +GSTAY
Sbjct  538  DEIRKEFE------VLNEVVVDRGSSPYLCNLDCFCDGKYITTVQADGIIMSTPTGSTAY  591

Query  653  SLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDR  474
            S++AGGSMVHP VP ILFTPICPHSLSFRP++ P+   IR+ +   +R HAWASFDGK R
Sbjct  592  SMSAGGSMVHPSVPAILFTPICPHSLSFRPIVFPDSAKIRIQISEEARSHAWASFDGKSR  651

Query  473  KRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            ++L  GD++I  M  +PVPT  + D T D+ +S+    ++N R  Q 
Sbjct  652  QQLQRGDSMIIEMNLYPVPTVNKTDHTGDWFQSLDRAFNFNSRAIQK  698



>ref|XP_004997035.1| poly(p)/ATP nad kinase [Salpingoeca rosetta]
 gb|EGD81831.1| poly(p)/ATP nad kinase [Salpingoeca rosetta]
Length=615

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = -2

Query  791  VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVP  612
            +LNEV IDRG S +LTNL+ Y   S VTCVQGDGLI++T +GSTAYSLAAGGSMVHP VP
Sbjct  451  ILNEVVIDRGPSPYLTNLDVYVGGSLVTCVQGDGLIIATPTGSTAYSLAAGGSMVHPSVP  510

Query  611  GILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMA  432
             +L TP+CPHSLSFRP+++P  + I+V VP ++R  A+ASFDG++R+RL  G A++ + +
Sbjct  511  CVLLTPVCPHSLSFRPIVVPSSLEIKVAVPMDARNPAYASFDGRNRQRLDRGMAVVINAS  570

Query  431  PWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS-FD---GPRES  312
             WPVPT  + + + D+ RS+   L WN+R+ Q  FD   GPR S
Sbjct  571  SWPVPTINRRNPSVDWFRSLSSCLGWNVREKQKGFDVQAGPRTS  614



>ref|XP_001637014.1| predicted protein [Nematostella vectensis]
 gb|EDO44951.1| predicted protein, partial [Nematostella vectensis]
Length=369

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  791  VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVP  612
            VLNEV IDRG S +L+NLE YC++  +T VQGDGLI+ST +GSTAY++AAG SMVHP VP
Sbjct  205  VLNEVVIDRGQSPYLSNLEVYCNDYHITSVQGDGLIISTPTGSTAYAVAAGASMVHPTVP  264

Query  611  GILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMA  432
             IL TPICPHSLSFRP++LP  V I++VV   SR  AWASFDG++R+ L  G+++  + +
Sbjct  265  AILITPICPHSLSFRPIVLPAGVEIKIVVSLESRNTAWASFDGRNRQELDLGESIRITTS  324

Query  431  PWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             +PVP+   V+  TD+  S+ + LHWN+R+ Q 
Sbjct  325  VFPVPSINCVNQVTDWFTSLAECLHWNVREQQQ  357



>gb|KFM72467.1| hypothetical protein X975_06244, partial [Stegodyphus mimosarum]
Length=410

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 119/166 (72%), Gaps = 0/166 (0%)
 Frame = -2

Query  833  DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAY  654
            +T +   +     LVLNEV +DRG S +L+N++ Y D   VT VQGDGLI+ST +GSTAY
Sbjct  218  ETGEKSNKPHASFLVLNEVVVDRGPSPYLSNIDLYLDGKHVTTVQGDGLIVSTPTGSTAY  277

Query  653  SLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDR  474
            ++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V ++++V  +SR  AW SFDG++R
Sbjct  278  AVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKIMVSPDSRNLAWVSFDGRNR  337

Query  473  KRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            + L  GD+L  +M+ +P+P+ C  D  +D+  S+ + LHWN+RK Q
Sbjct  338  QELRHGDSLRVTMSIYPIPSICAQDQISDWFDSLAECLHWNVRKKQ  383



>ref|XP_001654785.1| AAEL000278-PA, partial [Aedes aegypti]
 gb|EAT48715.1| AAEL000278-PA, partial [Aedes aegypti]
Length=392

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV IDRG+SS+L+N++ + D   +T VQGDGLI+ST +GSTAYS AAG SM+HP 
Sbjct  208  ILVLNEVVIDRGLSSYLSNIDLFLDGKHITSVQGDGLIVSTPTGSTAYSAAAGASMIHPS  267

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP IL TPICPHSLSFRP++LP  V +++ +  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  268  VPAILVTPICPHSLSFRPIVLPAGVELKIALSPDSRNSSWVSFDGRNRQELLHGDSLHVT  327

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  328  TSIYPVPSICAQDQIADWFDSLAECLHWNVRKRQK  362



>ref|XP_001995437.1| GH22631 [Drosophila grimshawi]
 gb|EDV98509.1| GH22631 [Drosophila grimshawi]
Length=442

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  260  ILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  319

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ +  GD+L  +
Sbjct  320  VPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQEIFHGDSLRVT  379

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
             + +PVP+ C  D  +D+  S+ DGLHWN+RK Q
Sbjct  380  TSIYPVPSICAQDQISDWFASLADGLHWNVRKRQ  413



>ref|XP_011876642.1| PREDICTED: NAD kinase-like isoform X9 [Vollenhovia emeryi]
Length=381

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  190  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  249

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  250  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  309

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  310  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  357



>gb|EFX83515.1| hypothetical protein DAPPUDRAFT_187852 [Daphnia pulex]
Length=366

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R        T+ P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  165  ILRKDEATGKPTKAPTSLLVLNEVVIDRGPSPYLSNIDLYLDGKHITSVQGDGLIVSTPT  224

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V   SR  AW SF
Sbjct  225  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTAWVSF  284

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            DG+ R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q
Sbjct  285  DGRSRQELKHGDSLRVTTSIYPVPSICAQDQITDWFDSLAECLHWNVRKKQ  335



>ref|XP_011876641.1| PREDICTED: NAD kinase-like isoform X8 [Vollenhovia emeryi]
Length=386

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  195  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  254

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  255  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  314

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  315  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  362



>ref|XP_006564945.1| PREDICTED: NAD kinase-like isoform X10 [Apis mellifera]
 ref|XP_006615113.1| PREDICTED: NAD kinase-like isoform X9 [Apis dorsata]
Length=389

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  194  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  252

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  253  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  312

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  313  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  365



>ref|XP_006564943.1| PREDICTED: NAD kinase-like isoform X8 [Apis mellifera]
 ref|XP_006615111.1| PREDICTED: NAD kinase-like isoform X7 [Apis dorsata]
Length=418

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  223  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  281

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  282  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  341

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  342  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  394



>ref|XP_011876640.1| PREDICTED: NAD kinase-like isoform X7 [Vollenhovia emeryi]
Length=417

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  226  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  285

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  286  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  345

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  346  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  393



>ref|XP_011876637.1| PREDICTED: NAD kinase-like isoform X4 [Vollenhovia emeryi]
Length=435

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  244  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  303

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  304  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  363

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  364  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  411



>ref|XP_006564944.1| PREDICTED: NAD kinase-like isoform X9 [Apis mellifera]
 ref|XP_006615112.1| PREDICTED: NAD kinase-like isoform X8 [Apis dorsata]
Length=405

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  210  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  268

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  269  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  328

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  329  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  381



>ref|XP_011876639.1| PREDICTED: NAD kinase-like isoform X6 [Vollenhovia emeryi]
Length=421

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  230  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  289

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  290  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  349

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  350  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  397



>ref|XP_002058882.1| GJ19672 [Drosophila virilis]
 gb|EDW71417.1| GJ19672 [Drosophila virilis]
Length=448

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -2

Query  815  FETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            F     +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+S+ +GSTAY++AAG 
Sbjct  260  FPLADTILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSSPTGSTAYAVAAGA  319

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V   SR  +W SFDG++R+ L  G
Sbjct  320  SMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSFDGRNRQELFHG  379

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  +D+  S+ DGLHWN+RK Q 
Sbjct  380  DSLRVTTSIYPVPSICAQDQISDWFASLADGLHWNVRKRQK  420



>ref|XP_629620.1| NAD+ kinase family protein [Dictyostelium discoideum AX4]
 gb|EAL61200.1| NAD+ kinase family protein [Dictyostelium discoideum AX4]
Length=857

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  791  VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVP  612
            VLNEVTIDRG + +L+NLEC CD   +T VQ DGLI++T++GSTAYSL+AGGS+VHP +P
Sbjct  667  VLNEVTIDRGTNPYLSNLECCCDGKLITIVQADGLIIATSTGSTAYSLSAGGSLVHPTIP  726

Query  611  GILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMA  432
             IL TPICPH+LSFRP+ILP    + + VP  SR   WASFDGK+R+ L  GD +I   +
Sbjct  727  AILITPICPHTLSFRPVILPSTSELIIRVPETSRCPVWASFDGKNRQELKRGDYVIIKTS  786

Query  431  PWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGP  321
             W VP  C+ D + ++   +   L+WNLR+ Q SF  P
Sbjct  787  RWAVPVVCKTDESNEWFEKLAQNLNWNLRQVQKSFTAP  824



>ref|XP_006564942.1| PREDICTED: NAD kinase-like isoform X7 [Apis mellifera]
 ref|XP_006615110.1| PREDICTED: NAD kinase-like isoform X6 [Apis dorsata]
Length=426

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  231  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  289

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  290  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  349

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  350  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  402



>ref|XP_392018.3| PREDICTED: NAD kinase-like isoformX1 [Apis mellifera]
 ref|XP_003694814.1| PREDICTED: NAD kinase-like [Apis florea]
 ref|XP_006615109.1| PREDICTED: NAD kinase-like isoform X5 [Apis dorsata]
Length=436

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  241  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  299

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  300  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  359

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  412



>ref|XP_002006911.1| GI21327 [Drosophila mojavensis]
 gb|EDW10846.1| GI21327 [Drosophila mojavensis]
Length=412

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 118/170 (69%), Gaps = 0/170 (0%)
 Frame = -2

Query  845  HVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            H +   A+        +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +G
Sbjct  214  HAVDSNAEPSSSLANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTG  273

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+H  VP I+ TPICPHSLSFRP+++P  V +++ V   SR  +W SFD
Sbjct  274  STAYAVAAGASMIHSSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSFD  333

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
            G++R+ L  GD+L  + + +PVP+ C  D  +D+  S+ DGLHWN+RK Q
Sbjct  334  GRNRQELFHGDSLRVTTSIYPVPSICAQDQISDWFASLADGLHWNVRKRQ  383



>ref|XP_008470542.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470543.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470544.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470545.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
Length=364

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  165  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  224

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  225  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  284

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  285  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  336



>ref|XP_011058884.1| PREDICTED: NAD kinase-like isoform X6 [Acromyrmex echinatior]
Length=386

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  192  IIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  250

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  251  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  310

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  311  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  362



>ref|XP_001868717.1| poly(p)/ATP NAD kinase [Culex quinquefasciatus]
 gb|EDS27527.1| poly(p)/ATP NAD kinase [Culex quinquefasciatus]
Length=470

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV IDRG+SS+LTN++ + D   +T VQGDGLI+ST +GSTAYS AAG SM+HP 
Sbjct  286  ILVLNEVVIDRGMSSYLTNIDLFLDGKHITSVQGDGLIVSTPTGSTAYSAAAGASMIHPS  345

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP IL +PICPHSLSFRP++LP  V +++ +  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  346  VPAILVSPICPHSLSFRPIVLPAGVELKIALSPDSRNSSWVSFDGRNRQELLHGDSLHVT  405

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  406  TSIYPVPSICAQDQIADWFDSLAECLHWNVRKRQK  440



>ref|XP_011876638.1| PREDICTED: NAD kinase-like isoform X5 [Vollenhovia emeryi]
Length=431

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  240  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  299

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  300  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  359

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  407



>ref|XP_006564937.1| PREDICTED: NAD kinase-like isoform X2 [Apis mellifera]
 ref|XP_006615105.1| PREDICTED: NAD kinase-like isoform X1 [Apis dorsata]
Length=467

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  272  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  330

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  331  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  390

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  391  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  443



>ref|XP_011253171.1| PREDICTED: NAD kinase isoform X9 [Camponotus floridanus]
Length=359

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  175  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  234

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  235  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  294

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  295  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  335



>ref|XP_011696113.1| PREDICTED: NAD kinase-like isoform X10 [Wasmannia auropunctata]
Length=357

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  163  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  222

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  223  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  282

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  283  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  333



>ref|XP_011161171.1| PREDICTED: NAD kinase-like isoform X7 [Solenopsis invicta]
Length=358

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  181  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  240

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  241  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  300

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  301  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  334



>ref|XP_002424361.1| NADH kinase, putative [Pediculus humanus corporis]
 gb|EEB11623.1| NADH kinase, putative [Pediculus humanus corporis]
Length=426

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = -2

Query  824  KNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYS  651
            +NE E++ P  +LVLNEV +DRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY+
Sbjct  234  RNE-ESKSPTSLLVLNEVVVDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYA  292

Query  650  LAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRK  471
            +AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +RV +  +SR  +W SFDG++R+
Sbjct  293  VAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELRVAISPDSRNTSWVSFDGRNRQ  352

Query  470  RLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
             L  GD+L  + + +PVP+ C  D  +D+  S+ + LHWN+RK Q
Sbjct  353  ELFHGDSLRVTTSIYPVPSICAQDQISDWFDSLAECLHWNVRKRQ  397



>ref|XP_012139742.1| PREDICTED: NAD kinase-like isoform X9 [Megachile rotundata]
Length=359

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  181  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  240

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  241  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  300

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  301  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  335



>ref|XP_012139743.1| PREDICTED: NAD kinase-like isoform X10 [Megachile rotundata]
Length=357

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  179  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  238

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  239  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  298

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  299  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  333



>ref|XP_011058883.1| PREDICTED: NAD kinase-like isoform X5 [Acromyrmex echinatior]
Length=403

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  209  IIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  267

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  268  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  327

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  328  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  379



>ref|XP_011058880.1| PREDICTED: NAD kinase-like isoform X3 [Acromyrmex echinatior]
 gb|EGI62840.1| NAD kinase [Acromyrmex echinatior]
Length=435

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  241  IIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  299

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  300  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  359

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  411



>ref|XP_004517712.1| PREDICTED: NAD kinase-like isoform X5 [Ceratitis capitata]
 ref|XP_004517713.1| PREDICTED: NAD kinase-like isoform X6 [Ceratitis capitata]
Length=394

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E  +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY++AAG SM+
Sbjct  207  ETNILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAVAAGASMI  266

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HP VP I+ TPICPHSLSFRP+++P  V +R+ +  +SR  +W SFDG++R+ L  GD L
Sbjct  267  HPSVPAIMVTPICPHSLSFRPIVVPAGVELRISISPDSRNTSWVSFDGRNRQELLHGDCL  326

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
              + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  327  RVTTSIYPVPSICAQDQITDWFDSLAECLHWNVRKKQK  364



>ref|XP_004517709.1| PREDICTED: NAD kinase-like isoform X2 [Ceratitis capitata]
Length=599

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 118/162 (73%), Gaps = 0/162 (0%)
 Frame = -2

Query  818  EFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAG  639
            E E+E  +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY++AAG
Sbjct  408  ETESETNILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAVAAG  467

Query  638  GSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAP  459
             SM+HP VP I+ TPICPHSLSFRP+++P  V +R+ +  +SR  +W SFDG++R+ L  
Sbjct  468  ASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELRISISPDSRNTSWVSFDGRNRQELLH  527

Query  458  GDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            GD L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  528  GDCLRVTTSIYPVPSICAQDQITDWFDSLAECLHWNVRKKQK  569



>ref|XP_008470541.1| PREDICTED: NAD kinase-like isoform X11 [Diaphorina citri]
Length=387

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  188  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  247

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  248  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  307

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  308  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  359



>ref|XP_011058881.1| PREDICTED: NAD kinase-like isoform X4 [Acromyrmex echinatior]
 ref|XP_011058882.1| PREDICTED: NAD kinase-like isoform X4 [Acromyrmex echinatior]
Length=417

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  223  IIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  281

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  282  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  341

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  342  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  393



>ref|XP_012060592.1| PREDICTED: NAD kinase-like isoform X2 [Atta cephalotes]
Length=435

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +L+LNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  241  IIRKNEDSQL-TEPPTNLLILNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  299

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  300  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  359

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  411



>ref|XP_006564938.1| PREDICTED: NAD kinase-like isoform X3 [Apis mellifera]
 ref|XP_006564939.1| PREDICTED: NAD kinase-like isoform X4 [Apis mellifera]
 ref|XP_006564940.1| PREDICTED: NAD kinase-like isoform X5 [Apis mellifera]
 ref|XP_006564941.1| PREDICTED: NAD kinase-like isoform X6 [Apis mellifera]
Length=452

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  257  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  315

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  316  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  375

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  376  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  428



>ref|XP_011253170.1| PREDICTED: NAD kinase isoform X8 [Camponotus floridanus]
Length=386

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  202  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  261

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  262  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  321

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  322  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  362



>gb|EFZ17327.1| hypothetical protein SINV_04986, partial [Solenopsis invicta]
Length=389

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  212  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  271

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  272  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  331

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  332  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  365



>ref|XP_006615106.1| PREDICTED: NAD kinase-like isoform X2 [Apis dorsata]
 ref|XP_006615107.1| PREDICTED: NAD kinase-like isoform X3 [Apis dorsata]
 ref|XP_006615108.1| PREDICTED: NAD kinase-like isoform X4 [Apis dorsata]
Length=452

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTT  672
            ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST 
Sbjct  257  IMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTP  315

Query  671  SGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWAS  492
            +GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W S
Sbjct  316  TGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVS  375

Query  491  FDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            FDG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  376  FDGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  428



>ref|XP_011876633.1| PREDICTED: NAD kinase-like isoform X1 [Vollenhovia emeryi]
Length=478

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  287  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  346

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  347  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  406

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  407  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  454



>ref|XP_011161170.1| PREDICTED: NAD kinase-like isoform X6 [Solenopsis invicta]
Length=386

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  209  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  268

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  269  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  328

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  329  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  362



>ref|XP_008470539.1| PREDICTED: NAD kinase-like isoform X9 [Diaphorina citri]
Length=420

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  221  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  280

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  281  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  340

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  341  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  392



>ref|XP_011876636.1| PREDICTED: NAD kinase-like isoform X3 [Vollenhovia emeryi]
Length=441

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG SS+L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  250  KNEDSQPTEPPTNLLVLNEVVVDRGASSYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  309

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  310  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  369

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +P+P+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  370  RQELFHGDSLKVTTSVYPLPSICAADQMTDWFDSLAECLHWNVRKRQK  417



>ref|XP_003488899.1| PREDICTED: NAD kinase-like [Bombus impatiens]
Length=435

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +I    + + E + P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  240  IIMRKGEEDKEAKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  299

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  300  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  359

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  DGRNRQELFHGDSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  411



>ref|XP_011161169.1| PREDICTED: NAD kinase-like isoform X5 [Solenopsis invicta]
Length=418

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  241  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  300

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  301  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  360

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  361  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  394



>ref|XP_012139741.1| PREDICTED: NAD kinase-like isoform X8 [Megachile rotundata]
Length=385

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  207  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  266

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  267  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  326

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  327  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  361



>ref|XP_011696112.1| PREDICTED: NAD kinase-like isoform X9 [Wasmannia auropunctata]
Length=386

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  192  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  251

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  252  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  311

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  312  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  362



>ref|XP_008470540.1| PREDICTED: NAD kinase-like isoform X10 [Diaphorina citri]
Length=412

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  213  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  272

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  273  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  332

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  333  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  384



>ref|XP_011696109.1| PREDICTED: NAD kinase-like isoform X6 [Wasmannia auropunctata]
Length=417

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  223  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  282

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  283  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  342

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  343  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  393



>ref|XP_011634034.1| PREDICTED: NAD kinase-like isoform X6 [Pogonomyrmex barbatus]
Length=417

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  226  KNEDSQPTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  285

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  286  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  345

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  346  RQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  393



>ref|XP_011253167.1| PREDICTED: NAD kinase isoform X5 [Camponotus floridanus]
Length=417

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  233  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  292

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  293  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  352

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  353  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  393



>ref|XP_002590542.1| hypothetical protein BRAFLDRAFT_124524 [Branchiostoma floridae]
 gb|EEN46553.1| hypothetical protein BRAFLDRAFT_124524 [Branchiostoma floridae]
Length=399

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = -2

Query  857  DCNAHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILS  678
            +C++H+      N  E    + VLNEV IDRG S +L +L+ Y +   VT VQGDGLI+S
Sbjct  209  ECDSHI------NSIEKPKKIQVLNEVVIDRGPSPYLCHLDLYLEGRHVTSVQGDGLIVS  262

Query  677  TTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAW  498
            T +GSTAY++AAG SMVHP VP I+ TPICPHSLSFRP+++P  V I+V+V   SRG AW
Sbjct  263  TPTGSTAYAVAAGASMVHPNVPAIMVTPICPHSLSFRPIVVPAGVEIKVMVSPESRGSAW  322

Query  497  ASFDGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
             S DG++R+ +  GD++  + + +P+P+ C++D  +D+  S+ + LHWN+R+ Q
Sbjct  323  VSLDGRNRQEIKVGDSVRITTSEFPIPSICKLDQISDWFDSLAECLHWNVRRPQ  376



>ref|XP_011253168.1| PREDICTED: NAD kinase isoform X6 [Camponotus floridanus]
Length=417

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  233  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  292

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  293  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  352

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  353  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  393



>ref|XP_008470538.1| PREDICTED: NAD kinase-like isoform X8 [Diaphorina citri]
Length=420

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  221  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  280

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  281  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  340

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  341  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  392



>ref|XP_008206815.1| PREDICTED: NAD kinase-like isoform X10 [Nasonia vitripennis]
 ref|XP_008206816.1| PREDICTED: NAD kinase-like isoform X10 [Nasonia vitripennis]
Length=359

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  181  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  240

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  241  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  300

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  301  TSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  335



>gb|KFB51324.1| AGAP011122-PA-like protein [Anopheles sinensis]
Length=610

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV IDRG+SS+L+N++ + D   +T VQGDGLI+ST +GSTAYS AAG SM+HP 
Sbjct  426  ILVLNEVVIDRGLSSYLSNIDLFLDGKHITSVQGDGLIVSTPTGSTAYSAAAGASMIHPS  485

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP IL TPICPHSLSFRP++LP  V +++ +  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  486  VPAILVTPICPHSLSFRPIVLPAGVELKIAISPDSRNSSWVSFDGRNRQELLHGDSLHVT  545

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ  336
             + +PVP+ C  D   D+  S+ + LHWN+RK Q
Sbjct  546  TSIYPVPSICAQDQXADWFDSLAECLHWNVRKRQ  579



>ref|XP_011634031.1| PREDICTED: NAD kinase-like isoform X4 [Pogonomyrmex barbatus]
Length=435

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  244  KNEDSQPTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  303

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  304  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  363

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  364  RQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  411



>ref|XP_011634036.1| PREDICTED: NAD kinase-like isoform X7 [Pogonomyrmex barbatus]
Length=402

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  211  KNEDSQPTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  270

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  271  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  330

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  331  RQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  378



>ref|XP_011161167.1| PREDICTED: NAD kinase-like isoform X3 [Solenopsis invicta]
Length=436

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  259  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  318

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  319  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  378

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  379  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  412



>ref|XP_011161168.1| PREDICTED: NAD kinase-like isoform X4 [Solenopsis invicta]
Length=423

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  794  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQV  615
            LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP V
Sbjct  246  LVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPSV  305

Query  614  PGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSM  435
            P I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  + 
Sbjct  306  PAIMITPICPHSLSFRPIVVPAGVELKISVSLDSRNTSWVSFDGRNRQELRHGDSLKVTT  365

Query  434  APWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  366  SIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  399



>ref|XP_011495464.1| PREDICTED: NAD kinase-like isoform X8 [Ceratosolen solmsi marchali]
 ref|XP_011495472.1| PREDICTED: NAD kinase-like isoform X8 [Ceratosolen solmsi marchali]
Length=359

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  181  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  240

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  241  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRIT  300

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  301  TSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  335



>ref|XP_012139740.1| PREDICTED: NAD kinase-like isoform X7 [Megachile rotundata]
Length=417

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  239  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  298

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  299  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  358

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  359  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  393



>ref|XP_011696110.1| PREDICTED: NAD kinase-like isoform X7 [Wasmannia auropunctata]
Length=403

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  209  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  268

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  269  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  328

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  329  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  379



>ref|XP_011148641.1| PREDICTED: NAD kinase-like isoform X8 [Harpegnathos saltator]
Length=356

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  178  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMMHPS  237

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  238  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNSSWVSFDGRNRQELLHGDSLKVT  297

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  298  TSIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  332



>ref|XP_011253169.1| PREDICTED: NAD kinase isoform X7 [Camponotus floridanus]
Length=397

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  213  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  272

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  273  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  332

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  333  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  373



>ref|XP_011148643.1| PREDICTED: NAD kinase-like isoform X10 [Harpegnathos saltator]
Length=358

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  180  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMMHPS  239

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  240  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNSSWVSFDGRNRQELLHGDSLKVT  299

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  300  TSIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  334



>ref|XP_012139737.1| PREDICTED: NAD kinase-like isoform X5 [Megachile rotundata]
Length=422

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  244  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  303

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  304  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  363

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  364  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  398



>ref|XP_011696111.1| PREDICTED: NAD kinase-like isoform X8 [Wasmannia auropunctata]
Length=388

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  194  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  253

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  254  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  313

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  314  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  364



>ref|XP_011253165.1| PREDICTED: NAD kinase isoform X3 [Camponotus floridanus]
Length=437

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  253  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  312

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  313  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  372

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  373  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  413



>ref|XP_003291185.1| hypothetical protein DICPUDRAFT_155765 [Dictyostelium purpureum]
 gb|EGC32307.1| hypothetical protein DICPUDRAFT_155765 [Dictyostelium purpureum]
Length=745

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  791  VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVP  612
            VLNEVTIDRG + +L+NLEC CD   +T VQ DGLI++T++GSTAYSL+AGGS+VHP +P
Sbjct  565  VLNEVTIDRGTNPYLSNLECCCDGKLITIVQADGLIIATSTGSTAYSLSAGGSLVHPTIP  624

Query  611  GILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMA  432
             IL TPICPH+LSFRP+ILP    + + VP  SR   WASFDGK+R+ L  GD +I   +
Sbjct  625  AILITPICPHTLSFRPVILPSTSELVIRVPETSRCPVWASFDGKNRQELNRGDFVIIKTS  684

Query  431  PWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQ-SFDGPR  318
             W VP  C+ D + ++   +   L+WN+R  Q SF+ P 
Sbjct  685  RWAVPVVCKTDESNEWFEKLAQNLNWNVRMVQKSFNPPN  723



>ref|XP_011696106.1| PREDICTED: NAD kinase-like isoform X4 [Wasmannia auropunctata]
Length=436

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  242  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  301

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  302  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  361

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  362  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  412



>ref|XP_012139738.1| PREDICTED: NAD kinase-like isoform X6 [Megachile rotundata]
Length=421

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  243  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  302

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  303  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  362

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  363  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  397



>ref|XP_011696107.1| PREDICTED: NAD kinase-like isoform X5 [Wasmannia auropunctata]
 ref|XP_011696108.1| PREDICTED: NAD kinase-like isoform X5 [Wasmannia auropunctata]
Length=419

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  842  VIRDTAKNEF-ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSG  666
            +IR    ++  E    +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +G
Sbjct  225  IIRKNEDSQLAEPPTSLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTG  284

Query  665  STAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFD  486
            STAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFD
Sbjct  285  STAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFD  344

Query  485  GKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            G++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  345  GRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  395



>ref|XP_011253166.1| PREDICTED: NAD kinase isoform X4 [Camponotus floridanus]
Length=423

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  239  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  298

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  299  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  358

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  359  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  399



>ref|XP_011634032.1| PREDICTED: NAD kinase-like isoform X5 [Pogonomyrmex barbatus]
 ref|XP_011634033.1| PREDICTED: NAD kinase-like isoform X5 [Pogonomyrmex barbatus]
Length=425

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -2

Query  824  KNEFE--TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTA  657
            KNE    TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTA
Sbjct  234  KNEDSQPTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTA  293

Query  656  YSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKD  477
            Y++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++
Sbjct  294  YAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRN  353

Query  476  RKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  354  RQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  401



>ref|XP_002063997.1| GK15608 [Drosophila willistoni]
 gb|EDW74983.1| GK15608 [Drosophila willistoni]
Length=475

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = -2

Query  836  RDTAKNEF-ETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            R + K +   TE P   +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +
Sbjct  276  RKSEKRQLIHTEAPPNSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPT  335

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V   SR  +W SF
Sbjct  336  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSF  395

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+    D  +D+  S+ DGLHWN+RK Q 
Sbjct  396  DGRNRQELFHGDSLRVTTSIYPVPSISAQDQISDWFASLADGLHWNVRKRQK  447



>ref|XP_003702819.1| PREDICTED: NAD kinase-like isoform X4 [Megachile rotundata]
Length=435

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  257  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  316

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  317  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  376

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  377  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  411



>ref|XP_005537945.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81909.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=511

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  791  VLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVP  612
            VLNEV +DRG + FL+NLECYCD+  VT +Q DG+IL+T +GSTAYSL++ GSMVHP VP
Sbjct  262  VLNEVVVDRGPAPFLSNLECYCDDFPVTRIQADGVILATPTGSTAYSLSSNGSMVHPSVP  321

Query  611  GILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICSMA  432
             IL TPICPHSLSFRP+I P++VT+++ V  ++RG AW SFDG+ R  L  GD L   ++
Sbjct  322  AILLTPICPHSLSFRPVIFPDYVTLKIRVSRHARGSAWVSFDGRARTELQRGDYLRVQIS  381

Query  431  PWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQSF  330
            PWP+ T    D T D+ RS+   L WN R  Q  
Sbjct  382  PWPLATLNYNDQTQDWFRSVSRCLRWNERPMQRL  415



>ref|XP_011297427.1| PREDICTED: NAD kinase-like isoform X2 [Fopius arisanus]
Length=428

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  250  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  309

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +R+ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  310  VPAIMITPICPHSLSFRPIVVPAGVELRISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  369

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  370  TSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  404



>ref|XP_003426645.1| PREDICTED: NAD kinase-like isoform X9 [Nasonia vitripennis]
Length=380

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  202  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  261

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  262  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  321

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  322  TSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  356



>ref|XP_011058878.1| PREDICTED: NAD kinase-like isoform X1 [Acromyrmex echinatior]
Length=441

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  247  IIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  305

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  306  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  365

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  366  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  417



>dbj|BAM19258.1| poly(p)/ATP NAD kinase [Papilio polytes]
Length=414

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            V+R T+  +   + P  +LVLNEV +DRG S +L+N++ + D   +T VQGDGLI+ST +
Sbjct  212  VLRKTSNEDNNKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQGDGLIVSTPT  271

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ +   +R   W SF
Sbjct  272  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKIALSPEARNAMWVSF  331

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  +D+  S+ + LHWN+RK Q 
Sbjct  332  DGRNRQALQHGDSLYVTTSVYPVPSICAQDQISDWFDSLAECLHWNVRKKQK  383



>ref|XP_012060591.1| PREDICTED: NAD kinase-like isoform X1 [Atta cephalotes]
Length=441

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            +IR    ++  TE P  +L+LNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +
Sbjct  247  IIRKNEDSQL-TEPPTNLLILNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPT  305

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SF
Sbjct  306  GSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSF  365

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  366  DGRNRQELFHGDSLKVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  417



>ref|XP_011436211.1| PREDICTED: NAD kinase-like isoform X4 [Crassostrea gigas]
Length=365

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGS  633
            +++  MLV NEV +DRG S +L N++ Y +   VT VQGDGLI+ST +GSTAY++AAG S
Sbjct  184  QSKTHMLVFNEVVVDRGQSPYLCNIDLYVEGKLVTTVQGDGLIISTPTGSTAYAVAAGAS  243

Query  632  MVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGD  453
            MVHP VP I+ TPICPHSLSFRP+++P  V I+++V   +R  AW S DG++R+ +  GD
Sbjct  244  MVHPNVPAIVITPICPHSLSFRPVVVPAGVEIKIMVSPEARNSAWVSLDGRNRQEIFEGD  303

Query  452  ALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            ++  + A +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  304  SVRITTAQYPVPSVCAKDQMDDWFESLAECLHWNVRKPQK  343



>ref|XP_011346933.1| PREDICTED: NAD kinase-like isoform X7 [Cerapachys biroi]
Length=388

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGS  633
            E+   +LVLNEV +DRG S +L+N++ + +   VT VQGDGLI+ST +GSTAY++AAG S
Sbjct  205  ESSTTLLVLNEVVVDRGPSPYLSNIDLFIEGKHVTSVQGDGLIVSTPTGSTAYAVAAGAS  264

Query  632  MVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGD  453
            M+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD
Sbjct  265  MIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGD  324

Query  452  ALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            +L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  325  SLKVTTSVYPVPSICAADQITDWFDSLAECLHWNVRKRQK  364



>ref|XP_008550791.1| PREDICTED: NAD kinase isoform X6 [Microplitis demolitor]
 ref|XP_008550792.1| PREDICTED: NAD kinase isoform X6 [Microplitis demolitor]
 ref|XP_008550795.1| PREDICTED: NAD kinase isoform X8 [Microplitis demolitor]
Length=359

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV IDRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  181  LLVLNEVVIDRGPSPYLSNIDLFIDGKHVTNVQGDGLIVSTPTGSTAYAVAAGASMIHPS  240

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  241  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  300

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  301  TSIYPVPSICASDQITDWFDSLAECLHWNVRKRQK  335



>ref|XP_004517711.1| PREDICTED: NAD kinase-like isoform X4 [Ceratitis capitata]
Length=476

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E  +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY++AAG SM+
Sbjct  289  ETNILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAVAAGASMI  348

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HP VP I+ TPICPHSLSFRP+++P  V +R+ +  +SR  +W SFDG++R+ L  GD L
Sbjct  349  HPSVPAIMVTPICPHSLSFRPIVVPAGVELRISISPDSRNTSWVSFDGRNRQELLHGDCL  408

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
              + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  409  RVTTSIYPVPSICAQDQITDWFDSLAECLHWNVRKKQK  446



>ref|XP_004517710.1| PREDICTED: NAD kinase-like isoform X3 [Ceratitis capitata]
Length=481

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  806  EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMV  627
            E  +LVLNEV IDRG S +L+N++ + D  ++T VQGDGLI+ST +GSTAY++AAG SM+
Sbjct  294  ETNILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAVAAGASMI  353

Query  626  HPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDAL  447
            HP VP I+ TPICPHSLSFRP+++P  V +R+ +  +SR  +W SFDG++R+ L  GD L
Sbjct  354  HPSVPAIMVTPICPHSLSFRPIVVPAGVELRISISPDSRNTSWVSFDGRNRQELLHGDCL  413

Query  446  ICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
              + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  414  RVTTSIYPVPSICAQDQITDWFDSLAECLHWNVRKKQK  451



>ref|XP_011148640.1| PREDICTED: NAD kinase-like isoform X7 [Harpegnathos saltator]
Length=385

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  207  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMMHPS  266

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  267  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNSSWVSFDGRNRQELLHGDSLKVT  326

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  327  TSIYPVPSICATDQITDWFDSLAECLHWNVRKRQK  361



>ref|XP_012139732.1| PREDICTED: NAD kinase-like isoform X1 [Megachile rotundata]
Length=442

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  264  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  323

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  324  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  383

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  384  TSKYPVPSICAADQITDWFDSLAECLHWNVRKKQK  418



>ref|XP_011253163.1| PREDICTED: NAD kinase isoform X1 [Camponotus floridanus]
Length=440

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  809  TEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGG  636
            TE P  +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG 
Sbjct  256  TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGA  315

Query  635  SMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPG  456
            SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  G
Sbjct  316  SMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSRDSRNTSWVSFDGRNRQELFHG  375

Query  455  DALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            D+L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  376  DSLRVTTSIYPVPSICAADQITDWFDSLAECLHWNVRKRQK  416



>ref|XP_011346928.1| PREDICTED: NAD kinase-like isoform X6 [Cerapachys biroi]
Length=414

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  812  ETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGS  633
            E+   +LVLNEV +DRG S +L+N++ + +   VT VQGDGLI+ST +GSTAY++AAG S
Sbjct  231  ESSTTLLVLNEVVVDRGPSPYLSNIDLFIEGKHVTSVQGDGLIVSTPTGSTAYAVAAGAS  290

Query  632  MVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGD  453
            M+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD
Sbjct  291  MIHPSVPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGD  350

Query  452  ALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            +L  + + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  351  SLKVTTSVYPVPSICAADQITDWFDSLAECLHWNVRKRQK  390



>ref|XP_008470537.1| PREDICTED: NAD kinase-like isoform X7 [Diaphorina citri]
Length=442

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  842  VIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTS  669
            ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQGDGLI+ST +
Sbjct  243  IMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPT  302

Query  668  GSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASF  489
            GSTAY++AAG SM+HP VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  AW SF
Sbjct  303  GSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSRNTAWVSF  362

Query  488  DGKDRKRLAPGDALICSMAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
            DG++R+ L  GD+L  + + +PVP+ C  D   D+  S+ + LHWN+RK Q 
Sbjct  363  DGRNRQELLHGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQK  414



>ref|XP_003426644.1| PREDICTED: NAD kinase-like isoform X5 [Nasonia vitripennis]
Length=418

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  797  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQ  618
            +LVLNEV +DRG S +L+N++ + D   VT VQGDGLI+ST +GSTAY++AAG SM+HP 
Sbjct  240  LLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQGDGLIVSTPTGSTAYAVAAGASMIHPS  299

Query  617  VPGILFTPICPHSLSFRPLILPEHVTIRVVVPFNSRGHAWASFDGKDRKRLAPGDALICS  438
            VP I+ TPICPHSLSFRP+++P  V +++ V  +SR  +W SFDG++R+ L  GD+L  +
Sbjct  300  VPAIMITPICPHSLSFRPIVVPAGVELKISVSPDSRNTSWVSFDGRNRQELFHGDSLRVT  359

Query  437  MAPWPVPTACQVDSTTDFLRSIHDGLHWNLRKTQS  333
             + +PVP+ C  D  TD+  S+ + LHWN+RK Q 
Sbjct  360  TSIYPVPSICAADQITDWFDSLAECLHWNVRKKQK  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996