BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4131

Length=921
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11900.1|  unnamed protein product                                153   9e-39   Coffea canephora [robusta coffee]
dbj|BAF49288.1|  hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6''...    150   5e-38   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_009588215.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    148   3e-37   Nicotiana tomentosiformis
emb|CDP11907.1|  unnamed protein product                                142   7e-37   Coffea canephora [robusta coffee]
emb|CAN71050.1|  hypothetical protein VITISV_003717                     147   8e-37   Vitis vinifera
ref|XP_002276090.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    147   1e-36   Vitis vinifera
ref|XP_009593467.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    146   2e-36   Nicotiana tomentosiformis
gb|AAQ63615.1|  anthocyanidin 3-O-glucoside-6''-O-malonyltransferase    146   2e-36   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006367188.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    143   3e-35   Solanum tuberosum [potatoes]
emb|CDP11905.1|  unnamed protein product                                139   4e-34   Coffea canephora [robusta coffee]
ref|XP_009769443.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    139   6e-34   Nicotiana sylvestris
sp|Q9ZWR8.1|ANTA_GENTR  RecName: Full=Anthocyanin 5-aromatic acyl...    139   6e-34   Gentiana triflora
dbj|BAD44688.1|  Hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6-O...    139   8e-34   Gentiana scabra var. buergeri
gb|AAQ63616.1|  anthocyanidin 3-O-glucoside-3'',6''-O-dimalonyltr...    139   1e-33   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAO38058.1|  malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6...    136   6e-33   Pericallis cruenta
sp|Q8GSN8.1|3MAT_DAHPI  RecName: Full=Malonyl-coenzyme A:anthocya...    136   6e-33   Dahlia pinnata
ref|XP_009397893.1|  PREDICTED: phenolic glucoside malonyltransfe...    136   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275913.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    135   2e-32   Vitis vinifera
ref|XP_009620758.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    134   3e-32   Nicotiana tomentosiformis
ref|XP_011090949.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    134   3e-32   Sesamum indicum [beniseed]
ref|XP_009400673.1|  PREDICTED: phenolic glucoside malonyltransfe...    133   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011076802.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    133   8e-32   Sesamum indicum [beniseed]
ref|XP_007043451.1|  HXXXD-type acyl-transferase family protein, ...    133   9e-32   
ref|XP_009620757.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    133   1e-31   Nicotiana tomentosiformis
ref|XP_007043459.1|  HXXXD-type acyl-transferase family protein, ...    132   2e-31   
ref|XP_009780993.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    132   2e-31   Nicotiana sylvestris
ref|XP_011093436.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    132   2e-31   Sesamum indicum [beniseed]
dbj|BAD93691.1|  malonyltransferase                                     132   2e-31   Nicotiana tabacum [American tobacco]
ref|XP_004248143.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    132   2e-31   
ref|XP_007215354.1|  hypothetical protein PRUPE_ppa005488mg             132   2e-31   Prunus persica
ref|XP_011093437.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    131   3e-31   Sesamum indicum [beniseed]
ref|XP_010657393.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    131   3e-31   Vitis vinifera
ref|XP_011093435.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    131   4e-31   Sesamum indicum [beniseed]
ref|XP_009400945.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    130   4e-31   
ref|XP_011100332.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    130   7e-31   Sesamum indicum [beniseed]
gb|EPS62795.1|  hypothetical protein M569_11994                         130   9e-31   Genlisea aurea
dbj|BAF99690.1|  putative anthocyanin acyltransferase                   130   1e-30   Lobelia erinus
ref|XP_011079054.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    129   2e-30   Sesamum indicum [beniseed]
dbj|BAF99691.1|  putative anthocyanin acyltransferase                   129   2e-30   Lobelia erinus
ref|XP_008231007.1|  PREDICTED: phenolic glucoside malonyltransfe...    128   3e-30   
ref|XP_009400675.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    128   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011079053.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    128   4e-30   Sesamum indicum [beniseed]
gb|AAS77403.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        127   1e-29   Glandularia x hybrida [garden verbena]
dbj|BAF99692.1|  putative anthocyanin acyltransferase                   127   1e-29   Lobelia erinus
gb|KHN48829.1|  Anthocyanin 5-aromatic acyltransferase                  123   1e-29   Glycine soja [wild soybean]
dbj|BAF99693.1|  putative anthocyanin acyltransferase                   127   2e-29   Lobelia erinus
ref|XP_011047482.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    126   2e-29   Populus euphratica
ref|XP_011100333.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    126   2e-29   
ref|XP_002326110.2|  anthocyanin acyltransferase family protein         126   3e-29   
gb|EYU24860.1|  hypothetical protein MIMGU_mgv1a022453mg                125   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_004489467.1|  PREDICTED: phenolic glucoside malonyltransfe...    125   4e-29   Cicer arietinum [garbanzo]
ref|XP_011100334.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    125   4e-29   Sesamum indicum [beniseed]
emb|CBI18011.3|  unnamed protein product                                125   4e-29   Vitis vinifera
ref|XP_007217864.1|  hypothetical protein PRUPE_ppa021495mg             125   5e-29   Prunus persica
gb|EYU26095.1|  hypothetical protein MIMGU_mgv1a006012mg                125   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_011100429.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    124   8e-29   Sesamum indicum [beniseed]
ref|XP_007043458.1|  HXXXD-type acyl-transferase family protein, ...    124   1e-28   
ref|XP_011047481.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    124   1e-28   Populus euphratica
emb|CAN83656.1|  hypothetical protein VITISV_009941                     124   2e-28   Vitis vinifera
pdb|2XR7|A  Chain A, Crystal Structure Of Nicotiana Tabacum Malon...    123   2e-28   Nicotiana tabacum [American tobacco]
ref|XP_011090972.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    124   2e-28   Sesamum indicum [beniseed]
gb|AAS77402.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        123   2e-28   Glandularia x hybrida [garden verbena]
ref|NP_001236819.1|  malonyl-CoA:isoflavone 7-O-glucoside-6''-O-m...    123   2e-28   Glycine max [soybeans]
ref|XP_004306152.1|  PREDICTED: phenolic glucoside malonyltransfe...    123   3e-28   Fragaria vesca subsp. vesca
ref|XP_007217231.1|  hypothetical protein PRUPE_ppa005502mg             123   3e-28   
ref|XP_008231014.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    123   3e-28   Prunus mume [ume]
pdb|2E1T|A  Chain A, Crystal Structure Of Dendranthema Morifolium...    123   3e-28   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EYU36651.1|  hypothetical protein MIMGU_mgv1a006328mg                123   3e-28   Erythranthe guttata [common monkey flower]
gb|EYU24862.1|  hypothetical protein MIMGU_mgv1a006330mg                122   4e-28   Erythranthe guttata [common monkey flower]
gb|KEH25060.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    122   4e-28   Medicago truncatula
gb|EYU17682.1|  hypothetical protein MIMGU_mgv1a023077mg                122   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_010657397.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    120   9e-28   Vitis vinifera
ref|XP_006475382.1|  PREDICTED: phenolic glucoside malonyltransfe...    121   1e-27   Citrus sinensis [apfelsine]
ref|XP_008361942.1|  PREDICTED: phenolic glucoside malonyltransfe...    121   1e-27   
emb|CAN83833.1|  hypothetical protein VITISV_039456                     121   1e-27   Vitis vinifera
ref|XP_008779426.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    120   1e-27   Phoenix dactylifera
gb|AAL50565.1|AF405204_1  malonyl CoA:anthocyanin 5-O-glucoside-6...    120   2e-27   Perilla frutescens [beefsteak-mint]
gb|AAO12207.1|  putative malonyl CoA:anthocyanidin 3-O-glucoside-...    120   3e-27   Dahlia pinnata
ref|XP_006362146.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    120   3e-27   Solanum tuberosum [potatoes]
ref|XP_010918788.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    119   4e-27   Elaeis guineensis
ref|XP_009365920.1|  PREDICTED: phenolic glucoside malonyltransfe...    119   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_008357919.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    115   4e-27   
ref|XP_008231009.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    117   7e-27   
ref|XP_008231008.1|  PREDICTED: phenolic glucoside malonyltransfe...    119   7e-27   Prunus mume [ume]
ref|XP_012084834.1|  PREDICTED: phenolic glucoside malonyltransfe...    119   8e-27   Jatropha curcas
gb|KDO39555.1|  hypothetical protein CISIN_1g012242mg                   119   8e-27   Citrus sinensis [apfelsine]
ref|XP_011069511.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    114   8e-27   
gb|KDO39556.1|  hypothetical protein CISIN_1g012242mg                   118   9e-27   Citrus sinensis [apfelsine]
ref|XP_007032769.1|  HXXXD-type acyl-transferase family protein, ...    118   9e-27   
ref|XP_008230917.1|  PREDICTED: phenolic glucoside malonyltransfe...    118   1e-26   
gb|KHN07133.1|  Anthocyanin 5-aromatic acyltransferase                  116   1e-26   Glycine soja [wild soybean]
ref|XP_006451382.1|  hypothetical protein CICLE_v10007994mg             118   2e-26   
ref|XP_007216387.1|  hypothetical protein PRUPE_ppa021452mg             117   2e-26   Prunus persica
ref|XP_012076156.1|  PREDICTED: phenolic glucoside malonyltransfe...    117   2e-26   Jatropha curcas
ref|XP_011079059.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    117   2e-26   Sesamum indicum [beniseed]
ref|XP_004489466.1|  PREDICTED: phenolic glucoside malonyltransfe...    117   2e-26   Cicer arietinum [garbanzo]
ref|XP_007217389.1|  hypothetical protein PRUPE_ppa026050mg             119   2e-26   
ref|XP_007043460.1|  HXXXD-type acyl-transferase family protein, ...    117   3e-26   
ref|XP_010940606.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    117   3e-26   Elaeis guineensis
ref|NP_001237760.1|  malonyl-CoA:isoflavone 7-O-glucoside-6''-O-m...    117   3e-26   Glycine max [soybeans]
ref|XP_007217573.1|  hypothetical protein PRUPE_ppa020665mg             117   3e-26   Prunus persica
ref|XP_002518001.1|  Anthocyanin 5-aromatic acyltransferase, puta...    117   3e-26   Ricinus communis
ref|XP_008230894.1|  PREDICTED: phenolic glucoside malonyltransfe...    117   3e-26   Prunus mume [ume]
ref|XP_009365887.1|  PREDICTED: phenolic glucoside malonyltransfe...    116   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_010274321.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    116   5e-26   Nelumbo nucifera [Indian lotus]
gb|KCW54644.1|  hypothetical protein EUGRSUZ_I00590                     115   5e-26   Eucalyptus grandis [rose gum]
ref|XP_007216246.1|  hypothetical protein PRUPE_ppa016949mg             116   5e-26   Prunus persica
ref|XP_007151367.1|  hypothetical protein PHAVU_004G040700g             116   5e-26   Phaseolus vulgaris [French bean]
ref|XP_007042677.1|  HXXXD-type acyl-transferase family protein, ...    116   6e-26   
gb|EYU36657.1|  hypothetical protein MIMGU_mgv1a019731mg                116   6e-26   Erythranthe guttata [common monkey flower]
gb|EPS62073.1|  hypothetical protein M569_12718                         116   7e-26   Genlisea aurea
gb|KEH25061.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    116   7e-26   Medicago truncatula
ref|XP_008348092.1|  PREDICTED: phenolic glucoside malonyltransfe...    116   7e-26   
gb|EYU24861.1|  hypothetical protein MIMGU_mgv1a006931mg                115   8e-26   Erythranthe guttata [common monkey flower]
pdb|2E1V|A  Chain A, Crystal Structure Of Dendranthema Morifolium...    115   1e-25   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_007151362.1|  hypothetical protein PHAVU_004G040200g             115   1e-25   Phaseolus vulgaris [French bean]
ref|XP_008357786.1|  PREDICTED: phenolic glucoside malonyltransfe...    115   1e-25   
ref|XP_004306067.1|  PREDICTED: phenolic glucoside malonyltransfe...    115   1e-25   Fragaria vesca subsp. vesca
emb|CBI18016.3|  unnamed protein product                                114   2e-25   Vitis vinifera
ref|XP_009365966.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    114   2e-25   
ref|XP_010089648.1|  Anthocyanin 5-aromatic acyltransferase             114   2e-25   Morus notabilis
ref|XP_009365919.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    114   3e-25   
ref|XP_006649178.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    114   3e-25   Oryza brachyantha
ref|XP_008813246.1|  PREDICTED: phenolic glucoside malonyltransfe...    115   3e-25   Phoenix dactylifera
ref|XP_010657386.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    114   3e-25   Vitis vinifera
ref|XP_003543881.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   3e-25   Glycine max [soybeans]
ref|XP_010261004.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    114   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008348091.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   3e-25   
gb|KHN07114.1|  Agmatine coumaroyltransferase                           114   3e-25   Glycine soja [wild soybean]
ref|XP_011467881.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   4e-25   Fragaria vesca subsp. vesca
ref|XP_008797924.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...    114   4e-25   
ref|XP_010030472.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    114   4e-25   Eucalyptus grandis [rose gum]
gb|KCW54645.1|  hypothetical protein EUGRSUZ_I00591                     114   4e-25   Eucalyptus grandis [rose gum]
emb|CDP11899.1|  unnamed protein product                                108   5e-25   Coffea canephora [robusta coffee]
ref|XP_008357916.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   5e-25   
ref|XP_010027980.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    113   6e-25   Eucalyptus grandis [rose gum]
ref|XP_008230892.1|  PREDICTED: phenolic glucoside malonyltransfe...    113   7e-25   Prunus mume [ume]
gb|EYU24859.1|  hypothetical protein MIMGU_mgv1a023480mg                112   9e-25   Erythranthe guttata [common monkey flower]
gb|EYU24853.1|  hypothetical protein MIMGU_mgv1a006246mg                112   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_009365888.1|  PREDICTED: phenolic glucoside malonyltransfe...    112   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_004956266.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    112   1e-24   Setaria italica
ref|XP_009382788.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    112   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265764.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    112   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010247206.1|  PREDICTED: phenolic glucoside malonyltransfe...    111   2e-24   Nelumbo nucifera [Indian lotus]
gb|KDO55796.1|  hypothetical protein CISIN_1g012440mg                   112   2e-24   Citrus sinensis [apfelsine]
emb|CBI18015.3|  unnamed protein product                                112   2e-24   Vitis vinifera
ref|XP_009391701.1|  PREDICTED: phenolic glucoside malonyltransfe...    112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48832.1|  Agmatine coumaroyltransferase                           111   2e-24   Glycine soja [wild soybean]
ref|XP_004304225.1|  PREDICTED: phenolic glucoside malonyltransfe...    111   3e-24   Fragaria vesca subsp. vesca
ref|XP_003554894.2|  PREDICTED: phenolic glucoside malonyltransfe...    111   3e-24   Glycine max [soybeans]
ref|XP_007214879.1|  hypothetical protein PRUPE_ppa026936mg             111   3e-24   Prunus persica
gb|EAY88051.1|  hypothetical protein OsI_09479                          111   3e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001048542.1|  Os02g0820400                                       111   3e-24   
ref|XP_010102963.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    111   3e-24   Morus notabilis
ref|XP_008779727.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    110   4e-24   Phoenix dactylifera
gb|AGT37413.1|  anthocyanin 5-aromatic acyltransferase                  110   5e-24   
gb|EYU24857.1|  hypothetical protein MIMGU_mgv1a019718mg                107   5e-24   Erythranthe guttata [common monkey flower]
gb|EPS62076.1|  hypothetical protein M569_12721                         110   6e-24   Genlisea aurea
emb|CAN64565.1|  hypothetical protein VITISV_044304                     110   7e-24   Vitis vinifera
ref|XP_010263233.1|  PREDICTED: agmatine coumaroyltransferase-like      110   7e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006447403.1|  hypothetical protein CICLE_v10015168mg             110   8e-24   Citrus clementina [clementine]
ref|XP_004304224.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   1e-23   Fragaria vesca subsp. vesca
gb|EYU24855.1|  hypothetical protein MIMGU_mgv1a005957mg                110   1e-23   Erythranthe guttata [common monkey flower]
gb|ACG40604.1|  anthocyanin 5-aromatic acyltransferase                  109   1e-23   Zea mays [maize]
ref|XP_011079049.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    110   1e-23   Sesamum indicum [beniseed]
ref|NP_001140601.1|  uncharacterized protein LOC100272672               109   1e-23   
ref|XP_008670029.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    109   1e-23   
dbj|BAF49307.1|  putative anthocyanin malonyltransferase                109   1e-23   Clitoria ternatea
gb|KJB79463.1|  hypothetical protein B456_013G051200                    109   2e-23   Gossypium raimondii
gb|KCW47095.1|  hypothetical protein EUGRSUZ_K00901                     109   2e-23   Eucalyptus grandis [rose gum]
ref|XP_008379864.1|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-23   
ref|XP_006361075.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_007033865.1|  HXXXD-type acyl-transferase family protein, ...    108   2e-23   
ref|XP_004507302.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    109   2e-23   Cicer arietinum [garbanzo]
gb|EYU24852.1|  hypothetical protein MIMGU_mgv1a006230mg                108   2e-23   Erythranthe guttata [common monkey flower]
gb|KEH25130.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    108   2e-23   Medicago truncatula
ref|XP_010035654.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    108   3e-23   Eucalyptus grandis [rose gum]
sp|Q8W1W9.1|5MAT1_SALSN  RecName: Full=Malonyl-coenzyme:anthocyan...    108   4e-23   Salvia splendens [bonfire salvia]
ref|XP_008365521.1|  PREDICTED: phenolic glucoside malonyltransfe...    108   4e-23   
ref|XP_010102962.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    108   5e-23   Morus notabilis
ref|XP_010246275.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    108   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010111948.1|  Anthocyanin 5-aromatic acyltransferase             108   5e-23   
ref|XP_007033867.1|  HXXXD-type acyl-transferase family protein, ...    107   6e-23   
ref|XP_011038069.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   6e-23   Populus euphratica
ref|XP_009397892.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    107   7e-23   
ref|XP_010035650.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    107   8e-23   Eucalyptus grandis [rose gum]
gb|EYU26102.1|  hypothetical protein MIMGU_mgv1a005739mg                107   8e-23   Erythranthe guttata [common monkey flower]
ref|XP_008363917.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   9e-23   
ref|XP_008231010.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    105   1e-22   
ref|XP_009629767.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    107   1e-22   Nicotiana tomentosiformis
ref|XP_002459867.1|  hypothetical protein SORBIDRAFT_02g012620          106   1e-22   Sorghum bicolor [broomcorn]
ref|XP_011467880.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   1e-22   Fragaria vesca subsp. vesca
gb|KHN36596.1|  Anthocyanin 5-aromatic acyltransferase                  105   2e-22   Glycine soja [wild soybean]
ref|XP_004306064.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   2e-22   Fragaria vesca subsp. vesca
dbj|BAF93857.1|  anthocyanin acyltransferase                            106   2e-22   Torenia hybrid cultivar
ref|XP_003621460.1|  Isoflavonoid malonyl transferase                   104   2e-22   
ref|XP_011025419.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    106   2e-22   Populus euphratica
ref|XP_008342065.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   2e-22   
ref|XP_008353552.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   2e-22   
ref|XP_009391749.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    105   2e-22   
ref|XP_006485702.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   2e-22   Citrus sinensis [apfelsine]
ref|XP_003576889.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_006490135.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    104   3e-22   
gb|KJB71711.1|  hypothetical protein B456_011G138500                    105   3e-22   Gossypium raimondii
gb|AES77714.2|  transferase family protein                              103   4e-22   Medicago truncatula
ref|XP_006490134.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   4e-22   
ref|XP_012084860.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    105   5e-22   Jatropha curcas
ref|XP_009387932.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    105   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608203.1|  Isoflavonoid malonyl transferase                   103   5e-22   
ref|XP_003531870.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   5e-22   Glycine max [soybeans]
ref|XP_006452621.1|  hypothetical protein CICLE_v10010723mg             105   5e-22   Citrus clementina [clementine]
gb|ABY91222.1|  isoflavonoid malonyl transferase 2                      105   5e-22   Medicago truncatula
ref|XP_004305990.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   5e-22   Fragaria vesca subsp. vesca
ref|XP_011009741.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   5e-22   Populus euphratica
gb|KHN30328.1|  Anthocyanin 5-aromatic acyltransferase                  105   5e-22   Glycine soja [wild soybean]
gb|AES77678.2|  anthocyanin 5-aromatic acyltransferase                  105   5e-22   Medicago truncatula
gb|AAS77404.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        105   5e-22   Lamium purpureum [purple dead-nettle]
ref|XP_010107163.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    104   6e-22   
ref|XP_004491975.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   6e-22   Cicer arietinum [garbanzo]
ref|XP_010680633.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    105   7e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010089640.1|  Anthocyanin 5-aromatic acyltransferase             104   7e-22   Morus notabilis
ref|XP_006452620.1|  hypothetical protein CICLE_v10008059mg             105   8e-22   Citrus clementina [clementine]
gb|KEH25128.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    104   8e-22   Medicago truncatula
ref|XP_009378321.1|  PREDICTED: phenolic glucoside malonyltransfe...    104   9e-22   Pyrus x bretschneideri [bai li]
gb|KEH25127.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    104   9e-22   Medicago truncatula
ref|XP_009354720.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    104   9e-22   Pyrus x bretschneideri [bai li]
ref|XP_003608200.1|  Isoflavonoid malonyl transferase                   104   9e-22   
gb|KDO59147.1|  hypothetical protein CISIN_1g010609mg                   104   1e-21   Citrus sinensis [apfelsine]
ref|XP_008231013.1|  PREDICTED: BAHD acyltransferase At3g29680-like     104   1e-21   Prunus mume [ume]
ref|XP_003543364.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    104   1e-21   Glycine max [soybeans]
ref|XP_011000255.1|  PREDICTED: phenolic glucoside malonyltransfe...    104   1e-21   Populus euphratica
ref|XP_006474854.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    104   1e-21   Citrus sinensis [apfelsine]
gb|EYU32009.1|  hypothetical protein MIMGU_mgv1a006060mg                103   1e-21   Erythranthe guttata [common monkey flower]
gb|KHN36593.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-...    103   1e-21   Glycine soja [wild soybean]
ref|XP_003541923.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    103   1e-21   Glycine max [soybeans]
ref|XP_002313292.2|  hypothetical protein POPTR_0009s06800g             103   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008379902.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    103   1e-21   
ref|XP_009398032.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149905.1|  hypothetical protein PHAVU_005G108800g             103   1e-21   Phaseolus vulgaris [French bean]
ref|XP_010265765.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   1e-21   Nelumbo nucifera [Indian lotus]
gb|KJB50065.1|  hypothetical protein B456_008G151700                    104   1e-21   Gossypium raimondii
ref|XP_010657394.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...    103   2e-21   
ref|XP_008231011.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    103   2e-21   
gb|KCW47092.1|  hypothetical protein EUGRSUZ_K00898                     102   2e-21   Eucalyptus grandis [rose gum]
gb|KJB50068.1|  hypothetical protein B456_008G151900                    102   2e-21   Gossypium raimondii
ref|XP_002513167.1|  Anthocyanin 5-aromatic acyltransferase, puta...    103   2e-21   Ricinus communis
ref|XP_010089646.1|  Anthocyanin 5-aromatic acyltransferase             100   2e-21   
ref|XP_012084861.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    103   3e-21   Jatropha curcas
ref|XP_004954417.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    102   3e-21   Setaria italica
gb|EYU24851.1|  hypothetical protein MIMGU_mgv1a006146mg                102   3e-21   Erythranthe guttata [common monkey flower]
ref|XP_003621467.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...    102   3e-21   Medicago truncatula
ref|XP_010107164.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    102   3e-21   Morus notabilis
ref|XP_010268734.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    103   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008346924.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanin ...    102   3e-21   
ref|XP_002527620.1|  anthocyanin 5-aromatic acyltransferase, puta...    101   4e-21   
ref|XP_007052550.1|  HXXXD-type acyl-transferase family protein, ...    101   4e-21   
ref|XP_006361062.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...    102   4e-21   
ref|XP_003551761.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   4e-21   Glycine max [soybeans]
ref|XP_008379438.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   4e-21   
ref|XP_004507303.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   5e-21   Cicer arietinum [garbanzo]
ref|XP_007215331.1|  hypothetical protein PRUPE_ppa005255mg             102   5e-21   Prunus persica
ref|XP_006384219.1|  hypothetical protein POPTR_0004s10320g             102   6e-21   
ref|XP_006490136.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    102   6e-21   Citrus sinensis [apfelsine]
ref|XP_010257336.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    102   6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_011004421.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   6e-21   Populus euphratica
ref|XP_006475110.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    102   8e-21   Citrus sinensis [apfelsine]
ref|XP_003621474.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...    101   8e-21   
ref|XP_004499461.1|  PREDICTED: phenolic glucoside malonyltransfe...    101   8e-21   Cicer arietinum [garbanzo]
ref|XP_009353357.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    101   8e-21   Pyrus x bretschneideri [bai li]
gb|AES77692.2|  anthocyanin 5-aromatic acyltransferase                  101   8e-21   Medicago truncatula
ref|XP_009398891.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  98.6    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13543.1|  Anthocyanin 5-aromatic acyltransferase                  101   9e-21   Glycine soja [wild soybean]
ref|XP_006384220.1|  transferase family protein                         101   9e-21   
dbj|BAK04520.1|  predicted protein                                      101   1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009350417.1|  PREDICTED: phenolic glucoside malonyltransfe...    101   1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008230890.1|  PREDICTED: phenolic glucoside malonyltransfe...    101   1e-20   
ref|XP_007139470.1|  hypothetical protein PHAVU_008G032200g             100   1e-20   Phaseolus vulgaris [French bean]
ref|XP_010034361.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    100   1e-20   Eucalyptus grandis [rose gum]
ref|XP_007151361.1|  hypothetical protein PHAVU_004G040100g             100   1e-20   Phaseolus vulgaris [French bean]
ref|XP_003570416.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    100   1e-20   
sp|Q9MBC1.1|3AT_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside ...    100   2e-20   
ref|XP_006373366.1|  hypothetical protein POPTR_0017s13040g             100   2e-20   
ref|XP_003552581.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   2e-20   
gb|KHN13545.1|  Agmatine coumaroyltransferase                           100   2e-20   
ref|XP_011000071.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    100   2e-20   
ref|XP_006851052.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...  99.8    3e-20   
ref|XP_006370200.1|  hypothetical protein POPTR_0001s40570g             100   3e-20   
ref|XP_010277331.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   3e-20   
ref|XP_007139466.1|  hypothetical protein PHAVU_008G031900g           99.8    3e-20   
ref|XP_004141586.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  99.8    3e-20   
ref|XP_008230891.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   4e-20   
gb|KHN13542.1|  Anthocyanin 5-aromatic acyltransferase                97.8    4e-20   
ref|XP_010089644.1|  Agmatine coumaroyltransferase                    99.4    5e-20   
gb|KDO65328.1|  hypothetical protein CISIN_1g047536mg                 96.3    7e-20   
ref|XP_006485081.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  97.1    7e-20   
ref|XP_007139438.1|  hypothetical protein PHAVU_008G029400g           99.0    7e-20   
ref|XP_003541924.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  99.0    7e-20   
emb|CDY11576.1|  BnaC06g31630D                                        98.6    8e-20   
ref|XP_006370203.1|  hypothetical protein POPTR_0001s40600g           99.4    8e-20   
emb|CDY11580.1|  BnaC06g31590D                                        98.6    9e-20   
gb|KHN48831.1|  Agmatine coumaroyltransferase                         98.6    9e-20   
ref|XP_012065542.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...  98.6    9e-20   
ref|XP_008454724.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  99.0    9e-20   
ref|XP_004308681.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.6    9e-20   
gb|AAR26386.1|  putative acyltransferase                              98.6    9e-20   
ref|XP_002443938.1|  hypothetical protein SORBIDRAFT_07g004730        98.6    1e-19   
gb|KHN36592.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-...  98.6    1e-19   
ref|XP_004974393.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...  98.6    1e-19   
gb|KFK42702.1|  hypothetical protein AALP_AA1G028900                  98.6    1e-19   
ref|XP_008230893.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.2    1e-19   
ref|XP_003554890.2|  PREDICTED: phenolic glucoside malonyltransfe...  99.0    1e-19   
ref|XP_010095850.1|  Anthocyanin 5-aromatic acyltransferase           97.8    1e-19   
ref|XP_010436793.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.5    1e-19   
ref|XP_009365918.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...  98.6    1e-19   
ref|XP_008357784.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.2    1e-19   
ref|XP_007032768.1|  HXXXD-type acyl-transferase family protein, ...  98.2    1e-19   
ref|XP_011012668.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.2    1e-19   
ref|XP_007139474.1|  hypothetical protein PHAVU_008G032500g           97.4    1e-19   
ref|XP_010553964.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.2    1e-19   
gb|KDO65331.1|  hypothetical protein CISIN_1g011670mg                 98.2    1e-19   
ref|XP_011015767.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  98.2    1e-19   
dbj|BAA93452.1|  acyltransferase homolog                              98.2    2e-19   
ref|XP_011012393.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  98.2    2e-19   
gb|KFK41265.1|  hypothetical protein AALP_AA2G107200                  97.4    2e-19   
ref|XP_006384218.1|  hypothetical protein POPTR_0004s10300g           97.8    2e-19   
gb|KHN04293.1|  Anthocyanin 5-aromatic acyltransferase                97.8    2e-19   
ref|XP_009105715.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.8    2e-19   
ref|XP_012084862.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  97.8    2e-19   
ref|XP_010522645.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  97.8    2e-19   
gb|ACU23115.1|  unknown                                               97.8    2e-19   
ref|XP_011470563.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.4    2e-19   
ref|XP_010918830.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  95.5    2e-19   
ref|XP_006602943.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...  97.4    2e-19   
ref|NP_171890.1|  coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-...  97.4    2e-19   
gb|KHN14029.1|  Anthocyanin 5-aromatic acyltransferase                94.7    3e-19   
ref|XP_006421640.1|  hypothetical protein CICLE_v10004896mg           97.4    3e-19   
ref|XP_002313487.2|  hypothetical protein POPTR_0009s02480g           97.4    3e-19   
ref|XP_010095851.1|  Anthocyanin 5-aromatic acyltransferase           97.4    3e-19   
ref|XP_006490275.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  97.4    3e-19   
ref|XP_006421642.1|  hypothetical protein CICLE_v10004906mg           97.1    3e-19   
ref|XP_003541922.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  97.1    3e-19   
gb|KHN07646.1|  Anthocyanin 5-aromatic acyltransferase                95.9    4e-19   
gb|KHN36594.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-...  97.1    4e-19   
ref|XP_010105247.1|  Agmatine coumaroyltransferase                    96.7    4e-19   
ref|XP_009151767.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.7    4e-19   
ref|XP_010502982.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.7    4e-19   
dbj|BAJ91669.1|  predicted protein                                    96.7    5e-19   
ref|XP_008465393.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.1    5e-19   
ref|XP_006418229.1|  hypothetical protein EUTSA_v10007549mg           96.7    5e-19   
ref|XP_006602942.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.3    5e-19   
ref|XP_004151485.2|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  93.2    5e-19   
emb|CDY47141.1|  BnaA08g05420D                                        96.3    6e-19   
ref|XP_002527622.1|  Anthocyanin 5-aromatic acyltransferase, puta...  96.3    6e-19   
ref|XP_010089639.1|  Agmatine coumaroyltransferase                    96.3    6e-19   
gb|EYU24856.1|  hypothetical protein MIMGU_mgv1a017714mg              96.3    6e-19   
ref|XP_009105716.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.3    6e-19   
ref|XP_007139473.1|  hypothetical protein PHAVU_008G032400g           96.7    6e-19   
ref|XP_011014457.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.1    6e-19   
ref|XP_006421786.1|  hypothetical protein CICLE_v10004870mg           96.7    6e-19   
ref|XP_002889461.1|  transferase family protein                       95.9    6e-19   
ref|XP_007219500.1|  hypothetical protein PRUPE_ppa022332mg           96.3    6e-19   
ref|XP_002527626.1|  Anthocyanin 5-aromatic acyltransferase, puta...  96.3    6e-19   
gb|KFK39966.1|  hypothetical protein AALP_AA3G312300                  96.3    7e-19   
ref|XP_007149907.1|  hypothetical protein PHAVU_005G109000g           96.3    7e-19   
emb|CDX86361.1|  BnaA06g30780D                                        95.9    7e-19   
gb|AIS92513.1|  putative anthocyanin acyltransferase                  96.3    7e-19   
gb|EMT00918.1|  Anthocyanin 5-aromatic acyltransferase                94.0    8e-19   
gb|KJB64646.1|  hypothetical protein B456_010G059400                  95.9    9e-19   
ref|XP_009774760.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  95.9    9e-19   
emb|CDY47140.1|  BnaA08g05430D                                        95.9    9e-19   
gb|KHN13544.1|  Agmatine coumaroyltransferase                         95.5    9e-19   
ref|XP_010435817.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.9    1e-18   
ref|XP_002448612.1|  hypothetical protein SORBIDRAFT_06g030140        95.5    1e-18   
ref|XP_003633577.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...  95.5    1e-18   
ref|XP_006370205.1|  hypothetical protein POPTR_0001s40620g           95.5    1e-18   
ref|XP_009111134.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  95.5    1e-18   
ref|XP_007217619.1|  hypothetical protein PRUPE_ppa016299mg           95.5    1e-18   
gb|EYU17680.1|  hypothetical protein MIMGU_mgv1a018592mg              93.6    1e-18   
emb|CDY15482.1|  BnaA08g27660D                                        95.5    1e-18   
ref|XP_008459384.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  95.5    1e-18   
emb|CDY11582.1|  BnaC06g31570D                                        95.1    1e-18   
ref|XP_006586454.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  93.2    2e-18   
gb|EMT28353.1|  Anthocyanin 5-aromatic acyltransferase                92.8    2e-18   
ref|XP_010104710.1|  Anthocyanin 5-aromatic acyltransferase           95.1    2e-18   
ref|XP_010425761.1|  PREDICTED: phenolic glucoside malonyltransfe...  94.7    2e-18   
gb|KHN13546.1|  Agmatine coumaroyltransferase                         94.7    2e-18   
ref|XP_003552580.1|  PREDICTED: phenolic glucoside malonyltransfe...  94.7    2e-18   
gb|KFK22497.1|  hypothetical protein AALP_AAs67487U000200             94.4    3e-18   
ref|XP_004499462.1|  PREDICTED: phenolic glucoside malonyltransfe...  94.7    3e-18   
ref|XP_002305849.1|  hypothetical protein POPTR_0004s09280g           94.4    3e-18   
ref|XP_003555054.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  93.6    3e-18   
ref|XP_008379435.1|  PREDICTED: phenolic glucoside malonyltransfe...  94.7    3e-18   
ref|XP_006395267.1|  hypothetical protein EUTSA_v10004175mg           94.4    3e-18   
ref|XP_006485169.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  93.2    3e-18   
ref|XP_002892187.1|  transferase                                      94.4    3e-18   
ref|XP_006421639.1|  hypothetical protein CICLE_v10004912mg           94.0    4e-18   
gb|KGN57758.1|  hypothetical protein Csa_3G280970                     90.1    4e-18   
gb|KJB11558.1|  hypothetical protein B456_001G265700                  94.0    4e-18   
gb|KJB25033.1|  hypothetical protein B456_004G173600                  94.0    4e-18   
ref|NP_171849.2|  coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-...  94.0    4e-18   
ref|XP_004972722.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  94.0    5e-18   
ref|XP_007139468.1|  hypothetical protein PHAVU_008G032100g           93.6    5e-18   
ref|XP_010528413.1|  PREDICTED: phenolic glucoside malonyltransfe...  93.6    5e-18   
ref|XP_004145869.2|  PREDICTED: phenolic glucoside malonyltransfe...  93.6    6e-18   
gb|ABY91220.1|  isoflavonoid malonyl transferase 1                    93.6    6e-18   
ref|XP_003621462.1|  Isoflavonoid malonyl transferase                 93.6    6e-18   
ref|XP_003540336.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...  93.6    6e-18   
ref|XP_010101949.1|  Agmatine coumaroyltransferase                    93.6    7e-18   
ref|XP_002875524.1|  transferase family protein                       93.2    7e-18   
emb|CBI18012.3|  unnamed protein product                              88.6    8e-18   
ref|XP_008379867.1|  PREDICTED: phenolic glucoside malonyltransfe...  90.1    1e-17   
ref|XP_008353429.1|  PREDICTED: phenolic glucoside malonyltransfe...  93.2    1e-17   
ref|XP_002454697.1|  hypothetical protein SORBIDRAFT_04g035790        92.8    1e-17   
gb|EMT26311.1|  Anthocyanin 5-aromatic acyltransferase                92.4    1e-17   
tpg|DAA35784.1|  TPA: transferase                                     92.4    1e-17   
dbj|BAK02456.1|  predicted protein                                    92.4    1e-17   
gb|EMT28352.1|  Anthocyanin 5-aromatic acyltransferase                92.0    1e-17   
ref|XP_002445141.1|  hypothetical protein SORBIDRAFT_07g004720        92.4    1e-17   
ref|XP_006390880.1|  hypothetical protein EUTSA_v10018583mg           92.0    2e-17   
ref|XP_011027150.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.4    2e-17   
gb|KEH39034.1|  anthocyanin 5-aromatic acyltransferase                92.4    2e-17   
ref|XP_011468648.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  90.5    2e-17   
ref|XP_004487342.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  92.0    2e-17   
ref|XP_010474975.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  92.0    2e-17   
ref|XP_011035173.1|  PREDICTED: phenolic glucoside malonyltransfe...  92.0    2e-17   
dbj|BAJ92994.1|  predicted protein                                    92.0    2e-17   
ref|XP_012084833.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.0    2e-17   
emb|CAN65238.1|  hypothetical protein VITISV_018675                   90.9    2e-17   
ref|XP_006478069.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  90.5    2e-17   
ref|XP_010482850.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  92.0    2e-17   
ref|XP_010482858.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  92.0    2e-17   
ref|XP_010553967.1|  PREDICTED: phenolic glucoside malonyltransfe...  91.7    2e-17   
ref|XP_006378727.1|  hypothetical protein POPTR_0010s21520g           92.0    2e-17   
ref|XP_006482763.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.0    3e-17   
gb|KDO72777.1|  hypothetical protein CISIN_1g038932mg                 91.7    3e-17   
ref|XP_009105714.1|  PREDICTED: phenolic glucoside malonyltransfe...  91.3    3e-17   
ref|NP_189609.1|  phenolic glucoside malonyltransferase 2             91.3    3e-17   
emb|CDX86660.1|  BnaC08g00430D                                        91.3    3e-17   
ref|XP_006431307.1|  hypothetical protein CICLE_v10013395mg           91.7    4e-17   
gb|KJB11557.1|  hypothetical protein B456_001G265600                  91.3    4e-17   
emb|CDY35357.1|  BnaA04g14900D                                        88.6    4e-17   
ref|XP_003608206.1|  Isoflavonoid malonyl transferase                 91.3    4e-17   
ref|XP_006384236.1|  hypothetical protein POPTR_0004s10920g           91.3    4e-17   
ref|XP_008348250.1|  PREDICTED: phenolic glucoside malonyltransfe...  90.1    4e-17   
ref|XP_011013415.1|  PREDICTED: phenolic glucoside malonyltransfe...  90.9    4e-17   
ref|XP_006441057.1|  hypothetical protein CICLE_v10020505mg           90.1    5e-17   
ref|XP_007052549.1|  Malonyl CoA:flavonoid malonyltransferase 5, ...  91.3    5e-17   
ref|XP_003621465.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...  90.9    5e-17   
ref|XP_008231363.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  90.9    5e-17   
ref|XP_010917117.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...  90.5    5e-17   
emb|CDY09445.1|  BnaC02g19870D                                        90.9    5e-17   
ref|XP_008341621.1|  PREDICTED: phenolic glucoside malonyltransfe...  90.9    5e-17   
ref|XP_011011768.1|  PREDICTED: phenolic glucoside malonyltransfe...  90.9    5e-17   
ref|XP_002305314.2|  hypothetical protein POPTR_0004s18920g           90.9    5e-17   
gb|AES77683.2|  anthocyanin 5-aromatic acyltransferase                90.5    6e-17   
ref|XP_006384610.1|  hypothetical protein POPTR_0004s19020g           90.5    6e-17   
gb|KJB11559.1|  hypothetical protein B456_001G265800                  90.5    6e-17   
ref|XP_004965989.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  90.5    6e-17   
ref|XP_011079048.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  90.5    7e-17   
ref|NP_001147723.1|  transferase                                      90.1    7e-17   
ref|XP_006436965.1|  hypothetical protein CICLE_v10033612mg           90.1    7e-17   
gb|KEH18149.1|  anthocyanin 5-aromatic acyltransferase                90.5    7e-17   
ref|XP_002306023.1|  hypothetical protein POPTR_0004s11990g           90.1    8e-17   
ref|XP_003599128.1|  Anthocyanin 5-aromatic acyltransferase           90.1    8e-17   
ref|XP_006592833.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  90.1    9e-17   
ref|XP_006304592.1|  hypothetical protein CARUB_v10011644mg           89.7    1e-16   
ref|XP_002527629.1|  Anthocyanin 5-aromatic acyltransferase, puta...  89.7    1e-16   
ref|XP_003559638.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.7    1e-16   
ref|XP_010089641.1|  Agmatine coumaroyltransferase                    89.0    1e-16   
ref|XP_010502978.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.4    1e-16   
gb|KFK41334.1|  hypothetical protein AALP_AA2G116700                  89.4    1e-16   
gb|AGT37412.1|  anthocyanin 5-aromatic acyltransferase                89.0    2e-16   
ref|XP_007032765.1|  HXXXD-type acyl-transferase family protein, ...  89.4    2e-16   
ref|XP_010102957.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...  89.0    2e-16   
gb|KEH39033.1|  HXXXD-type acyl-transferase family protein            89.0    2e-16   
ref|XP_010425759.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.0    2e-16   
ref|XP_006593286.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  86.7    2e-16   
ref|XP_009365921.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...  89.0    2e-16   
ref|XP_008341623.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.0    2e-16   
ref|XP_006370202.1|  hypothetical protein POPTR_0001s40590g           84.3    3e-16   
ref|XP_009360572.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.0    3e-16   
emb|CDP11903.1|  unnamed protein product                              89.0    3e-16   
ref|XP_003571718.1|  PREDICTED: phenolic glucoside malonyltransfe...  88.2    4e-16   
ref|XP_010453884.1|  PREDICTED: phenolic glucoside malonyltransfe...  88.2    4e-16   
gb|AFK47969.1|  unknown                                               84.7    4e-16   
ref|XP_009360568.1|  PREDICTED: phenolic glucoside malonyltransfe...  88.2    5e-16   
ref|XP_003621476.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...  86.7    6e-16   
ref|XP_007216324.1|  hypothetical protein PRUPE_ppa019904mg           87.0    6e-16   
ref|NP_001151040.1|  transferase family protein                       87.4    7e-16   
emb|CDY03746.1|  BnaA02g14910D                                        87.4    7e-16   
gb|EYU26094.1|  hypothetical protein MIMGU_mgv1a005927mg              87.4    7e-16   
gb|EAZ35815.1|  hypothetical protein OsJ_20108                        87.0    8e-16   
ref|XP_012084863.1|  PREDICTED: phenolic glucoside malonyltransfe...  87.4    8e-16   
gb|AFW63968.1|  anthocyanin 5-aromatic acyltransferase                87.0    8e-16   
ref|XP_004972723.1|  PREDICTED: phenolic glucoside malonyltransfe...  87.4    8e-16   
ref|XP_002305836.2|  hypothetical protein POPTR_0004s09540g           84.3    9e-16   
ref|XP_006395269.1|  hypothetical protein EUTSA_v10004190mg           87.0    9e-16   
ref|XP_003552578.1|  PREDICTED: phenolic glucoside malonyltransfe...  87.0    1e-15   
gb|KHN04295.1|  Anthocyanin 5-aromatic acyltransferase                86.7    1e-15   
emb|CDX67424.1|  BnaA07g14640D                                        86.7    1e-15   



>emb|CDP11900.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 122/188 (65%), Gaps = 3/188 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CA++WTCL++ +  PSG   D D++  YF C ADCR R+D PLP+NYFGNC   
Sbjct  293  SSFTVICAHVWTCLVKCRG-PSGEYVD-DEEVEYFCCTADCRGRMDPPLPSNYFGNCQTV  350

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                 K G+L  EEG   A E+IGE IH++L+  + +   A+ W      ++ +R++SVA
Sbjct  351  IRKNEKNGKLIGEEGFPIAVESIGEGIHQRLKNNDSLFDDADTWLPGIAGINLDRVVSVA  410

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR +YY +DFGWGKPKK E  SI+ SGAI +G ++ES  DIEVG+S+   +M     +
Sbjct  411  GSPRYNYYNLDFGWGKPKKFEFISIETSGAISLGGSRESDGDIEVGLSLSKPRMDAFTVI  470

Query  280  FEEGLQAL  257
            F + L +L
Sbjct  471  FNDRLNSL  478



>dbj|BAF49288.1| hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6'''-O-hydroxycinnamoyltransferase 
[Eustoma grandiflorum]
Length=465

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 126/194 (65%), Gaps = 4/194 (2%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQ--CFPSGINRDEDDDTVYFLCAADCRARLDTPLPA  665
            GQ  R  ++F VTC Y+WTC+L+S+         ++++++  YF   A+CRA L  P PA
Sbjct  273  GQQTRV-TTFTVTCGYVWTCMLKSKDAMLEEVPPQNDENEIEYFSFTANCRALLRPPAPA  331

Query  664  NYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV  485
            NYFGNC+ PC+ +A+ G+L   EG   A  A+GEAI +++  +EGVL  A+ W +    +
Sbjct  332  NYFGNCIAPCLAKARHGELIGSEGFLVATAAVGEAIDKRVNNKEGVLADAKTWLTESKGI  391

Query  484  SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPA  308
              ER+L V+GSPR D Y +DFGWGKP+K E TSIDY+G + +  ++E    +EVG+S+P 
Sbjct  392  LSERLLGVSGSPRFDSYGVDFGWGKPEKYEITSIDYAGLMSLIKSREFEGGVEVGLSLPK  451

Query  307  AKMHLLKTLFEEGL  266
             +M+    +FEEGL
Sbjct  452  IQMNAFARIFEEGL  465



>ref|XP_009588215.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 125/200 (63%), Gaps = 11/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+P     +SF VTCAY+WTCL++S+    G   DE++   +F+C ADCRAR   P+ 
Sbjct  257  LSRRPNLTHVTSFTVTCAYVWTCLIKSEGATIGKEIDENE-MEFFVCVADCRARFKPPIH  315

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             +YFGNCL+  I R +   L  +EG   A E IGE I ++++ EE +L G   W   F T
Sbjct  316  PSYFGNCLMAYIARTRHADLVGKEGFTIAVELIGEPIQKRIKDEEWILNG--KWFKEFST  373

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKES---LDIEVGVS  317
            V+ +R+LSVAGSP+LD Y  DFGWG+P+K+E  SID    + +  +K      D+E+G+S
Sbjct  374  VNAKRLLSVAGSPKLDLYAADFGWGRPEKLEFVSIDNGDGVSMSLSKSKDSDEDLEIGLS  433

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +P A+M++   +F  GL  L
Sbjct  434  LPKARMNVFAAIFTHGLNVL  453



>emb|CDP11907.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 111/170 (65%), Gaps = 3/170 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+WTCL++S+   SG +  E+D   +F+  ADCR+ +  PLPANYFGNCLV 
Sbjct  24   STFTVTCAYVWTCLIKSRG-ASGEDIKEND-LEHFMIGADCRSLIAPPLPANYFGNCLVN  81

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             I+ AK  +L  E G   AA  IGE I  +L  + GVL GAE W S    ++ ER++ VA
Sbjct  82   RIITAKTVELMQESGFIKAAGLIGEVIREKLHNKGGVLNGAEKWLSEIEGLNPERVVGVA  141

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVP  311
            GSP+   Y MDFGWGKP+K E  SID +G+I +  C     D+EVG+S+P
Sbjct  142  GSPKFAVYDMDFGWGKPRKSEVISIDTTGSISLNECRDGKGDLEVGLSLP  191



>emb|CAN71050.1| hypothetical protein VITISV_003717 [Vitis vinifera]
Length=449

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 114/187 (61%), Gaps = 3/187 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+WTC+++++       +  +D+  +F+  ADCRA L  PLPA YFGNCLV 
Sbjct  265  STFTVTCAYVWTCMVKAR--ERSGEKVTEDEXEHFVFGADCRALLQPPLPATYFGNCLVS  322

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C    K  +L  + G   AA+ IGEAI  +L  +EGVL+ AE W S F T   +RI+ VA
Sbjct  323  CFATTKTKELMGDNGFIVAAKTIGEAIQERLRKKEGVLKDAEKWISEFETRKEDRIVGVA  382

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFG GKPKK E  SID +G+I +  C  +    E+G+S+P  KM   + +
Sbjct  383  GSPRFAVYDIDFGLGKPKKSEVVSIDMTGSISLNECKNDKESFEIGLSLPKIKMDAFEDI  442

Query  280  FEEGLQA  260
            F  G Q 
Sbjct  443  FANGFQV  449



>ref|XP_002276090.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Vitis vinifera]
Length=454

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 114/187 (61%), Gaps = 3/187 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+WTC+++++       +  +D+  +F+  ADCRA L  PLPA YFGNCLV 
Sbjct  270  STFTVTCAYVWTCMVKAR--ERSGEKVTEDELEHFVFGADCRALLQPPLPATYFGNCLVS  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C    K  +L  + G   AA+ IGEAI  +L  +EGVL+ AE W S F T   +RI+ VA
Sbjct  328  CFATTKTKELMGDNGFIIAAKTIGEAIQERLRKKEGVLKDAEKWISEFETRKEDRIVGVA  387

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFG GKPKK E  SID +G+I +  C  +    E+G+S+P  KM   + +
Sbjct  388  GSPRFAVYDIDFGLGKPKKSEVVSIDMTGSISLNECKNDKESFEIGLSLPKIKMDAFEDI  447

Query  280  FEEGLQA  260
            F  G Q 
Sbjct  448  FANGFQV  454



>ref|XP_009593467.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=451

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 12/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+P     +SF VTCAY+WTCL++S+   +G   DE+    +F+CAADCR R + PLP
Sbjct  256  LSRRPNLTHVTSFTVTCAYVWTCLIKSEA-ATGEEIDENG-VEFFVCAADCRPRFNPPLP  313

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
              YFGNC+VP I R K G +  +EG   A E IGE I ++++ EE +L G  ++     T
Sbjct  314  PTYFGNCVVPYITRTKHGDVVGKEGFIIAVELIGETIKKKMKDEESILNG--EFLKELNT  371

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK---ESLDIEVGVS  317
            V + R +SVAGSP+ D Y +DFGWG+P+KIE  SID    I +  +K    + D+E+G+ 
Sbjct  372  VDWNRTVSVAGSPKFDLYAVDFGWGRPEKIEFVSIDNDNGISMSLSKSKDSNGDLEIGLC  431

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +P  +M     LF  GL  L
Sbjct  432  LPKTRMSTFAALFTHGLSFL  451



>gb|AAQ63615.1| anthocyanidin 3-O-glucoside-6''-O-malonyltransferase [Chrysanthemum 
x morifolium]
Length=459

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 122/187 (65%), Gaps = 5/187 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTC Y+W+C+ +S     G  + ED+    F+C ADCR+R+D P+P+ YFGNC  P
Sbjct  275  SSFTVTCGYIWSCIAKS-LVKMGEKKGEDE-LEQFICTADCRSRMDPPIPSTYFGNCGAP  332

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   K   L++E G   AA+ IGEAI++ ++ +EG+L+ AE W+  F   +  R + VA
Sbjct  333  CVTTIKNVVLSSENGFVFAAKLIGEAINKMVKNKEGILKDAERWHDAFKIPA--RKIGVA  390

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            G+P+L++Y +DFGWGKP+K ET SIDY+G++ +  +KES  D E+G+     +M     +
Sbjct  391  GTPKLNFYDIDFGWGKPQKNETISIDYNGSVAINASKESTQDFEIGLCFSNMQMEAFADI  450

Query  280  FEEGLQA  260
            F  GL++
Sbjct  451  FNHGLES  457



>ref|XP_006367188.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=454

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 128/198 (65%), Gaps = 10/198 (5%)
 Frame = -3

Query  832  VARQPS-----SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+PS     SF +TCAY+WTCL++S+   + I    ++   +F+CAADCRAR++ PLP
Sbjct  261  LSRRPSLAHVTSFTITCAYVWTCLVKSEV--TTIEITNENVMEFFVCAADCRARINPPLP  318

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             +YFGNC++  + + +   L  +EG   A E IGE I ++ + +E +L G  +W   F T
Sbjct  319  PSYFGNCVMGYVTQTRRIDLIGKEGFTIAVELIGEVIQKRTKDKEWILSG--NWFKEFST  376

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVP  311
            +  +R+LSV+GSP+ D Y  DFGWGK +KIE+ SID  G++ +  +K+S  D+EVG+S+ 
Sbjct  377  IDTKRLLSVSGSPKFDLYSADFGWGKAEKIESVSIDNGGSMSLTKSKDSNGDLEVGLSLS  436

Query  310  AAKMHLLKTLFEEGLQAL  257
             A+M+    +F  GL  L
Sbjct  437  KAQMNAFAAIFTHGLSLL  454



>emb|CDP11905.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = -3

Query  814  SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVPC  635
            SF V CAY+W CL++S+    G    ++++   F+C  +CR RLD  +  NYFGNC+  C
Sbjct  285  SFKVVCAYVWICLVKSR----GEEAVDEEEVENFVCFGNCRRRLDHLVAENYFGNCITLC  340

Query  634  IVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVAG  455
            I + K G+L    G+  A   IG A++ +L+ +E +  GAE+W      ++ +R   VAG
Sbjct  341  IAKMKNGELVGGGGIPRAVGLIGAAMNEKLQSQEALSNGAENWLVDLQNLNLDRTFMVAG  400

Query  454  SPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-GCAKESLDIEVGVSVPAAKMHLLKTLF  278
            SP+ ++Y++DFGWG+P++ E  SID +GA+ + G    + DIEVG+S+P A+M     +F
Sbjct  401  SPKFNFYQLDFGWGRPRRFEFVSIDKTGAVSLCGGRDRNRDIEVGLSLPKARMDAFAAIF  460

Query  277  EEGLQAL  257
             +GL+ L
Sbjct  461  NQGLKDL  467



>ref|XP_009769443.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Nicotiana sylvestris]
Length=452

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 123/200 (62%), Gaps = 12/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+P     +SF VTCAY+WTCL++S+   +G   DE+    +F CAADCRARL+ P+P
Sbjct  257  LSRRPNLTHVTSFTVTCAYIWTCLIKSEA-STGEEIDENG-VEFFGCAADCRARLNPPIP  314

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
              YFGNC+V  + R +   LA +EG   A E IGE I ++++ EE +L G+  W   +GT
Sbjct  315  QTYFGNCIVGYVARTRHTDLAGKEGFTIAVELIGETIQKRMKDEEWILNGS--WFKEYGT  372

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGVS  317
            V   R LS+ GSP+ D Y  DFGWG+ +K+E  SI+ +  + +  +K      D+EVG+S
Sbjct  373  VDQNRSLSITGSPKFDLYAADFGWGRLEKLEFVSINNNNGVTISLSKSKDSDGDLEVGLS  432

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +P  +M+    +F  GL  L
Sbjct  433  LPKTQMNAFAAIFTHGLSFL  452



>sp|Q9ZWR8.1|ANTA_GENTR RecName: Full=Anthocyanin 5-aromatic acyltransferase; Short=5AT 
[Gentiana triflora]
 dbj|BAA74428.1| Anthocyanin 5-aromatic acyltransferase [Gentiana triflora]
Length=469

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 118/190 (62%), Gaps = 2/190 (1%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQC-FPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLV  641
            ++F +TC Y+WTC+++S+    S  + +++++  YF   ADCR  L  P P NYFGNCL 
Sbjct  280  TTFTMTCGYVWTCMVKSKDDVVSEESSNDENELEYFSFTADCRGLLTPPCPPNYFGNCLA  339

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
             C+ +A   +L  ++G+  A  AIGEAI ++L  E+GVL  A+ W S    +  +R L +
Sbjct  340  SCVAKATHKELVGDKGLLVAVAAIGEAIEKRLHNEKGVLADAKTWLSESNGIPSKRFLGI  399

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKT  284
             GSP+ D Y +DFGWGKP K + TS+DY+  IYV  +++    +E+GVS+P   M     
Sbjct  400  TGSPKFDSYGVDFGWGKPAKFDITSVDYAELIYVIQSRDFEKGVEIGVSLPKIHMDAFAK  459

Query  283  LFEEGLQALS  254
            +FEEG  +LS
Sbjct  460  IFEEGFCSLS  469



>dbj|BAD44688.1| Hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6-O-hydroxycinnamoyltransferase 
[Gentiana scabra var. buergeri]
Length=469

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 115/190 (61%), Gaps = 2/190 (1%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQC-FPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLV  641
            ++F VTC Y+WTC+++S+    S  + +++++  YF   ADCR  L  P P NYFGNCL 
Sbjct  280  TTFTVTCGYVWTCMVKSKDDVVSEESSNDENELEYFSFTADCRGLLTPPCPPNYFGNCLA  339

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
             C+ +A   +L   +G+  A  AI EAI +++  E GVL  A+ W S    +  +R L +
Sbjct  340  SCVAKATHKELVGNKGLLVAVAAIVEAIDKRVHNERGVLADAKTWLSESNGIPSKRFLGI  399

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKT  284
             GSP+ D Y +DFGWGKP K + TS+DY+  IYV  +++    +E+GVS+P   M     
Sbjct  400  TGSPKFDSYGVDFGWGKPAKFDITSVDYAELIYVIQSRDFEKGVEIGVSLPKIHMDAFAK  459

Query  283  LFEEGLQALS  254
            +FEEG  +LS
Sbjct  460  IFEEGFCSLS  469



>gb|AAQ63616.1| anthocyanidin 3-O-glucoside-3'',6''-O-dimalonyltransferase [Chrysanthemum 
x morifolium]
Length=460

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTC Y+W+C+ +S     G  + ED+    F+ + DCR+R++ P+P+ Y GNC  P
Sbjct  276  SSFTVTCGYIWSCIAKS-LVKMGEKKGEDE-LEQFIISVDCRSRMNPPIPSTYLGNCGAP  333

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            CI   K   L++E G    A+ I EAI++ ++ +EG+L+ AE W+  F   +  R + VA
Sbjct  334  CITTIKNVVLSSENGFVFTAKLISEAINKMVKNKEGILKDAERWHEGFKIPA--RKIGVA  391

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            G+P+L++Y +DFGWGKP+K E  SIDY G++ +  +KES  D E+G+  P  +M     +
Sbjct  392  GTPKLNFYDIDFGWGKPQKYEAISIDYKGSVAINASKESTQDFEIGLCFPNMQMKAFADI  451

Query  280  FEEGLQA  260
            F  G ++
Sbjct  452  FNHGFES  458



>gb|AAO38058.1| malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6''-O-malonyltransferase 
[Pericallis cruenta]
Length=461

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 117/187 (63%), Gaps = 5/187 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTC Y+W+C+ +S        R  +D+   F+   DCR+RLD P+P  YFGNC  P
Sbjct  275  SSFTVTCGYIWSCIAKSLVKIG--ERKGEDELEQFIITIDCRSRLDPPIPTAYFGNCGAP  332

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   K   L +E G A  A+ IGE+I + +  ++G+L+ A  W+  F   +  R + VA
Sbjct  333  CVPTLKNVVLTSENGYALGAKVIGESICKMIYNKDGILKDAARWHEPFMIPA--RKIGVA  390

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            G+P+L+ Y  DFGWGKP K ET SIDY+ +I +  +K S  D+E+G+S+P+ +M    ++
Sbjct  391  GTPKLNLYDFDFGWGKPIKYETVSIDYNTSISINASKTSAQDLEIGLSLPSMQMEAFSSI  450

Query  280  FEEGLQA  260
            F+EGL++
Sbjct  451  FDEGLES  457



>sp|Q8GSN8.1|3MAT_DAHPI RecName: Full=Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase; 
Short=Dv3MaT; Short=Malonyl CoA:anthocyanin 
3-O-glucoside-6''-O-malonyltransferase [Dahlia pinnata]
 gb|AAO12206.1| malonyl CoA:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Dahlia pinnata]
Length=460

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 114/190 (60%), Gaps = 11/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDE---DDDTVYFLCAADCRARLDTPLPANYFGNC  647
            SSF VTC Y+W+C+++S      +N  E   +D+   F+ +  CR+RLD PLP NYFGNC
Sbjct  274  SSFTVTCGYIWSCIVKSL-----VNMGEKKGEDELEQFIVSVGCRSRLDPPLPENYFGNC  328

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERIL  467
              PCIV  K G L  E G   AA+ IGE I + +  + G+L  A+ W   F   +  R +
Sbjct  329  SAPCIVTIKNGVLKGENGFVMAAKLIGEGISKMVNKKGGILEYADRWYDGFKIPA--RKM  386

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLL  290
             ++G+P+L++Y +DFGWGK  K E  SIDYS ++ +   KES  D E+GV  P+ +M   
Sbjct  387  GISGTPKLNFYDIDFGWGKAMKYEVVSIDYSASVSLSACKESAQDFEIGVCFPSMQMEAF  446

Query  289  KTLFEEGLQA  260
              +F +GL++
Sbjct  447  GKIFNDGLES  456



>ref|XP_009397893.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=454

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 118/188 (63%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VVT AY W CL++++ F        DD   +F  AADC+ARL  P+PA YFGNCLV 
Sbjct  276  STTVVTYAYAWFCLVKTRAF-------ADDRIAHFAFAADCKARLRPPVPATYFGNCLVA  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  KAG+L  E+GVAAAA AI + +   ++   G L GA +    + +V+ E+ LSVA
Sbjct  329  CFVEMKAGELTGEDGVAAAAIAISKVVQGFID---GPLEGAAELPEKYKSVASEQALSVA  385

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+L  Y++DFGWGKPKK+E  SI  +GA+ V  ++E    +E+G  +P  +M  LK  
Sbjct  386  GSPKLRVYEVDFGWGKPKKVEVISIVRTGAMSVAESREEEGGVEIGFVLPKLEMDKLKAH  445

Query  280  FEEGLQAL  257
            F  GL+ L
Sbjct  446  FSGGLKLL  453



>ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransferase [Vitis vinifera]
 emb|CBI18018.3| unnamed protein product [Vitis vinifera]
Length=458

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 117/187 (63%), Gaps = 4/187 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SS  V C+Y W C+ +++   S  +  ++++  +F+   DCRARL+ PLP NYFGNCL P
Sbjct  271  SSLTVACSYTWACVAKARARSS--DEVDENELQHFVFPVDCRARLNPPLPENYFGNCLAP  328

Query  637  CIVRAKAGQLaaeeg-vaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V  K+ QL  +E    AA  A+GEA+ + L+ EEGVLRGAE W S   +++ ER L  
Sbjct  329  CFVAIKSTQLIDDEDGFVAAVNAMGEALGKTLQNEEGVLRGAEKWLSDLESLNKERTLGA  388

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKT  284
            + SP+   Y +DFG+G+ +K E  SID + +I +   K ++ DIEVGV++P   M +  +
Sbjct  389  SASPKFAVYNIDFGFGRLQKREMISIDETNSISLHEGKTNMGDIEVGVALPKMTMDVFAS  448

Query  283  LFEEGLQ  263
            +F  GL+
Sbjct  449  IFANGLK  455



>ref|XP_009620758.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=452

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 122/201 (61%), Gaps = 14/201 (7%)
 Frame = -3

Query  832  VARQPS-----SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV-YFLCAADCRARLDTPL  671
            ++R+PS     SF VTCAY+WTCL++S+   + I  + D++ V +F CAADCRARL+ P+
Sbjct  257  LSRRPSLTHVTSFTVTCAYVWTCLIKSE---AAIGEEIDENGVEFFGCAADCRARLNPPI  313

Query  670  PANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFG  491
            P  YFGNC+V  + R +   LA +EG   A E IGE I ++++ EE +L G+  W     
Sbjct  314  PPTYFGNCIVGYVARTRHADLAGKEGFTIAVELIGETIQKRMKDEEWILNGS--WFKECC  371

Query  490  TVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGV  320
            T+   R LS+ GSP+ D Y  DFGWGK +K+E  SI+ +  + +  +K      D+E+G 
Sbjct  372  TIDGNRSLSITGSPKFDLYAADFGWGKLEKLEFVSINNNNGVTMSLSKSKDSDGDLEIGF  431

Query  319  SVPAAKMHLLKTLFEEGLQAL  257
            S+P  +M+    +F  GL  L
Sbjct  432  SLPKTQMNAFAAIFTHGLSFL  452



>ref|XP_011090949.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=463

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 115/188 (61%), Gaps = 7/188 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV-YFLCAADCRARLDTPLPANYFGNCLV  641
            SSF +T AY+WTCL++S    +G   + DD+   YF+ A D R RLD P+PA YFGNC+ 
Sbjct  279  SSFTITTAYVWTCLVKSA---AGAGEEVDDNEPEYFVFAVDARRRLDPPVPAAYFGNCVA  335

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
              +V +  GQL  E G + A E IGE I +++  ++ +LR AE W S F  +  +R + V
Sbjct  336  FGMVESTHGQLKVENGFSVAVELIGEVICKRVNNKDEILRDAESWVSKFSGLVRKRAMGV  395

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLK  287
            AGSPR D Y  +FGWGKPKK E  SID S ++ + C    L+  +++G+S+P  KM    
Sbjct  396  AGSPRFDLYDTEFGWGKPKKYEVVSIDGSESMSL-CKSRELEGGLQIGLSLPEKKMRAFA  454

Query  286  TLFEEGLQ  263
             +F  GL+
Sbjct  455  AIFSAGLK  462



>ref|XP_009400673.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ + T AY+W CL++++ + S       D T +F+ AADCR RL  PLPA YFGNCL  
Sbjct  270  STIMATYAYVWVCLIKARAYGS-------DRTAHFMFAADCRGRLRPPLPAAYFGNCLGA  322

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  KAG+L  E GV +AA+AIG+AI R     +  LRGAE W      V+ ++ LSVA
Sbjct  323  CFVEVKAGELLRENGVVSAAKAIGKAIER---FGDDPLRGAETWPERIKYVALQQPLSVA  379

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFGWG+PKK+E TSI  SGA+ +  ++ E   +E+G+ +   +M    T 
Sbjct  380  GSPRFRVYDLDFGWGRPKKVEVTSIVRSGAMSLAESRDEDGGVEIGMGLLKHEMDEFATH  439

Query  280  FEEGLQAL  257
            F +GL  L
Sbjct  440  FIDGLDRL  447



>ref|XP_011076802.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Sesamum indicum]
Length=461

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 112/189 (59%), Gaps = 5/189 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF + CA +W C  +S   PSG     DD+  YF   ADCR RL+ PLPANYFGNC+  
Sbjct  274  SSFTIICALVWVCSAKSAA-PSG-EHVPDDEPEYFGFVADCRGRLNPPLPANYFGNCVAL  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                   G++   +G   AA+AIGEAI   +  E+GVL GAE W   +G +  +R   VA
Sbjct  332  VKAELNHGEVKGNDGFVMAAKAIGEAIKETVYSEKGVLYGAEKWPDEYGKLVGKRQYGVA  391

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSPR ++Y +D+GWGKPKK E   ID  G+I + C     +  +E+G+S P  +M    T
Sbjct  392  GSPRFNFYAVDYGWGKPKKFEALFIDGGGSISL-CKSRDFEGGLEIGLSKPKVQMDAFTT  450

Query  283  LFEEGLQAL  257
            +F+E L++L
Sbjct  451  VFKEILESL  459



>ref|XP_007043451.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX99282.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=466

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 116/188 (62%), Gaps = 6/188 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVV+CA++WT L+++Q    G  + EDD+  YF   ADCR R +  +P  Y GNCL  
Sbjct  282  STFVVSCAFVWTSLIKAQEL-CGRGKHEDDEFHYFCFVADCRNRPEFAIPETYLGNCLSI  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-RILSV  461
            C VR K  +L  E GV AA +AIG    R  E E+G LR AE W + +  +S    ++++
Sbjct  341  CFVRMKRRELLGENGVVAATKAIG---KRVWEFEKGALREAEKWLTNWKEISETGHLVTI  397

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKT  284
            +GSP+L  Y+ DFGWGKPKK E   ID SGAIY+G ++ E   IE+G+++   +M     
Sbjct  398  SGSPKLRAYETDFGWGKPKKTEVVQIDVSGAIYLGDSRDEEGGIEIGLALNKDEMEAFHG  457

Query  283  LFEEGLQA  260
             FE+GL+ 
Sbjct  458  FFEQGLKT  465



>ref|XP_009620757.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 7/190 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+WTCL++S+   +G   DE+    +F CAADCRA+ + PLP +YFGN LV 
Sbjct  268  TSFTVTCAYVWTCLIKSEA-ATGEEIDENG-MEFFGCAADCRAQFNPPLPPSYFGNALVG  325

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             + R +   LA +EG   A E IGEAI ++++ EE +L G+  W   +  V  +R LSVA
Sbjct  326  YVARTRQVDLAGKEGFTIAVELIGEAIRKRMKDEEWILSGS--WFKEYDKVDAKRSLSVA  383

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGVSVPAAKMHLLK  287
            GSP+LD Y  DFGWG+P+K+E  SID    I +  +K      D+E+G+S+   +M+   
Sbjct  384  GSPKLDLYAADFGWGRPEKLEFVSIDNDDGISMSLSKSKDSDGDLEIGLSLSKTRMNAFA  443

Query  286  TLFEEGLQAL  257
             +F  G+  L
Sbjct  444  AMFTHGISFL  453



>ref|XP_007043459.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX99290.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
Length=465

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 114/190 (60%), Gaps = 6/190 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQ-CFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLV  641
            S+FVVT A++W CL++S+    + ++RD+DD   + L   DCR RL+ P+P  YFGNCL 
Sbjct  279  STFVVTSAFVWVCLIKSKDSATNNLSRDDDDKFYFLLFPFDCRNRLEFPVPPTYFGNCLR  338

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERILS  464
            P +V     +L  E G+  A++ IG   ++  E E   LRGAE W ++    +   R+ +
Sbjct  339  PGVVDVTKSELIGENGILLASKVIG---NKIKEMERSGLRGAEHWISTLVERMKSRRLTA  395

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLK  287
            VAGSP+   Y  DFGWG+P K+E T IDY GAI +  C  E   IEVG+++   +M    
Sbjct  396  VAGSPKFHVYDTDFGWGRPCKVELTHIDYDGAISLAECKDEPGGIEVGLALNKNQMDEFI  455

Query  286  TLFEEGLQAL  257
            T+FE+ L+ L
Sbjct  456  TIFEQSLKLL  465



>ref|XP_009780993.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
sylvestris]
Length=453

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 125/200 (63%), Gaps = 12/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+P     +SF VTCAY+WTC+++S+   + +   +++   +F CAADCRA+ + PLP
Sbjct  258  LSRRPNLTHVTSFTVTCAYVWTCVIKSEA--AIVEEIDENGMEFFGCAADCRAQFNPPLP  315

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             +YFGN LV  + R +   LA +EG   AAE IGEAI ++++ EE +L G+  W   FG 
Sbjct  316  PSYFGNALVGYVARTRHVDLAGKEGFIIAAELIGEAIQKRMKDEEWILSGS--WFKEFGK  373

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGVS  317
            V  +R +SVAGSP+LD Y  DFGWG+ +K+E  SID   +I +  +K      D+E+G+S
Sbjct  374  VDEKRSVSVAGSPKLDLYAADFGWGRAEKLEFVSIDSGDSISMSLSKSKDSDGDLEIGLS  433

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +   +M+    +F  GL  L
Sbjct  434  LSKTRMNAFAAMFTHGLSFL  453



>ref|XP_011093436.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 113/189 (60%), Gaps = 7/189 (4%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            Q SSFVVT +Y+WTC ++S+        D+DD    F+ AAD RAR+D P+PA+YFGNCL
Sbjct  269  QVSSFVVTASYVWTCFVKSEE-----QVDDDDVLQVFIFAADIRARIDPPVPASYFGNCL  323

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
               + + +  QL   EG   AAEAI + I  +L  ++ VL+GAE+W S    ++  R   
Sbjct  324  AYGLAKIEHKQLVGGEGFVIAAEAIADQIKNRLNNKDQVLKGAENWLSETKEMTAIRAFG  383

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLL  290
            V+GSP+ D    DFGWG+ +K+ET SID        C     +  +EVG+S+P A+M   
Sbjct  384  VSGSPKFDLCSADFGWGRARKLETVSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAF  443

Query  289  KTLFEEGLQ  263
              +FEEGL+
Sbjct  444  AAIFEEGLR  452



>dbj|BAD93691.1| malonyltransferase [Nicotiana tabacum]
Length=453

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 118/190 (62%), Gaps = 7/190 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+WTC+++S+   +G   DE+    +F CAADCRA+ + PLP +YFGN LV 
Sbjct  268  TSFTVTCAYVWTCIIKSEA-ATGEEIDENG-MEFFGCAADCRAQFNPPLPPSYFGNALVG  325

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             + R +   LA +EG   A E IGEAI ++++ EE +L G+  W   +  V  +R LSVA
Sbjct  326  YVARTRQVDLAGKEGFTIAVELIGEAIRKRMKDEEWILSGS--WFKEYDKVDAKRSLSVA  383

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGVSVPAAKMHLLK  287
            GSP+LD Y  DFGWG+P+K+E  SID    I +  +K      D+E+G+S+   +M+   
Sbjct  384  GSPKLDLYAADFGWGRPEKLEFVSIDNDDGISMSLSKSKDSDGDLEIGLSLSKTRMNAFA  443

Query  286  TLFEEGLQAL  257
             +F  G+  L
Sbjct  444  AMFTHGISFL  453



>ref|XP_004248143.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Solanum lycopersicum]
Length=454

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 121/200 (61%), Gaps = 11/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            ++R+P     +SF +TCAY+WTCL++S+        DED   + F C ADCR+RL+ PLP
Sbjct  258  LSRRPNLSYVTSFTITCAYIWTCLIKSKFAIEDEMIDEDVMEI-FGCVADCRSRLNPPLP  316

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             +YFGNCLV    +A   +L  +EG   A E IGEAI  Q++  E +L  +  W   F  
Sbjct  317  QSYFGNCLVTIASKASRVELVGKEGFITAVEVIGEAIKSQMKDVELILNCS--WYREFCG  374

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK---ESLDIEVGVS  317
            ++ +  LSV+GSP+ + Y++DFGWG+P+KIE  SID S  I +  +K      D+EVG+S
Sbjct  375  INMKHTLSVSGSPKFNLYEVDFGWGRPEKIEIISIDNSSGISMSISKYKDSHGDLEVGLS  434

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +P  +M+    +F  GL  L
Sbjct  435  LPKTRMNAFVAIFNHGLSFL  454



>ref|XP_007215354.1| hypothetical protein PRUPE_ppa005488mg [Prunus persica]
 gb|EMJ16553.1| hypothetical protein PRUPE_ppa005488mg [Prunus persica]
Length=458

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 114/196 (58%), Gaps = 12/196 (6%)
 Frame = -3

Query  841  AGQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            A Q     S+F + CAY W C+++++        D   D    + + DCR+RLD P+PAN
Sbjct  274  AEQKPVHVSTFTLACAYTWVCVVKAE--------DIKADKTRLIFSMDCRSRLDPPIPAN  325

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNC+  CI  A+   L  E+G+  A +AI EA       E+GVL GAE+W S    VS
Sbjct  326  YFGNCIAGCIPVAETKGLLGEDGLVVAVKAISEAKE---SLEKGVLDGAENWVSRLFAVS  382

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAA  305
              R+LS++GS R  +Y  DFGWG+PKK E  SID + AI +  +K     IEVG+++   
Sbjct  383  EGRMLSISGSHRFGFYDTDFGWGRPKKFEIVSIDRNRAISLSDSKTGAGAIEVGLALDKH  442

Query  304  KMHLLKTLFEEGLQAL  257
             MH+  +LF +GL+ L
Sbjct  443  DMHVFASLFAKGLRNL  458



>ref|XP_011093437.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 113/189 (60%), Gaps = 7/189 (4%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            Q SSFVVT +Y+WTC ++S+        D+DD    F+ AAD RAR+D P+PA+YFGNCL
Sbjct  269  QVSSFVVTASYVWTCFVKSEE-----QVDDDDVLQVFIFAADIRARIDPPVPASYFGNCL  323

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
               + + +  QL   EG   AAEAI + I  +L  ++ VL+GAE+W S    ++  R   
Sbjct  324  AYGLAKIEHKQLVGGEGFVIAAEAIADQIKNRLNNKDQVLKGAENWLSETKEMTAIRAFG  383

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLL  290
            V+GSP+ D    DFGWG+ +K+ET SID        C     +  +EVG+S+P A+M   
Sbjct  384  VSGSPKFDLCSADFGWGRARKLETVSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAF  443

Query  289  KTLFEEGLQ  263
              +FEEGL+
Sbjct  444  AAIFEEGLR  452



>ref|XP_010657393.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Vitis 
vinifera]
Length=458

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 114/186 (61%), Gaps = 3/186 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W C+ +++   SG +  E++   +     DCRA  D P+PANYFGNCL P
Sbjct  272  SSFTVACAYVWACMAKARA-KSGEDVGENEPE-HLAFVGDCRAYFDPPIPANYFGNCLAP  329

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C    K+ +L  E+G   AA  IG+AI  +L  +EG+L+G E W S + +++ +RI  VA
Sbjct  330  CSATVKSLELITEDGFIVAANTIGKAIQERLRNKEGILKGLEKWMSNYKSLNPKRIFGVA  389

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+   Y +DFG G+P K E  SID + +I +   + +  D+E+G+S P  KM +  ++
Sbjct  390  GSPKFSCYDIDFGLGRPCKGEIISIDVTKSISLNEGRNNKEDVEIGLSFPKIKMDVFTSI  449

Query  280  FEEGLQ  263
            F  GL+
Sbjct  450  FVNGLK  455



>ref|XP_011093435.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 111/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            Q SSFVVT +Y+WTC ++S+        D+DD   +F+ AAD RAR+D P+PA+YFGNCL
Sbjct  269  QVSSFVVTASYVWTCFVKSEE-----QVDDDDVLEFFIFAADIRARIDPPVPASYFGNCL  323

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
                 + +  QL   EG   AAEAI + I  ++  +E VL+GAE+W S    +   R   
Sbjct  324  GYGAAKIEHKQLVGGEGFVIAAEAIADQIKNRVNNKEEVLKGAENWLSEINKMKTIRAFG  383

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLL  290
            V+GSP+ D    DFGWG+ +K+E  SID        C     +  +EVG+S+P A+M   
Sbjct  384  VSGSPKFDLSSADFGWGRARKLEVVSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAF  443

Query  289  KTLFEEGLQ  263
              +FEEGL+
Sbjct  444  AAIFEEGLR  452



>ref|XP_009400945.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
{ECO:0000303|PubMed:12481098}-like [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 115/188 (61%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ + T AY+W CL++++ + S       D T +F+ AADCR RL  PLPA YFGNC+  
Sbjct  238  STIMATYAYVWVCLVKARAYGS-------DRTAHFIFAADCRGRLRPPLPAAYFGNCIGA  290

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V AKAG L  E GV +AA+AIG+AI    E  +  LRG E W     ++   + LSVA
Sbjct  291  CFVEAKAGDLLRENGVVSAAKAIGKAIE---EFADDPLRGVETWPERIKSIVPRQPLSVA  347

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFGWG+PKK+  TSI  SGA+ +  ++E    +E+G+ +P  +M    T 
Sbjct  348  GSPRFRVYDLDFGWGRPKKVVITSIMRSGAMSMAESREEEGGVEIGLVLPKHEMDQFGTC  407

Query  280  FEEGLQAL  257
            F +GL+ L
Sbjct  408  FSDGLEQL  415



>ref|XP_011100332.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=450

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 110/190 (58%), Gaps = 10/190 (5%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLC-AADCRARLDTPLPANYFGNC  647
            Q SSF VT +Y+WTC ++S           DDD + F C AAD R+R+D P+PANYFGNC
Sbjct  267  QVSSFTVTASYVWTCFIKS-------GEQVDDDELEFFCFAADIRSRIDPPVPANYFGNC  319

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERIL  467
            L   +   +  QL  EEG   AAEAI + I  ++  ++ VL+GAE+W S    ++  R  
Sbjct  320  LSYGLAIMEHKQLVGEEGFVMAAEAIADQIKNKVNNKDEVLKGAENWVSDLRAMNVIRAF  379

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHL  293
             V+GSP+ D Y  DFGWG P+K+E   ID        C     D  +E+G+S+P A+M  
Sbjct  380  WVSGSPKFDLYNADFGWGSPRKLEVLMIDEQKYSMSLCKSRDSDGVLEIGMSLPKARMET  439

Query  292  LKTLFEEGLQ  263
              T+F +GL+
Sbjct  440  FATIFNDGLR  449



>gb|EPS62795.1| hypothetical protein M569_11994 [Genlisea aurea]
Length=455

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 107/188 (57%), Gaps = 6/188 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCA +W CL++S+          DD+  YF  AADCR RL+ PLPA YFGNCL  
Sbjct  273  TSFTVTCALVWACLVKSEA-----GSVPDDEPEYFGLAADCRERLNPPLPATYFGNCLAF  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                A  G L   +G   AAE++G AI   +  E G+L GAE W S FG +  +R+  V+
Sbjct  328  VKAEATHGSLRRNDGFLVAAESLGLAIQESVYNERGILDGAEGWPSDFGKLIGKRLFGVS  387

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR D Y  DFGWG+P+K E+ SID   ++ +  ++ S   +E G+S    K+      
Sbjct  388  GSPRFDLYDADFGWGRPRKFESASIDRDNSMSLSKSRFSDGGLEFGLSRTKKKLDAFAAA  447

Query  280  FEEGLQAL  257
            F E L+ L
Sbjct  448  FIETLRTL  455



>dbj|BAF99690.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=471

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 110/197 (56%), Gaps = 8/197 (4%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            +AR+P     S+F + C  +W C  +  C   G  +  +DD   F+C  D R+R+D P+P
Sbjct  274  LARRPTLEHLSTFTIACGLVWVCSAKV-CDALGEYKGMEDDREQFICVVDGRSRMDPPIP  332

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
            + YFGNCLVPCIV  K  QL   EG+  A E +G AI ++   ++G+  GAE W   F  
Sbjct  333  STYFGNCLVPCIVLCKRNQLLEGEGLINAVEFLGGAIRKRCNNKDGIFAGAESWGEQF-M  391

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVP  311
             S    L VAGSP+   Y  DFGWGKP K E  SIDY G + +  C     D+E+G+ + 
Sbjct  392  ASPRTTLGVAGSPKFSIYDTDFGWGKPSKCEAVSIDYGGTMSLSDCKDSKEDVEIGLLLA  451

Query  310  AAKMHLLKTLFEEGLQA  260
              ++ +  ++F E L++
Sbjct  452  KNQLDVFNSIFTEELKS  468



>ref|XP_011079054.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=455

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 110/189 (58%), Gaps = 6/189 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++F+VTCA +W CL++            DD+  YF  AADCR RL  PLPA YFGNCL  
Sbjct  271  TAFIVTCALVWVCLVKVD---GATETLADDEPEYFCFAADCRGRLSPPLPAAYFGNCLGF  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +  G L   +G   AA+++GEAIH+ +  E+G+L GAE+W   FG +  +R+  VA
Sbjct  328  VKAESTHGLLKGNDGFLFAAQSVGEAIHKTVNNEKGILDGAENWPRQFGKLIGKRLFGVA  387

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSPR D Y +D+GWG+P K E+ SID   ++ + C     +  +E+G+S P   +     
Sbjct  388  GSPRFDLYDVDYGWGRPIKFESASIDADTSMSL-CKSRDFEGGLEIGLSRPKEILDAFAA  446

Query  283  LFEEGLQAL  257
            +F E L+ L
Sbjct  447  IFTEALRNL  455



>dbj|BAF99691.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=471

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 110/197 (56%), Gaps = 8/197 (4%)
 Frame = -3

Query  832  VARQPS-----SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            +AR+P+     +F + C  +W C  +  C   G  +  +DD   F+C  D R+R+D P+P
Sbjct  274  LARRPTLEHLPTFTIACGLVWVCSAKV-CDALGEYKGMEDDREQFICVVDGRSRMDPPIP  332

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
            + YFGNCLVPCIV  K  QL   EG+  A E +G AI ++   ++G+  GAE W   F  
Sbjct  333  STYFGNCLVPCIVLCKRNQLLEGEGLINAVEFLGGAIRKRCNNKDGIFAGAESWGEQF-M  391

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVP  311
             S    L VAGSP+   Y  DFGWGKP K E  SIDY G + +  C     D+E+G+ + 
Sbjct  392  ASPRTTLGVAGSPKFSIYDTDFGWGKPSKCEAVSIDYGGTMSLSDCKDSKEDVEIGLLLA  451

Query  310  AAKMHLLKTLFEEGLQA  260
              ++ +  ++F E L++
Sbjct  452  KNQLDVFNSIFTEELKS  468



>ref|XP_008231007.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Prunus 
mume]
Length=404

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 114/197 (58%), Gaps = 13/197 (7%)
 Frame = -3

Query  841  AGQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            A Q     S+F + CAY W C+++++        D   D    + + DCR+RLD P+PAN
Sbjct  219  AEQKPVHVSTFTLACAYTWVCVVKAE--------DIKADKTRLIFSMDCRSRLDPPIPAN  270

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTV  485
            YFGNC+  CI  A+   L  E+G+  A  AI EAI R    ++GVL GAE+W S  F   
Sbjct  271  YFGNCIAGCIPVAETKGLLGEDGLVVAVNAISEAIER---LKKGVLDGAENWVSRLFALG  327

Query  484  SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPA  308
            S  R+LS+AGS R   Y +DFGWG+PKK E  SID + A  +  +K     IEVG+++  
Sbjct  328  SEGRMLSIAGSNRFGNYDIDFGWGRPKKFEIVSIDRTRAFSLSDSKTGAGAIEVGLALDK  387

Query  307  AKMHLLKTLFEEGLQAL  257
              MH+  +LF +GL+ L
Sbjct  388  HDMHVFASLFAKGLRNL  404



>ref|XP_009400675.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
{ECO:0000303|PubMed:12481098}-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 115/188 (61%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ + T AY+W CL++++ + S       D   +F+ AADCR RL  PLPA YFGNC+  
Sbjct  273  STIMATYAYVWVCLVKARAYGS-------DRAAHFIFAADCRGRLRPPLPAAYFGNCIGV  325

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V AKAG L  E GV +AA+AIG+AI    E  +  LRGAE W     ++   + LSVA
Sbjct  326  CFVEAKAGDLLRENGVVSAAKAIGKAIE---EFADDPLRGAETWPERIKSIVPRQPLSVA  382

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFGWG+PKK+  TSI  SGA+ +  ++E    +E+G+ +P  ++    T 
Sbjct  383  GSPRFRVYDLDFGWGRPKKVVITSIMRSGAMSMAESREEEGGVEIGLVLPKHEIDQFGTC  442

Query  280  FEEGLQAL  257
            F +GL+ L
Sbjct  443  FSDGLEQL  450



>ref|XP_011079053.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=455

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (58%), Gaps = 6/189 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++F VTCA +W CL++       +    DD+  YF  AADCR RL  PLPA YFGNCL  
Sbjct  271  TAFTVTCALVWVCLVKVDGAAETL---ADDEPEYFCFAADCRGRLTPPLPAAYFGNCLAF  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +  G L   +G   AA+++GEAIH+ +  E+G+L GAE+W   FG +  +R+  VA
Sbjct  328  VKAESTHGLLKGNDGFLFAAQSVGEAIHKTVNNEKGILDGAENWPRQFGKLIGKRLFGVA  387

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSPR D Y +D+GWG+P K E+ SID   ++ + C     +  +E+G+S P   +     
Sbjct  388  GSPRFDLYDVDYGWGRPIKFESASIDADTSMSL-CKSRDFEGGLEIGLSRPKEILDAFAA  446

Query  283  LFEEGLQAL  257
            +F E L  L
Sbjct  447  IFTEALGNL  455



>gb|AAS77403.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Glandularia 
x hybrida]
Length=470

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 107/186 (58%), Gaps = 3/186 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF +T AY+WTCL +S    +       D+T YF+ A D R R++ P PA YFGNC+VP
Sbjct  281  SSFTITTAYVWTCLAKSSA--AAGEEVAADETEYFVFAVDARQRINPPAPATYFGNCVVP  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +   +L  + G   A   +G+ I ++   ++ +LRGA++W +  G +  +R+  VA
Sbjct  339  AFAESTHSELKGKNGFLTAVGLVGDVISKKANNKDEILRGADEWLAKLGGMIGKRLFGVA  398

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSP+ D Y  DFGWG P K E+  ID  G++ +  ++E    +E+G+S+P  KM     +
Sbjct  399  GSPKFDLYDADFGWGNPNKYESVGIDVDGSMSLCKSREFEGGLEIGLSLPKKKMDAFGDV  458

Query  280  FEEGLQ  263
            F  GL+
Sbjct  459  FCGGLK  464



>dbj|BAF99692.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=470

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 114/188 (61%), Gaps = 4/188 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CA  WT L++ +    G N+D DDD   F CAADCRAR D PLPA YFGNC+  
Sbjct  281  STFTIVCAIAWTSLVKVRDAIGG-NKD-DDDRELFGCAADCRARTDPPLPATYFGNCITG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+  AK  QL  +EG   A + IG+ IH + + +  +  GAE W     +      + VA
Sbjct  339  CVAPAKRDQLLGKEGFLNAVKLIGDGIHERFKNKNSIFAGAEFWMQDIKSYP-PTAIGVA  397

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+   Y  DFGWG PKK E  +IDYSG+I +  +++S  DIE+G+S+P  +M + +T+
Sbjct  398  GSPKFSLYDTDFGWGNPKKCEIVTIDYSGSISLSSSRDSKEDIEIGLSLPKIQMDVFETI  457

Query  280  FEEGLQAL  257
            F   L+++
Sbjct  458  FSNELRSV  465



>gb|KHN48829.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=239

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 114/190 (60%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+ +C ++++          + + V F+ + DCRARLD P+P  YFGN +V 
Sbjct  60   TSFTVTCAYLLSCAVKAE--------QPNCERVPFIFSVDCRARLDPPIPGTYFGNSVVS  111

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFER--ILS  464
             +V AK  +L  EE    +   I E ++R    E  VL GA+ W     +V  ER  + S
Sbjct  112  LLVIAKREELLGEEAFFKSVLGISEELNR---IEGDVLNGADRWMPKIQSVMSERPRLFS  168

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLK  287
            VAGSPR + Y +DFGWG+PKK++ TS+D +GA  +   ++ S  I++G+++  ++M    
Sbjct  169  VAGSPRFEVYDVDFGWGRPKKVDVTSVDKTGAFSLSETRDHSGGIQIGLALTKSQMEAFS  228

Query  286  TLFEEGLQAL  257
            T+F +GL++L
Sbjct  229  TVFAQGLESL  238



>dbj|BAF99693.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=470

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 113/188 (60%), Gaps = 4/188 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CA +WT L++ +    G N+D+DD  V F CAADC AR D PLPA YFGNC+  
Sbjct  281  STFTIVCAIVWTSLVKVRN-AIGENKDDDDREV-FGCAADCMARTDPPLPATYFGNCITG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+  AK  QL  EEG   A   IG  IH + + +  V  GAE W     +      + VA
Sbjct  339  CVAPAKRDQLLGEEGFLNAVRLIGYGIHERFKNKNSVFAGAEFWMQDIKSYP-PTAIGVA  397

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+   Y  DFGWG PKK E  SIDYSG+I +  +++S  DIE+G+S+P  +M + +T+
Sbjct  398  GSPKFSLYDTDFGWGNPKKCEIVSIDYSGSISLSSSRDSKEDIEIGLSLPKIQMDVFETI  457

Query  280  FEEGLQAL  257
            F   L+++
Sbjct  458  FSNELRSV  465



>ref|XP_011047482.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Populus euphratica]
Length=466

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 112/196 (57%), Gaps = 8/196 (4%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANY  659
            GQV    S+FVV CAY W  L++SQ   +  + D +D   YF+  ADCR R +  LPA Y
Sbjct  276  GQV--HVSTFVVACAYTWVNLIKSQEKEASDSLD-NDKVCYFVFVADCRHRPEVKLPATY  332

Query  658  FGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSF  479
            FGNCL  C V AK  +L    G      A  E   +  E E GVL GAE W S +  VS 
Sbjct  333  FGNCLAICYVPAKKSEL---LGENGIIMAAREIGKKVKELESGVLVGAEKWISKWKEVSE  389

Query  478  E-RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-GCAKESLDIEVGVSVPAA  305
            + R+++VAGSP+L  Y+ DFG G+PKK E   I  SG+ ++  C      +E+G+++P  
Sbjct  390  QGRLVTVAGSPKLRAYETDFGLGRPKKTEVPHIYASGSFHLCECRDGGGGVEIGLALPQG  449

Query  304  KMHLLKTLFEEGLQAL  257
            +M +  ++FE+G Q L
Sbjct  450  QMDVFSSIFEQGKQNL  465



>ref|XP_011100333.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=451

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV-YFLCAADCRARLDTPLPANYFGNC  647
            Q SSFVVT +Y+WTCL++S           DDD + YF+ AAD R R+D P+PANYFGNC
Sbjct  268  QVSSFVVTVSYVWTCLVKS-------GEQVDDDVLEYFIFAADIRERIDPPVPANYFGNC  320

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERIL  467
            L     R +  QL  E+G   A EAI + I  ++  ++ VL+GAE+W S    ++  R +
Sbjct  321  LGYGAARIEHKQLVGEQGFVMAVEAIADQIKNRVNKKDEVLKGAENWLSKIKKMTGIRSV  380

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHL  293
             V+GSP+ D   +DFGWG+ +K+E  SID        C     +  +EVG+S+P  +M  
Sbjct  381  GVSGSPKFDLSTVDFGWGRARKLEVVSIDGEKHSISLCKSRDSEGGLEVGMSLPRTRMEA  440

Query  292  LKTLFEEGLQ  263
               +F++GL+
Sbjct  441  FAAIFDDGLR  450



>ref|XP_002326110.2| anthocyanin acyltransferase family protein [Populus trichocarpa]
 gb|EEF00492.2| anthocyanin acyltransferase family protein [Populus trichocarpa]
Length=466

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 115/196 (59%), Gaps = 8/196 (4%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANY  659
            GQV    S+FVV CA+ W  L++SQ      +  ++D   YF+  ADCR R +  LPA Y
Sbjct  276  GQV--HVSTFVVACAFTWVNLIKSQE-KEASDLLDNDKVYYFVFVADCRHRPEVKLPATY  332

Query  658  FGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSF  479
            FGNCL  C V AK  +L  E G+  AA  IG+   +  E E GV  GAE W S +  VS 
Sbjct  333  FGNCLAICYVPAKKIELLGENGIIMAAREIGK---KVKELESGVFVGAEKWISKWKEVSE  389

Query  478  E-RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-GCAKESLDIEVGVSVPAA  305
            + R+++VAGSP+L  Y+ DFGWG+PKK E   I  SG+ ++  C      +E+G+++P  
Sbjct  390  QGRLVTVAGSPKLRAYETDFGWGRPKKTEVPHIYASGSFHLCECRDGGGGVEIGLALPQG  449

Query  304  KMHLLKTLFEEGLQAL  257
            +M +   +FE+G Q L
Sbjct  450  QMDVFSGIFEQGKQNL  465



>gb|EYU24860.1| hypothetical protein MIMGU_mgv1a022453mg, partial [Erythranthe 
guttata]
Length=450

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 118/195 (61%), Gaps = 15/195 (8%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV--YFLCAADCRARLDTPLPANYFGN  650
            Q SSFV+T +Y+W CL++S+       R++ D+ V  YF+ + D RAR++ P+P NYFGN
Sbjct  258  QVSSFVITASYVWACLVKSE-------REKVDEEVMEYFVFSVDVRARMNPPVPFNYFGN  310

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL   + R +   L  EEG   A EAI E I  ++  ++ VL+GAE+W S    +   R+
Sbjct  311  CLGYGMARIERKWLVEEEGFVTAVEAIVEDIKNRVNDKDEVLKGAENWLSEMKELGEIRV  370

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSID---YSGAIYVGCAKESLDIEVGVSVPAAKM  299
            L VAGSP+ D +  DFGWG+ KK+E+ SID   YS ++Y         +E+G+S+P  +M
Sbjct  371  LGVAGSPKFDLHDADFGWGRAKKVESLSIDVDKYSMSLYKSVEG---GLEIGLSLPKERM  427

Query  298  HLLKTLFEEGLQALS  254
                 +F++GL  +S
Sbjct  428  EAFAAIFDDGLIKVS  442



>ref|XP_004489467.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 113/191 (59%), Gaps = 15/191 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+ +C ++ +        + + + V F+ + DCR RLD P+ ANYFGNC++P
Sbjct  279  STFSVTCAYLLSCTIKIE--------NPNSNKVAFIFSVDCRPRLDPPINANYFGNCVLP  330

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE---RIL  467
             +V AK      ++G  +A E I + ++     E GVL GAE+W S   +   E   R+ 
Sbjct  331  QLVMAKTEAWLKDDGFISALEGIIDTLNG---LENGVLNGAENWYSKMQSTMSETNGRMF  387

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLL  290
            S+AGSPR + Y  DFGWGKPKK++ TSID +GA  +   K +   IE+G+++   +M   
Sbjct  388  SIAGSPRFEVYNFDFGWGKPKKVDVTSIDKTGAFSLSENKNNDGGIEIGLALNKQQMDHF  447

Query  289  KTLFEEGLQAL  257
               F +GL++L
Sbjct  448  VQHFSQGLESL  458



>ref|XP_011100334.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 110/189 (58%), Gaps = 8/189 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++F VTCA +W CL++++          DD+  YF  AADCR RL+ PLPA YFGNCL  
Sbjct  274  TAFTVTCALVWVCLVKAEA-----GAVPDDEPEYFGFAADCRGRLNPPLPATYFGNCLAF  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +  G L  +EG   AAE++G AI + +  E+G+L GAEDW   F  +  +R+  VA
Sbjct  329  VKAESTHGLLRGKEGFLVAAESLGLAIQKTVYNEKGILDGAEDWPVEFRKLIGKRLFGVA  388

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSPR D Y  D+GWG+PKK E+ SID   ++ + C   + +  +E G+S    K+     
Sbjct  389  GSPRFDLYDADYGWGRPKKFESPSIDAETSMSL-CKSRNFEGGLEFGLSRTKKKLDSFAA  447

Query  283  LFEEGLQAL  257
            +F E L+ L
Sbjct  448  VFTETLRNL  456



>emb|CBI18011.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 117/196 (60%), Gaps = 5/196 (3%)
 Frame = -3

Query  835  QVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            Q+ +Q   S+F V CAY+W+C+++++   SG +  E++   +F   ADCR  LD P+PA 
Sbjct  297  QIPKQSHVSAFTVICAYVWSCMIKARS-RSGEDVGENE-LEHFAFTADCRTLLDPPIPAA  354

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNCL+  +   K+ +L  E+G   AA++I EAIH ++  + GVL+G + W S   +++
Sbjct  355  YFGNCLMGGLATTKSTRLIQEDGFIVAAKSIREAIHERVRNKGGVLKGVQQWVSDLKSLN  414

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAK  302
              R+ +V GSPR   Y +DFG+G+PKK E  S D    +  GC     D E+G+  P AK
Sbjct  415  RMRMAAVVGSPRFQVYNVDFGFGRPKKYEVISRDRYFTL-DGCKDNEEDFEIGLCFPKAK  473

Query  301  MHLLKTLFEEGLQALS  254
            M     +F  GL+A S
Sbjct  474  MDAFAEIFTNGLEAYS  489



>ref|XP_007217864.1| hypothetical protein PRUPE_ppa021495mg [Prunus persica]
 gb|EMJ19063.1| hypothetical protein PRUPE_ppa021495mg [Prunus persica]
Length=467

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 114/194 (59%), Gaps = 13/194 (7%)
 Frame = -3

Query  832  VARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            V +  S+F +TCAY W CL++++    G          Y     DCR+RLD P+ +NYFG
Sbjct  285  VQKYLSTFCITCAYTWVCLVKAEEIQGG--------KAYMGFTVDCRSRLDPPISSNYFG  336

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFE  476
            NCLV  +V A+   L  E+G+  A +AI EA+      ++GVL GAE+W    +     E
Sbjct  337  NCLVIRLVVAETKALLGEDGLTVAVKAICEAVK---SLDDGVLSGAENWIKPLYSVGGDE  393

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKM  299
            ++LSVAGSPR + Y+ DFGWG+P K+E  SI+ +GA+ +  +K+    ++VG+ +    M
Sbjct  394  KVLSVAGSPRFEVYETDFGWGRPNKVEVVSIEGTGAMSMSESKDGAGGVDVGLVLGKNSM  453

Query  298  HLLKTLFEEGLQAL  257
             +  TLF EGL  L
Sbjct  454  QVFATLFAEGLANL  467



>gb|EYU26095.1| hypothetical protein MIMGU_mgv1a006012mg [Erythranthe guttata]
Length=461

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 111/189 (59%), Gaps = 4/189 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF V CA +W CL++++   +      DD+  +F  AADCR RL+ PLPA YFGNCL  
Sbjct  275  TSFTVACALVWVCLVKAEAAEAATPV-ADDEPEFFCFAADCRGRLNAPLPAAYFGNCLAF  333

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +K G L  + G   AAE  GEAI +++  E+G+L GAE+W   FG +  +R+  VA
Sbjct  334  VKAESKHGLLKGDGGFVIAAECTGEAIQKRVYGEKGILHGAENWPLEFGKLIGKRLFGVA  393

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSPR D Y +D+GWG+PKK E+ SID   ++ + C     +  +E+G+S     ++    
Sbjct  394  GSPRFDLYDVDYGWGRPKKFESASIDGDTSMSL-CKSRDFEGGLEIGLSRSEKILNAFSA  452

Query  283  LFEEGLQAL  257
            +F + L  L
Sbjct  453  IFIQELGKL  461



>ref|XP_011100429.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=450

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 111/189 (59%), Gaps = 8/189 (4%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            Q SSFVVT +Y+WTC ++S        + +DD+  +F  AAD RAR+D P+PANYFGNCL
Sbjct  267  QVSSFVVTASYVWTCFVKSG------EQVDDDELEFFSFAADIRARIDPPVPANYFGNCL  320

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
               +   +  QL  EEG   AAEAI + I  ++  ++ VL+GAE+W S    ++  R   
Sbjct  321  GYGLAIMEHEQLVGEEGFVMAAEAIADQIKNKVNNKDEVLKGAENWVSDMRAMNAIRAFW  380

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLL  290
            V+GSP+ D    DFGWG  +K+E  +ID        C     D  +E+G+S+P A+M   
Sbjct  381  VSGSPKFDLSNADFGWGSARKLEVLTIDEEKYSMSLCKSRDSDGGLEIGMSLPMARMEAF  440

Query  289  KTLFEEGLQ  263
             T+F +GL+
Sbjct  441  ATIFNDGLR  449



>ref|XP_007043458.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX99289.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=467

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 102/192 (53%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVV C+ MW C+++SQ      N  +DD   YFL A DCR+R++ PLP  YFGNCL P
Sbjct  281  STFVVACSMMWICMVKSQESEISANCHDDDKFYYFLFAVDCRSRIEFPLPVTYFGNCLAP  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS--  464
             IVRAK G+L    G +    A      +  E E G L+  E      G  + E +L+  
Sbjct  341  GIVRAKKGEL---MGDSGIVTAAKAIARKVKEMESGALKEVEK-----GPSNLEEMLASG  392

Query  463  ----VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKM  299
                V+GSP+L  Y MDFGWG+P K+E   +D  G++ +  C  E   IEV + +   +M
Sbjct  393  HYLGVSGSPKLGIYGMDFGWGRPTKVEFIHLDDGGSLSLAECRDEPGGIEVSLVLSKDQM  452

Query  298  HLLKTLFEEGLQ  263
                  F E L+
Sbjct  453  DSFTAHFGESLR  464



>ref|XP_011047481.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Populus euphratica]
Length=466

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 110/196 (56%), Gaps = 8/196 (4%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANY  659
            GQV    S+FVV CA++W  +++SQ      +  ++D   YF+  ADCR RL+  LP+ Y
Sbjct  276  GQV--HVSTFVVACAFIWVNMIKSQE-KEASDLFDNDKVCYFVFVADCRHRLEVKLPSTY  332

Query  658  FGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSF  479
            FGNCL  C V AK  +L    G      A      +  E E GVL GAE W S +  VS 
Sbjct  333  FGNCLAICYVPAKKSEL---LGENGIIMAARAIGKKVKELESGVLVGAEKWISKWKEVSE  389

Query  478  E-RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-GCAKESLDIEVGVSVPAA  305
            + R+++VAGSP+L  Y+ DFGWG+PKK E   I  SG  ++  C      +EVG+++P  
Sbjct  390  QGRLVTVAGSPKLRAYETDFGWGRPKKTEVLHIYASGGFHLCECRDGGGGLEVGLALPQV  449

Query  304  KMHLLKTLFEEGLQAL  257
            +M +   +FE+  + L
Sbjct  450  QMDVFCGIFEQSKRNL  465



>emb|CAN83656.1| hypothetical protein VITISV_009941 [Vitis vinifera]
Length=456

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 116/196 (59%), Gaps = 5/196 (3%)
 Frame = -3

Query  835  QVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            Q+ +Q   S+F V CAY+W+C+++++   SG +  E++   +F   ADCR  LD P+P  
Sbjct  262  QIPKQSHVSAFTVICAYVWSCMIKARS-RSGEDVGENE-LEHFAFTADCRTLLDPPIPXA  319

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNCL+  +   K+ +L  E+G   AA++I EAIH ++  + GVL+G + W S   +++
Sbjct  320  YFGNCLMGGLATTKSTRLIQEDGFIVAAKSIREAIHERVRNKGGVLKGVQQWVSDLKSLN  379

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAK  302
              R+ +V GSPR   Y +DFG+G+PKK E  S D    +  GC     D E+G+  P AK
Sbjct  380  RMRMAAVVGSPRFQVYNVDFGFGRPKKYEVISRDRYFTL-DGCKDNEEDFEIGLCFPKAK  438

Query  301  MHLLKTLFEEGLQALS  254
            M     +F  GL+A S
Sbjct  439  MDAFAEIFTNGLEAYS  454



>pdb|2XR7|A Chain A, Crystal Structure Of Nicotiana Tabacum Malonyltransferase 
(Ntmat1) Complexed With Malonyl-Coa
Length=453

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+WTC+++S+   +G   DE+    +F CAADCRA+ + PLP +YFGN LV 
Sbjct  268  TSFTVTCAYVWTCIIKSEA-ATGEEIDENGXE-FFGCAADCRAQFNPPLPPSYFGNALVG  325

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             + R +   LA +EG   A E IGEAI ++ + EE +L G+  W   +  V  +R LSVA
Sbjct  326  YVARTRQVDLAGKEGFTIAVELIGEAIRKRXKDEEWILSGS--WFKEYDKVDAKRSLSVA  383

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL---DIEVGVSVPAAKMHLLK  287
            GSP+LD Y  DFGWG+P+K+E  SID    I    +K      D+E+G+S+   + +   
Sbjct  384  GSPKLDLYAADFGWGRPEKLEFVSIDNDDGISXSLSKSKDSDGDLEIGLSLSKTRXNAFA  443

Query  286  TLFEEGLQAL  257
              F  G+  L
Sbjct  444  AXFTHGISFL  453



>ref|XP_011090972.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=468

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 112/197 (57%), Gaps = 9/197 (5%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            +AR+P     SSF VT  Y+W CL++S    +G   D DD+  YF  A D R RL+ P+P
Sbjct  269  LAREPGLPHLSSFTVTTGYVWACLVKSAA-EAGEEVD-DDEPEYFGFAVDARHRLEPPVP  326

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
            A YFGNCL   +  +    L    G   A + IGE I +++  +E +LR A+DW   +G+
Sbjct  327  ATYFGNCLAFVVTESTHRLLRGSAGFVVAVKLIGELISQKVNNKEEILRDADDWIVKYGS  386

Query  487  VSF-ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSV  314
                +R L V GSP+ D Y  DFGWGKP K E+ S D  G++ V  ++E    +E+G+S+
Sbjct  387  PLLGKRTLGVVGSPKFDLYDADFGWGKPNKYESMSTDRYGSMSVCKSREFEGGLEIGLSL  446

Query  313  PAAKMHLLKTLFEEGLQ  263
            P  KM     +F +GL+
Sbjct  447  PRKKMDAFAAIFSDGLK  463



>gb|AAS77402.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Glandularia 
x hybrida]
Length=461

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 105/186 (56%), Gaps = 3/186 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VT +Y+W+CL ++    SG   DE +   YF  A D R R+D P PA YFGNCL  
Sbjct  277  SSFTVTTSYVWSCLAKASA-ESGEEVDETEPE-YFGFAVDARHRMDPPAPAAYFGNCLAF  334

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             +V    G L  E+G     E + E I +++  +  +LR A +W   +G +  +R++ VA
Sbjct  335  VVVETTHGVLKGEDGFFTGVELVSEIISKKVNNKNELLRDAHEWVVKYGPIVGKRLVGVA  394

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSP+ D Y  DFGWG P K E+ SID  G++ +  ++E    +E+G+S+P  KM      
Sbjct  395  GSPKFDLYDTDFGWGNPNKYESVSIDNDGSMSLCKSREFESGLEIGMSLPKKKMEAFVDA  454

Query  280  FEEGLQ  263
            F  GL+
Sbjct  455  FRHGLK  460



>ref|NP_001236819.1| malonyl-CoA:isoflavone 7-O-glucoside-6''-O-malonyltransferase 
[Glycine max]
 dbj|BAF73621.1| malonyl-CoA:isoflavone 7-O-glucoside-6''-O-malonyltransferase 
[Glycine max]
Length=463

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 114/190 (60%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+ +C ++++          + + V F+ + DCRARLD P+P  YFGN +V 
Sbjct  284  TSFTVTCAYLLSCAVKAE--------QPNCERVPFIFSVDCRARLDPPIPGTYFGNSVVS  335

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFER--ILS  464
             +V AK  +L  EE    +   I E ++R    E  VL GA+ W     +V  ER  + S
Sbjct  336  LLVIAKREELLGEEAFFKSVLGISEELNR---IEGDVLNGADRWMPKIQSVMSERPRLFS  392

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLK  287
            VAGSPR + Y +DFGWG+PKK++ TS+D +GA  +   ++ S  I++G+++  ++M    
Sbjct  393  VAGSPRFEVYDVDFGWGRPKKVDVTSVDKTGAFSLSETRDHSGGIQIGLALTKSQMEAFS  452

Query  286  TLFEEGLQAL  257
            T+F +GL++L
Sbjct  453  TVFAQGLESL  462



>ref|XP_004306152.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 108/187 (58%), Gaps = 12/187 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++F + CAYMW CL++++        + ++D    +  ADCR+RLD P+PA YFGNC+ P
Sbjct  285  TTFSLACAYMWVCLVKAE--------ETNEDETQLILVADCRSRLDPPIPATYFGNCITP  336

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+  A+   +   EGV  A  AI E ++R     +G L GAE+W S        R+L++A
Sbjct  337  CLAVAERKGMLGGEGVVVALTAITEGMNR---LGKGALNGAENWVSGMSRGRSGRVLTMA  393

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GSPR   Y+ DFG+G+P  ++  SID +GA+Y+  AK     ++V + +    M    +L
Sbjct  394  GSPRFGVYETDFGFGRPNNVDLVSIDRTGAVYISDAKIGGGGVDVALVLKKHCMDAFASL  453

Query  280  FEEGLQA  260
            F EGL+ 
Sbjct  454  FAEGLKG  460



>ref|XP_007217231.1| hypothetical protein PRUPE_ppa005502mg [Prunus persica]
 gb|EMJ18430.1| hypothetical protein PRUPE_ppa005502mg [Prunus persica]
Length=457

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 101/192 (53%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CL +++         + D  V    + DCR+R D PLPANYFGNC+  
Sbjct  276  STFSVTCAYTWVCLAKAE-------EKQSDKPVLMAFSLDCRSRFDPPLPANYFGNCIAG  328

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERIL  467
              +V  + G L  +    A  E             +G+L GAE W    +    S ER +
Sbjct  329  RAVVADRKGVLGEDGLTVAVNEISEAIKSAD---SDGILNGAETWVPKLYTAVSSEERFM  385

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  +++ +  D+EVG+ +    M  
Sbjct  386  GVAGSPRFGIYDTDFGWGRPSKVEVVSIEVTGAMSLAESRDGIAGDVEVGLVLEKHHMQA  445

Query  292  LKTLFEEGLQAL  257
              ++F +GLQ L
Sbjct  446  FASVFAKGLQDL  457



>ref|XP_008231014.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Prunus mume]
Length=467

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 113/194 (58%), Gaps = 13/194 (7%)
 Frame = -3

Query  832  VARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            V +  S+F +TCAY W CL++++    G          +     DCR+RLD P+ +NYFG
Sbjct  285  VQKYLSTFCITCAYTWVCLVKAEEIQGG--------KAFMGFTVDCRSRLDPPISSNYFG  336

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFE  476
            NCLV  +V A+   L  E+G+  A  AI EA+      ++GVL GAE+W    +     E
Sbjct  337  NCLVIRLVVAETKALLGEDGLTVAVNAICEAVK---SLDDGVLSGAENWIKPLYSVGGDE  393

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKM  299
            ++LSVAGSPR + Y+ DFGWG+P K+E  SI+ +GA+ +  +K+    ++VG+ +    M
Sbjct  394  KMLSVAGSPRFEVYETDFGWGRPNKVEIVSIEGTGAMSMSESKDGAGGVDVGLVLEKNSM  453

Query  298  HLLKTLFEEGLQAL  257
             +  TLF EGL  L
Sbjct  454  QVFATLFAEGLANL  467



>pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat Complexed 
With Malonyl-coa
 pdb|2E1T|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat Complexed 
With Malonyl-coa
 pdb|2E1U|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
 pdb|2E1U|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
 dbj|BAF50706.1| anthocyanin malonyltransferase homolog [Chrysanthemum x morifolium]
Length=454

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 115/191 (60%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W+C+ +S+          +D    F    D RAR+  P+P  YFGNC+  
Sbjct  274  SSFTVACAYIWSCIAKSR----------NDKLQLFGFPIDRRARMKPPIPTAYFGNCVGG  323

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFGTVSF---ERI  470
            C   AK   L  +EG   AA+ IGE +H+ L + ++GVL+  +D  SF   VS      +
Sbjct  324  CAAIAKTNLLIGKEGFITAAKLIGENLHKTLTDYKDGVLK--DDMESFNDLVSEGMPTTM  381

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKES-LDIEVGVSVPAAKMHL  293
              V+G+P+L +Y MDFGWGKPKK+ET SID++GAI +   KES  D+E+GV + A +M  
Sbjct  382  TWVSGTPKLRFYDMDFGWGKPKKLETVSIDHNGAISINSCKESNEDLEIGVCISATQMED  441

Query  292  LKTLFEEGLQA  260
               +F++GL+A
Sbjct  442  FVHIFDDGLKA  452



>gb|EYU36651.1| hypothetical protein MIMGU_mgv1a006328mg [Erythranthe guttata]
Length=448

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F   CA +W C  +S       +   DD+  YF   ADCR RL  P+P NYFGNC+VP
Sbjct  263  STFTAACAVVWVCSAKSAG-----DDVADDEPEYFGFVADCRGRLKPPVPGNYFGNCVVP  317

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                 K GQ     G   AA+AIG+AI   +  E G+L GAE W   +  +  +R   VA
Sbjct  318  VRAELKHGQAKGPNGFVMAAKAIGDAIVENVYNENGILFGAEKWPEKYNELIGKRQYGVA  377

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSPR D+Y +D+GWG PKK E   +D +G+I +  A++    +E+G+S P  +M    T+
Sbjct  378  GSPRFDFYAVDYGWGNPKKFEALFVDGNGSISLNKARDCEGGLEIGLSKPKLQMDAFSTV  437

Query  280  FEEGLQ  263
            F + L 
Sbjct  438  FSQVLH  443



>gb|EYU24862.1| hypothetical protein MIMGU_mgv1a006330mg [Erythranthe guttata]
Length=448

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 112/188 (60%), Gaps = 6/188 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++F +TCA +W CL++++     +  DE +   YF  AADCR RL+ PLPA YFGNCL  
Sbjct  266  TAFTMTCALVWVCLVKAET--GAVAPDEPE---YFGFAADCRGRLNPPLPATYFGNCLAF  320

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
               ++  G L   EG   AAE++G AI + +  E+G+L GAE+W   F  +  +R+  VA
Sbjct  321  VKAQSTHGLLKGREGFLIAAESLGLAIQKSVYSEKGILDGAENWPVDFRKMLGKRLFGVA  380

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GSPR D Y  D+GWG+P+K E+ SID   ++ +  +++  D +E  +S P  K+     +
Sbjct  381  GSPRFDLYDADYGWGRPRKFESASIDRDTSMSLCKSRDYEDGLEFALSRPKKKLDAFAAV  440

Query  280  FEEGLQAL  257
            F + L+ L
Sbjct  441  FTQTLRNL  448



>gb|KEH25060.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=455

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 109/190 (57%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+  C ++              + V F+ + DCR RLD P+ ANYFGNC+V 
Sbjct  277  STFSVTCAYLLACTIKVD--------QPKSNKVPFIFSVDCRPRLDPPINANYFGNCVVS  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE--RILS  464
             +V  +  +   ++G  +A E I + +      E GVL+G E+W S   +   E  R+ S
Sbjct  329  KLVLGETEEFLKDDGFISALEGISDVLKG---LENGVLKGLENWMSIMQSTMSETDRMFS  385

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            +AGSPR D Y  DFGWGKPKK++ TSID +GA  +   + +   IE+G+++   +M +  
Sbjct  386  IAGSPRFDVYSFDFGWGKPKKVDVTSIDKTGAFSLSENRNNDGGIEIGLALNKQQMEVFA  445

Query  286  TLFEEGLQAL  257
             LF +GL++L
Sbjct  446  QLFVQGLESL  455



>gb|EYU17682.1| hypothetical protein MIMGU_mgv1a023077mg [Erythranthe guttata]
Length=448

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 104/186 (56%), Gaps = 6/186 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+WTCL +S      ++   DD   YF C ADCR RL+ PLP NYFGNCL  
Sbjct  265  SSFAVICAYVWTCLAQST-----VDDVADDTPEYFTCTADCRRRLNPPLPDNYFGNCLGL  319

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                +  G+L  +EG+   AE I EAI + +  E  +L G+         +S +R+  V 
Sbjct  320  VQAESTHGRLKGKEGIVFGAEVINEAIQKTVNNERAILEGSIVGFLERRKLSGKRVFGVT  379

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSPR D Y  DFGWGKPKK E   ID  G++ +  ++E    +E+G+S+   +M   + +
Sbjct  380  GSPRFDLYGADFGWGKPKKFEAVHIDCGGSVSLCKSREFKGGVEIGLSMKKVEMDAFEAI  439

Query  280  FEEGLQ  263
            F  G +
Sbjct  440  FNHGFK  445



>ref|XP_010657397.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Vitis vinifera]
Length=376

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 109/186 (59%), Gaps = 3/186 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W C+ +++   SG +  E++   +      CRA  D P+PANYFGNCL P
Sbjct  190  SSFTVACAYVWDCMGKARA-KSGEDVGENEPE-HLAFVGGCRAYFDPPIPANYFGNCLAP  247

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C    K+ +L  E+G   A   IG+AI  +L  +EG+L+G E W S + +++ +RI  VA
Sbjct  248  CSATVKSLELITEDGFIVATNTIGKAIQERLRNKEGILKGLEKWMSNYKSLNPKRIFGVA  307

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            G P+   Y +DFG G+P K E   ID + +I +   K +  D+E+ +S P  KM +  ++
Sbjct  308  GLPKFSCYDIDFGLGRPCKGEIILIDVTKSISLNEGKNNKEDVEIDLSFPKIKMDVFTSI  367

Query  280  FEEGLQ  263
            F  GL+
Sbjct  368  FVNGLK  373



>ref|XP_006475382.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Citrus 
sinensis]
Length=467

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 18/202 (9%)
 Frame = -3

Query  841  AGQVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            AG+ A Q   S+ V+ CA+ + CL+++         +E D  V F  AADCR+RLD PLP
Sbjct  276  AGKSAEQLHLSTHVLACAHSFVCLVKAYG-------EETDTNVMFGVAADCRSRLDPPLP  328

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAED-WNSFFG  491
             NYFGNC+       KA  L  E GVA  AE + + I    E +  V+ G+ED + +F G
Sbjct  329  VNYFGNCVGGQGTVQKASYLMGENGVAFVAEKLSDCIK---ELKGDVIEGSEDKFVNFLG  385

Query  490  TVSFE----RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEV  326
             +  E    RILSVAGS R D Y  DFGWGKPKK+E  SID +GAI +  + + S  IEV
Sbjct  386  MMKGEGLQQRILSVAGSNRFDVYGSDFGWGKPKKVEIVSIDKTGAISLAESGDGSGGIEV  445

Query  325  GVSVPAAKMHLLKTLFEEGLQA  260
            GV +   +M +  +LF +GLQ+
Sbjct  446  GVVLEKHQMEVFASLFTDGLQS  467



>ref|XP_008361942.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=460

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 108/191 (57%), Gaps = 14/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL++++        +     V      DCR+RLD PLPA YFGNC+ P
Sbjct  280  STFSLTCAYTWVCLVKAE--------EIKTKKVLLXFNVDCRSRLDPPLPATYFGNCITP  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERILS  464
              V A+   L  E+G+  A  A+  AI R L+  +GVL G E W    F    S +RI S
Sbjct  332  HGVIAQTDDLMGEDGLFVALTAVSAAIKR-LDT-DGVLNGMETWIPTMFDAQTSTDRIFS  389

Query  463  VAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            VAGSPR + Y   DFGWG+P+ IE  SID +GAI +  +K     +E+G+++    M   
Sbjct  390  VAGSPRFELYDAADFGWGRPRTIEFVSIDRTGAISLSDSKNGGGGVEIGLALKKLSMEAF  449

Query  289  KTLFEEGLQAL  257
             +LF EGL+ L
Sbjct  450  ASLFAEGLEQL  460



>emb|CAN83833.1| hypothetical protein VITISV_039456 [Vitis vinifera]
Length=457

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 114/196 (58%), Gaps = 5/196 (3%)
 Frame = -3

Query  835  QVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            Q+ +Q   S+F V CAY+W+C+++++   SG +  E++   +F   ADCR  LD P+PA 
Sbjct  263  QIPKQSHVSAFTVICAYVWSCMIKARS-RSGEDVGENE-LEHFAFTADCRTLLDPPIPAA  320

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNCL+  +   K+ +L  E+G   AA +I EAI  ++  +  VL+G + W S   +++
Sbjct  321  YFGNCLMGGLATTKSTRLIQEDGFIVAANSIREAIQERVRNKGEVLKGVQKWVSDLKSLN  380

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAK  302
              R+ +V GSPR + Y MDFG G+PKK E  S D    +  GC     D EVG+  P AK
Sbjct  381  RMRMAAVVGSPRFEVYNMDFGLGRPKKYEVISRDRYFTL-DGCKDNEEDFEVGLCFPKAK  439

Query  301  MHLLKTLFEEGLQALS  254
            M     +F  GL+A S
Sbjct  440  MDAFAEIFTNGLEAYS  455



>ref|XP_008779426.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Phoenix dactylifera]
Length=464

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 111/190 (58%), Gaps = 11/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVV CA+ W CL+++Q    G        T + L + +CR+RL  P+PA YFGNCL P
Sbjct  283  SAFVVACAFAWKCLVKAQ----GGYASASKKTAHLLFSVECRSRLKPPVPAEYFGNCLRP  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLEC-EEGVLRGAEDWNSFFGTVSFERILSV  461
            C V      L  ++GV  AAEAIG    R ++  E+GVL+GAE W     ++  E+ +SV
Sbjct  339  CFVELPMCDLVKDDGVLFAAEAIG----RAIKLLEDGVLKGAEGWFQKIVSLMPEQPMSV  394

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            AGSP+   Y  DFGWG+PKK+E  SI+ + G I +   +E    IE+GV +P  +M    
Sbjct  395  AGSPKYRVYDADFGWGRPKKVEVASIEKTPGTISLAEGREEQGGIEIGVVLPKDEMDEFS  454

Query  286  TLFEEGLQAL  257
            + F  GL+ L
Sbjct  455  SCFSSGLKLL  464



>gb|AAL50565.1|AF405204_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Perilla frutescens]
Length=447

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 107/189 (57%), Gaps = 7/189 (4%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            QPSSFVV  AY+W+C+++S       +  E +    F+  AD R R + P+PANYFGNC+
Sbjct  263  QPSSFVVAAAYIWSCMVKSG------DGGEANAPELFVIPADARGRTNPPVPANYFGNCI  316

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
            V  +V+ +  ++A  EG   AAEAI   I  ++  +E +L+GAE+W S         +L 
Sbjct  317  VGGVVKVEHEKMAGNEGFVIAAEAIAGEIKNKMNDKEEILKGAENWLSEIWKCMGMSVLG  376

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLKT  284
            ++GSP+ D    DFGWGK +K+E  SID        C  +   +EVG+S+P  +M     
Sbjct  377  ISGSPKFDLSNADFGWGKARKLEVVSIDGEKYTMSLCNSDC-GLEVGLSLPGERMEAFAA  435

Query  283  LFEEGLQAL  257
            +F +GL  L
Sbjct  436  IFADGLAKL  444



>gb|AAO12207.1| putative malonyl CoA:anthocyanidin 3-O-glucoside-6''-O-malonyltransferase 
[Dahlia pinnata]
Length=467

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 108/194 (56%), Gaps = 17/194 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFVV C Y+W+CL +S+    G   + + D   F C AD R RL+ P+P  YFGNC   
Sbjct  279  SSFVVACGYVWSCLAKSRVQVEGAKGEYEVDR--FSCVADWRTRLNPPVPQTYFGNCTGL  336

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERIL---  467
            C+   K   +   +G   A E +G  I   +  ++G+   A+ W         E+IL   
Sbjct  337  CMATTKTTLITGSKGFQTAVELVGTGIREGVNSKQGLAEDAKSW--------LEKILIQA  388

Query  466  ---SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKM  299
                VAG+P+L+ Y +DFGWGKP+K ET S+DY+ AI V  +KES  D+E+G+ +PA +M
Sbjct  389  PTIGVAGTPKLNVYDIDFGWGKPEKYETISLDYADAISVNASKESSDDLEIGLCLPAEQM  448

Query  298  HLLKTLFEEGLQAL  257
                T+    L+++
Sbjct  449  DAFITISTNELESI  462



>ref|XP_006362146.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=451

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 118/202 (58%), Gaps = 16/202 (8%)
 Frame = -3

Query  829  ARQPS-----SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPA  665
            +R+PS     S+ VTC Y+W CL++S+   +     +D+   YF C  D RAR D PLP+
Sbjct  257  SRRPSLTHVTSYTVTCGYVWACLIKSEDTDTDHIIIDDNVMEYFSCTVDYRARFDPPLPS  316

Query  664  NYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGA---EDWNSFF  494
            +YFGNC+V  IV+ +   L   EG   AAE+IGE IH++ + +E VL G    ED + F 
Sbjct  317  SYFGNCVVWYIVKTRHVDLVGNEGFIIAAESIGETIHKRNKDKEYVLSGEWLNEDDHRF-  375

Query  493  GTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVS  317
                  + LSVAGSP+ D Y  DFGWG+P+K E  S+     + +  +K+S  D+E+G+S
Sbjct  376  ------KSLSVAGSPKFDLYATDFGWGRPEKWEFVSLQTGILMSLIKSKDSNGDLEIGLS  429

Query  316  VPAAKMHLLKTLFEEGLQALSL  251
            +P  +M+    +F  GL+   +
Sbjct  430  LPKTRMNAFAAIFTHGLEEFKI  451



>ref|XP_010918788.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Elaeis 
guineensis]
Length=447

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 112/198 (57%), Gaps = 11/198 (6%)
 Frame = -3

Query  841  AGQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            A + + Q S + V C ++W  L+ ++        D      +F     CRARLD P+P+N
Sbjct  258  ASRTSAQCSPYAVACGFVWAGLVHARG-------DTSKKKEHFGFVTGCRARLDPPIPSN  310

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNCL  C V AK  +L   +G   AA+AI + I      EEG  + AE+W       +
Sbjct  311  YFGNCLGICCVEAKRSELTGRDGPLIAADAIWKVIK---SLEEGAFKDAENWIRNVYNYA  367

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAA  305
              R L+VAGSP+L  Y++DFGWG+P+K+E  SI+ +GA+ +  ++E    IEVG+++P+ 
Sbjct  368  SARALTVAGSPKLGMYEVDFGWGRPRKVEVISIERTGALSLAESREEKGGIEVGLALPSH  427

Query  304  KMHLLKTLFEEGLQALSL  251
            +M    + F + L  LSL
Sbjct  428  EMEEFVSFFVDKLSELSL  445



>ref|XP_009365920.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Pyrus 
x bretschneideri]
Length=463

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 107/188 (57%), Gaps = 12/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++        +   +T   +  ADCR RLD PLP NYFGNC   
Sbjct  287  STFTLACAYTWVCIVKAE--------EIKGETTRMVFMADCRPRLDPPLPTNYFGNCTAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   +   L  E+G+  A  AI EAI +    E+GVL GAE+W S   TV+  R+LSVA
Sbjct  339  CVPVVETKGLFGEDGLVVAVYAIREAIRK---LEKGVLDGAENWVSRVVTVTSGRMLSVA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GS R   Y  DFGWG+PKK++  SID + AI     K E+  ++ G+ +    M    +L
Sbjct  396  GSHRFRVYDTDFGWGRPKKVDIVSIDRNKAISFSDPKSEAGVVDAGLVLEKHHMEAFASL  455

Query  280  FEEGLQAL  257
            F +GL+ L
Sbjct  456  FAKGLETL  463



>ref|XP_008357919.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Malus 
domestica]
Length=194

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 105/186 (56%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++        +   +T   +  ADCR RLD PLP NYFGNC   
Sbjct  16   STFTLACAYXWVCIVKAE--------EIKGETTRMVFMADCRPRLDPPLPTNYFGNCTAG  67

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   +   L  E+G+  A  AI EAI +    E+GVL GAE+W S   TV+  R++S+A
Sbjct  68   CVPVVETKGLFGEDGLVVAVYAIREAIRK---LEKGVLDGAENWVSRVVTVTSGRMISIA  124

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y  DFGWG+PKK+E  SID + AI     K     ++VG+ +    M +  +L
Sbjct  125  GSHRFRVYDTDFGWGRPKKVEIVSIDRNRAISFSDPKSDAGVVDVGLVLEKHHMEVFASL  184

Query  280  FEEGLQ  263
            F + L+
Sbjct  185  FYKDLK  190



>ref|XP_008231009.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Prunus 
mume]
Length=304

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (53%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CLL+++         + D  V    + DCR R D P+PANYFGNC+  
Sbjct  123  STFSVTCAYTWVCLLKAE-------EKQTDKPVRMAFSLDCRPRFDPPIPANYFGNCIAG  175

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERIL  467
              +V  + G L  +    A  +        +    +G+L GAE W    +    S ER +
Sbjct  176  RAVVADRKGLLGEDGLTMAVNKISEAI---KSVGSDGILNGAETWVPKLYTAVRSEERFM  232

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR      DFGWG+P K+E  SI+ +GA+ +  +++ +  D+EVG+ +    M  
Sbjct  233  GVAGSPRFGICDTDFGWGRPSKVEVVSIEETGAMSLAESRDGIAGDVEVGLVLEKHHMQA  292

Query  292  LKTLFEEGLQAL  257
              ++F +GLQ L
Sbjct  293  FASVFAKGLQDL  304



>ref|XP_008231008.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Prunus 
mume]
Length=462

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 107/186 (58%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++     IN D+           DCR+RLD P+  NYFGNC+  
Sbjct  286  STFTLACAYTWVCIVKAE----EINSDQ----TRLAFNVDCRSRLDPPISPNYFGNCIAG  337

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             I  A+   L  E+G+  A  AI EAI      E+GVL GAE+W S    V+ ER+L++A
Sbjct  338  RIAVAETKALFGEDGLVVAVNAISEAIK---SLEKGVLDGAENWVSRLFAVTSERMLTLA  394

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y+ DFGWG+PKK+E  SID + AI    AK     ++VG+ +    M +  +L
Sbjct  395  GSHRFGVYETDFGWGRPKKVEIVSIDRTRAISFSDAKTDAGVVDVGLVLDKHSMQVFASL  454

Query  280  FEEGLQ  263
            F +GLQ
Sbjct  455  FAKGLQ  460



>ref|XP_012084834.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Jatropha 
curcas]
 gb|KDP27255.1| hypothetical protein JCGZ_19954 [Jatropha curcas]
Length=464

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 115/189 (61%), Gaps = 10/189 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S FV+TCAY+  C+++++         +++ TV+FL + DCR RL+ PLP NYFGNC+  
Sbjct  279  SDFVITCAYVIVCMVKARG-------GDENRTVWFLYSVDCRKRLNPPLPRNYFGNCIAV  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS-FERILSV  461
              V A A     E G+   A+ I E+I + +E   GVL GAE+  S F +++   +++SV
Sbjct  332  HEVIAVARDFMEENGLWITAKRISESI-KAIETN-GVLEGAEEKLSVFKSMNDGVQMISV  389

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLKTL  281
            AGS R   Y  DFGWGKPKK+E  SID +GAI    +K+   +E+G+++   +M +   L
Sbjct  390  AGSTRFGVYGCDFGWGKPKKVEIISIDRTGAISFKESKDGNGVEIGLALNRNEMEIFAPL  449

Query  280  FEEGLQALS  254
            F  GL+ LS
Sbjct  450  FVNGLKDLS  458



>gb|KDO39555.1| hypothetical protein CISIN_1g012242mg [Citrus sinensis]
Length=467

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 116/202 (57%), Gaps = 18/202 (9%)
 Frame = -3

Query  841  AGQVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            AG+ A Q   S+ V+ CA+ + CL+++         +E D  V F  AADCR+RLD PLP
Sbjct  276  AGKSAEQLHLSTHVLACAHSFVCLVKAYG-------EETDTNVMFGVAADCRSRLDPPLP  328

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAED-WNSFFG  491
             NYFGNC+       KA  L  E G A  AE + + I    E +  V+ G+ED + +  G
Sbjct  329  VNYFGNCVGGQGTVQKASYLMGENGEAFVAEKLSDCIK---ELKGDVIEGSEDKFVNVLG  385

Query  490  TVSFE----RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEV  326
             +  E    RILSVAGS R D Y  DFGWGKPKK+E  SID +GAI +  + + S  IEV
Sbjct  386  MMKGEGLQQRILSVAGSNRFDVYGSDFGWGKPKKVEIVSIDKTGAISLAESGDGSGGIEV  445

Query  325  GVSVPAAKMHLLKTLFEEGLQA  260
            GV +   +M +  +LF +GLQ+
Sbjct  446  GVVLEKHQMEVFASLFTDGLQS  467



>ref|XP_011069511.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase, 
partial [Sesamum indicum]
Length=162

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = -3

Query  823  QPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCL  644
            Q SSFVVT +Y+WTC ++S+        D+DD    F+ AAD RAR+D P+PA+YFGNCL
Sbjct  1    QVSSFVVTASYVWTCFVKSEE-----QVDDDDVLQVFIFAADIRARIDPPVPASYFGNCL  55

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILS  464
               + + +  QL   EG   AAEAI + I  +L  ++ VL+GAE+W S    ++  R   
Sbjct  56   AYGLAKIEHKQLVGGEGFVIAAEAIADQIKNRLNNKDQVLKGAENWLSETKEMTAIRAFG  115

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSID  380
            V+GSP+ D    DFGWG+ +K+ET SID
Sbjct  116  VSGSPKFDLCSADFGWGRARKLETVSID  143



>gb|KDO39556.1| hypothetical protein CISIN_1g012242mg [Citrus sinensis]
Length=451

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 116/202 (57%), Gaps = 18/202 (9%)
 Frame = -3

Query  841  AGQVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            AG+ A Q   S+ V+ CA+ + CL+++         +E D  V F  AADCR+RLD PLP
Sbjct  260  AGKSAEQLHLSTHVLACAHSFVCLVKAYG-------EETDTNVMFGVAADCRSRLDPPLP  312

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAED-WNSFFG  491
             NYFGNC+       KA  L  E G A  AE + + I    E +  V+ G+ED + +  G
Sbjct  313  VNYFGNCVGGQGTVQKASYLMGENGEAFVAEKLSDCIK---ELKGDVIEGSEDKFVNVLG  369

Query  490  TVSFE----RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEV  326
             +  E    RILSVAGS R D Y  DFGWGKPKK+E  SID +GAI +  + + S  IEV
Sbjct  370  MMKGEGLQQRILSVAGSNRFDVYGSDFGWGKPKKVEIVSIDKTGAISLAESGDGSGGIEV  429

Query  325  GVSVPAAKMHLLKTLFEEGLQA  260
            GV +   +M +  +LF +GLQ+
Sbjct  430  GVVLEKHQMEVFASLFTDGLQS  451



>ref|XP_007032769.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY03695.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=395

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 115/191 (60%), Gaps = 13/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+T AY+ TCL++++         E D TV F  AAD R+RL+ P+P NYFGNC++ 
Sbjct  214  SSFVLTFAYVSTCLIKARG-------GESDRTVNFGFAADARSRLNPPIPENYFGNCVLG  266

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE---RIL  467
             +  AKAG    E G A AAE   + + ++LE   G+L  AE   + F  V  E   +++
Sbjct  267  PLASAKAGNFMDENGFATAAELASDMV-KELEMN-GILEQAEKKLTQFFDVIMETGKQVI  324

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            SV+GSPR   Y  DFGWGKP+K+   SID  GAI +  +++ S  IE+G+++   +M   
Sbjct  325  SVSGSPRFGVYGADFGWGKPRKVVIVSIDRGGAISLAESRDGSALIEIGLALNKHEMKTF  384

Query  289  KTLFEEGLQAL  257
             +LF +GL+ L
Sbjct  385  ASLFLDGLRDL  395



>ref|XP_008230917.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Prunus 
mume]
Length=414

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTC+Y W CL +++         + D       + DCR+R D PLPANYFGNC+  
Sbjct  233  STFSVTCSYTWVCLAKAE-------EKQSDKPDLMAFSLDCRSRFDPPLPANYFGNCIAG  285

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERIL  467
              +V  + G L  +    A  E             +G+L GAE W    +    S ER +
Sbjct  286  RAVVADRKGLLGEDGLTVAVNEISEAIKSAD---SDGILNGAETWVPKLYTAVGSEERFM  342

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  +++ +  D+EVG+ +    M  
Sbjct  343  GVAGSPRFGIYDTDFGWGRPSKVEVVSIEETGAMSLAESRDGIAGDVEVGLVLEKHHMQA  402

Query  292  LKTLFEEGLQAL  257
              ++F +GLQ L
Sbjct  403  FASVFAKGLQDL  414



>gb|KHN07133.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=290

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 111/191 (58%), Gaps = 16/191 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+ +C ++++          + + V F+   DCRARLD P+P  YFGNC+V 
Sbjct  110  TSFTVTCAYLLSCAVKAE--------QPNCERVPFVFNVDCRARLDPPIPETYFGNCVVA  161

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE--RIL  467
             +  AK  +L  EE    +   I      +L   EG VL GA+ W     +V  E  R+ 
Sbjct  162  LLASAKREELLGEEAFFKSVIGI----SEELNGLEGDVLNGADKWIPKIQSVVSETPRLF  217

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            SVAGSPR + Y +DFGWG+P+K++ TS+D +GA  +  +++ S  I++G+++   +M   
Sbjct  218  SVAGSPRFEVYGIDFGWGRPEKVDVTSVDKTGAFSLSESRDHSGGIQIGLALTKNQMEAF  277

Query  289  KTLFEEGLQAL  257
              +F +GL++L
Sbjct  278  SRVFAQGLESL  288



>ref|XP_006451382.1| hypothetical protein CICLE_v10007994mg [Citrus clementina]
 gb|ESR64622.1| hypothetical protein CICLE_v10007994mg [Citrus clementina]
Length=525

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 116/202 (57%), Gaps = 18/202 (9%)
 Frame = -3

Query  841  AGQVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            AG+ A Q   S+ V+ CA+ + CL+++         +E D  V F  AADCR+RLD PLP
Sbjct  334  AGKSAEQLHLSTHVLACAHSFVCLVKAYG-------EETDTNVMFGVAADCRSRLDPPLP  386

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAED-WNSFFG  491
             NYFGNC+       KA  L  E G A  AE + + I    E +  V+ G+ED + +  G
Sbjct  387  VNYFGNCVGGQGTVQKASYLMGENGEAFVAEKLSDCIK---ELKGDVIEGSEDKFVNVLG  443

Query  490  TVSFE----RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEV  326
             +  E    RILSVAGS R D Y  DFGWGKPKK+E  SID +GAI +  + + S  IEV
Sbjct  444  MMKGEGLQQRILSVAGSNRFDVYGSDFGWGKPKKVEIVSIDKTGAISLAESGDGSGGIEV  503

Query  325  GVSVPAAKMHLLKTLFEEGLQA  260
            GV +   +M +  +LF +GLQ+
Sbjct  504  GVVLEKHQMEVFASLFTDGLQS  525



>ref|XP_007216387.1| hypothetical protein PRUPE_ppa021452mg [Prunus persica]
 gb|EMJ17586.1| hypothetical protein PRUPE_ppa021452mg [Prunus persica]
Length=471

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 106/191 (55%), Gaps = 13/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CLL+++         + D  V      DCR R D P+P NYFGNC+  
Sbjct  290  STFSVTCAYTWVCLLKAE-------EKKTDKPVMMGFTLDCRPRFDPPIPVNYFGNCIAG  342

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV--SFERILS  464
             ++ A+   L  E+G+  A   I EAI R     +G+L+GAE       +   S +R + 
Sbjct  343  RVIVAERKGLLGEDGLTVAVNEISEAIKRA--ESDGILKGAETLVPIVYSAERSEKRFMG  400

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHLL  290
            VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  +++ +  D+EVG+ +    M   
Sbjct  401  VAGSPRFGIYDTDFGWGRPSKVEVVSIEVTGAMSLAESRDGIAGDVEVGLVLEKHHMQAF  460

Query  289  KTLFEEGLQAL  257
             +LF +GLQ L
Sbjct  461  ASLFAKGLQDL  471



>ref|XP_012076156.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Jatropha 
curcas]
 gb|KDP34386.1| hypothetical protein JCGZ_12780 [Jatropha curcas]
Length=459

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 110/192 (57%), Gaps = 17/192 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S FV+TCAY+  C+++++         +++ TV+FL A DCR RL+ PLP NYFGNC+  
Sbjct  279  SDFVITCAYVLVCMVKARG-------GDENRTVWFLYAVDCRTRLNPPLPKNYFGNCIAA  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV-SFERILSV  461
              V A A       G+   A+ I E+I R      GVL GAE+  S   ++ S  + + V
Sbjct  332  HDVIAVARDFMEVNGLPIIAKRISESIKRI--KTNGVLEGAEEKLSSLKSIKSGVQAIGV  389

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPAAKMHL  293
            AGS R   Y  DFGWGKPKK+E TSID +GAI     KES D    +E+G+++   +M  
Sbjct  390  AGSTRFGVYGYDFGWGKPKKVEITSIDRTGAI---SFKESKDGNGGVEIGLALTRNEMEA  446

Query  292  LKTLFEEGLQAL  257
              TLF  GL+ L
Sbjct  447  FATLFGNGLKDL  458



>ref|XP_011079059.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=459

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 106/195 (54%), Gaps = 9/195 (5%)
 Frame = -3

Query  826  RQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNC  647
            R  SSF V CAY+WTC  +     +G     DD+ VY   AADCR RL   LP+ YFGNC
Sbjct  266  RHISSFSVICAYVWTCSEKCLAATAGQQETNDDEPVYLPFAADCRKRLSPHLPSTYFGNC  325

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGA---EDWNSFFGTVSFE  476
            +V  I +++ G L  +EG   AAE+IGEAI   L  E  +L  A    D++ +FG     
Sbjct  326  VVYVITQSRHGLLKGDEGFLIAAESIGEAITETLYNEREILDSAGWPMDFSEYFG----R  381

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAK  302
            R + VAGSP+ D Y+ DFGWG+PKK E   +D        C     +   E+GVS     
Sbjct  382  RYIGVAGSPKFDVYEADFGWGRPKKYEFAHVDGERYSISLCKSREFEGGFEIGVSRMKTD  441

Query  301  MHLLKTLFEEGLQAL  257
            M + + +F +GLQ +
Sbjct  442  MDVFEDIFNQGLQMI  456



>ref|XP_004489466.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cicer 
arietinum]
Length=455

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 109/191 (57%), Gaps = 15/191 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTCAY+ +C ++ +          + + V F+ + DCR RLD P+  NYFGNC+V 
Sbjct  276  SSFSVTCAYLLSCAVKVE--------KPNTNKVGFVFSVDCRTRLDPPINTNYFGNCIVS  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE---RIL  467
             +V +K   L  ++G  +A E I + +      E GVL G E W S   ++  E   ++ 
Sbjct  328  KLVVSKTETLLNDDGFISALEGIIDVLKG---LESGVLNGVESWMSNIQSILSETNGKLF  384

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLL  290
            S+AGSPR + Y  DFGWG+PK ++ TSID +GA  +   K +   IE+G+++   +M   
Sbjct  385  SIAGSPRFEVYAFDFGWGRPKIVDVTSIDKTGAFSLSEHKNNDGGIEIGLALNKEQMKNF  444

Query  289  KTLFEEGLQAL  257
              LF EGL++L
Sbjct  445  TQLFVEGLESL  455



>ref|XP_007217389.1| hypothetical protein PRUPE_ppa026050mg [Prunus persica]
 gb|EMJ18588.1| hypothetical protein PRUPE_ppa026050mg [Prunus persica]
Length=747

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 97/192 (51%), Gaps = 34/192 (18%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CLL+++         + D  V      DCR R D P+PANYFGNC+  
Sbjct  585  STFSVTCAYTWVCLLKAE-------EKQTDKPVMMGFTLDCRPRFDPPIPANYFGNCIAG  637

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFERIL  467
              IV  + G L                       E+G+L+GAE           S ER++
Sbjct  638  RAIVAERKGLLG----------------------EDGILKGAETLVPVLYPAMRSEERVM  675

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  +++ +  D EVG+ +    M  
Sbjct  676  GVAGSPRFGIYDTDFGWGRPSKVEVVSIEETGAMSLAESRDGIAGDFEVGLVLEKHHMQA  735

Query  292  LKTLFEEGLQAL  257
              +LF +GLQ L
Sbjct  736  FASLFAKGLQDL  747



>ref|XP_007043460.1| HXXXD-type acyl-transferase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX99291.1| HXXXD-type acyl-transferase family protein, putative isoform 
2 [Theobroma cacao]
Length=447

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 100/167 (60%), Gaps = 6/167 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQ-CFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLV  641
            S+FVVT A++W CL++S+    + ++RD+DD   + L   DCR RL+ P+P  YFGNCL 
Sbjct  279  STFVVTSAFVWVCLIKSKDSATNNLSRDDDDKFYFLLFPFDCRNRLEFPVPPTYFGNCLR  338

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERILS  464
            P +V     +L  E G+  A++ IG   ++  E E   LRGAE W ++    +   R+ +
Sbjct  339  PGVVDVTKSELIGENGILLASKVIG---NKIKEMERSGLRGAEHWISTLVERMKSRRLTA  395

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEV  326
            VAGSP+   Y  DFGWG+P K+E T IDY GAI +  C  E   IE+
Sbjct  396  VAGSPKFHVYDTDFGWGRPCKVELTHIDYDGAISLAECKDEPGGIEL  442



>ref|XP_010940606.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Elaeis guineensis]
Length=463

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 111/190 (58%), Gaps = 11/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVV CA+ W CL+++Q    G        T + L + +CR+RL   +PA YFGNCL P
Sbjct  282  SAFVVACAFAWKCLVKAQ----GGYASAGKKTAHLLFSVECRSRLRPAVPAEYFGNCLRP  337

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLE-CEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V    G L  ++GV  AAEAIG    R ++  E+GVL+GAE W     ++  E+ +SV
Sbjct  338  CFVELPMGDLVKDDGVLFAAEAIG----RAIKGLEDGVLKGAEGWFQKIVSLIPEQPMSV  393

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            AGSP+   Y  DFGWG+PKK+E  SI+ + G I +  ++E    IE+G+ +P  +M    
Sbjct  394  AGSPKYGVYDTDFGWGRPKKVEVASIEKTPGTISLAESREEQGGIEIGLVLPKHEMDEFS  453

Query  286  TLFEEGLQAL  257
            + F  G + L
Sbjct  454  SCFSSGSKLL  463



>ref|NP_001237760.1| malonyl-CoA:isoflavone 7-O-glucoside-6''-O-malonyltransferase 
[Glycine max]
 dbj|BAF73620.1| malonyl-CoA:isoflavone 7-O-glucoside-6''-O-malonyltransferase 
[Glycine max]
 gb|ABY59019.1| malonyltransferase MT7 [Glycine max]
Length=467

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 111/191 (58%), Gaps = 16/191 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SF VTCAY+ +C ++++          + + V F+   DCRARLD P+P  YFGNC+V 
Sbjct  287  TSFTVTCAYLLSCAVKAE--------QPNCERVPFVFNVDCRARLDPPIPETYFGNCVVA  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE--RIL  467
             +  AK  +L  EE    +   I      +L   EG VL GA+ W     +V  E  R+ 
Sbjct  339  LLASAKREELLGEEAFFKSVIGIS----EELNGLEGDVLNGADKWIPKIQSVVSETPRLF  394

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            SVAGSPR + Y +DFGWG+P+K++ TS+D +GA  +  +++ S  I++G+++   +M   
Sbjct  395  SVAGSPRFEVYGIDFGWGRPEKVDVTSVDKTGAFSLSESRDHSGGIQIGLALTKNQMEAF  454

Query  289  KTLFEEGLQAL  257
              +F +GL++L
Sbjct  455  SRVFAQGLESL  465



>ref|XP_007217573.1| hypothetical protein PRUPE_ppa020665mg [Prunus persica]
 gb|EMJ18772.1| hypothetical protein PRUPE_ppa020665mg [Prunus persica]
Length=463

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++     IN D+           DCR+RLD P+  NYFGNC+  
Sbjct  287  STFTLACAYTWVCIVKAE----EINSDQ----TRLAFNVDCRSRLDPPISPNYFGNCIAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                A+   L  E+G+  A  AI EAI      E+GVL GAE+W S    V+ ER+L++A
Sbjct  339  RTAVAETKALFGEDGLVVAVNAISEAIK---SLEKGVLDGAENWVSRLFAVTSERMLTLA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y+ DFGWG+PKK+E  SID + AI    AK     ++VG+ +    M +  +L
Sbjct  396  GSHRFGVYETDFGWGRPKKVEIVSIDRTRAISFSDAKTDAGVVDVGLVLDKHSMQVFASL  455

Query  280  FEEGLQ  263
            F +GLQ
Sbjct  456  FAKGLQ  461



>ref|XP_002518001.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF44519.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=459

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 105/189 (56%), Gaps = 7/189 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVV CA  W  L++SQ   + +  D +D T Y    AD R RL+  LP  YFGNCL  
Sbjct  276  STFVVICAITWVNLIKSQEDEASL--DSNDKTCYLGFVADGRQRLEVELPVTYFGNCLAI  333

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-RILSV  461
            C   AK  +L  E GV  AA+AI    ++  E E G L+  E W S +  +S E R++++
Sbjct  334  CYASAKRSELVGENGVTVAAKAIA---NQVKELENGALKRVEKWMSDWKEISEEGRLITI  390

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKT  284
            +GSP+L  Y  DFGWGKPK  E   ID SGAI +  C      IE+G+++    M    +
Sbjct  391  SGSPKLRVYDTDFGWGKPKMSEVVQIDVSGAISLSECRDGGGGIEIGLALTRTNMDAFNS  450

Query  283  LFEEGLQAL  257
            LF++  + L
Sbjct  451  LFQQQFKQL  459



>ref|XP_008230894.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Prunus 
mume]
Length=471

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 100/192 (52%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CLL+++         + D  V      DCR R D P+PANYFGNC+  
Sbjct  290  STFSVTCAYTWVCLLKAE-------EKQTDKPVMMGFTMDCRPRFDPPIPANYFGNCIAG  342

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSF-FGTVSFE-RIL  467
              IV  + G L  +    A  E             +G+L+GAE      + +V  E R +
Sbjct  343  RVIVAERKGLLGEDGLTVAVNEISEAIKSAD---NDGILKGAETLVPIVYSSVRSEKRFM  399

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +   ++ +  D+EVG+ +    M  
Sbjct  400  GVAGSPRFGIYDTDFGWGRPNKVEVVSIEVTGAMSLAECRDGIAGDVEVGLVLEKHHMQA  459

Query  292  LKTLFEEGLQAL  257
              +LF +GLQ L
Sbjct  460  FASLFAKGLQDL  471



>ref|XP_009365887.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Pyrus 
x bretschneideri]
Length=465

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C ++++        +   +T   +  ADCR RLD PLP NYFGNC   
Sbjct  287  STFTLACAYTWVCSVKAE--------EIKGETTRMVFMADCRPRLDPPLPTNYFGNCTAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   +   L  E+G+  A  AI EAI +    E+GVL GAE+W S   TV+  R+LSVA
Sbjct  339  CVPVVETKGLFGEDGLVVAVYAIREAIRK---LEKGVLDGAENWVSRVVTVTSGRMLSVA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GS R   Y  DFGWG+PKK++  SID + AI     K E+  ++ G+ +    M +  +L
Sbjct  396  GSHRFRVYDTDFGWGRPKKVDIVSIDRNKAISFSDPKSEAGVVDAGLVLEKHHMEVFASL  455

Query  280  FEEGLQ  263
            F +GL+
Sbjct  456  FYKGLK  461



>ref|XP_010274321.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=460

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 109/187 (58%), Gaps = 9/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARL-DTPLPANYFGNCLV  641
            S+FVVTCA MW CL+++    S  +++ +    + L   DCR RL D P+P  YFGNCL 
Sbjct  277  SAFVVTCAVMWVCLIKAGVTISSPSKEME----HLLFLVDCRGRLRDPPVPPTYFGNCLA  332

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
            PC V AK   L  ++G+  AA+AI +AI R    E+G+LRGAE W S       E ++ V
Sbjct  333  PCFVDAKKIDLVGKDGIVIAAKAIADAIKR---LEDGILRGAERWPSEVLWREKEGMVWV  389

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKT  284
            +GSP+   Y+MDFGWGKPKK E   +       V   ++  D +EVG+S+P  K+    T
Sbjct  390  SGSPKFGAYEMDFGWGKPKKYEMLGVVGERNFSVFDGRDGEDAVEVGLSLPNPKLEAFTT  449

Query  283  LFEEGLQ  263
             F + L+
Sbjct  450  FFADCLK  456



>gb|KCW54644.1| hypothetical protein EUGRSUZ_I00590 [Eucalyptus grandis]
Length=302

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 104/197 (53%), Gaps = 16/197 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-----QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+F +TCA++W C++RS     QC     +  + D+  YF+  ADCR RL+  +P+ YFG
Sbjct  109  STFALTCAFVWVCIIRSKDRDCQCHNQSSSESDRDELRYFVFLADCRDRLEYSIPSTYFG  168

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCL  C +  K   L  + G+  A  AI     R  E   G  LRG E W   F      
Sbjct  169  NCLSACFLSEKRSTLLGKSGLPLATRAIA---RRVKEIRMGGALRGLEGWMRGFNIADST  225

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPA  308
             +++VAGSPR   Y  +FGWG+ +K  T  ID S AI +    ES D    +EVG+++  
Sbjct  226  DLVTVAGSPRHKVYDTNFGWGRLRKNHTVHIDQSAAISL---TESRDGDGGVEVGLALTR  282

Query  307  AKMHLLKTLFEEGLQAL  257
              M    +LFEEGL++ 
Sbjct  283  VCMEKFISLFEEGLKSF  299



>ref|XP_007216246.1| hypothetical protein PRUPE_ppa016949mg [Prunus persica]
 gb|EMJ17445.1| hypothetical protein PRUPE_ppa016949mg [Prunus persica]
Length=463

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 105/186 (56%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++     IN D+           DCR+RLD P+  NYFGNC+  
Sbjct  287  STFTLACAYTWVCIVKAE----EINSDQ----TRLAFNVDCRSRLDPPISPNYFGNCIAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                A+   L  E+G+  A   I EAI      E+GVL GAE+W S    V+ ER+L++A
Sbjct  339  RTAVAETKALFGEDGLVVAVNTISEAIK---SLEKGVLDGAENWVSRLFAVTSERMLTLA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y+ DFGWG+PKK+E  SID + AI    AK     ++VG+ +    M +  +L
Sbjct  396  GSYRFGVYETDFGWGRPKKVEIVSIDRTRAISFSDAKTDAGVVDVGLVLDKHSMQVFASL  455

Query  280  FEEGLQ  263
            F +GLQ
Sbjct  456  FAKGLQ  461



>ref|XP_007151367.1| hypothetical protein PHAVU_004G040700g [Phaseolus vulgaris]
 gb|ESW23361.1| hypothetical protein PHAVU_004G040700g [Phaseolus vulgaris]
Length=456

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 105/188 (56%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+  CL++         +   ++ V+F+ + DCR+RLD P+PA YFGNC+  
Sbjct  279  STFCVTCAYVLACLVKV--------KQVKEENVFFVFSIDCRSRLDPPIPATYFGNCVAG  330

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                    +   ++G   A E I E ++R    EEGVL+GAE W          RI S  
Sbjct  331  GSFVVLTKEFVEKDGFICALEGIVETLNRV--KEEGVLKGAETWGEGMNKPRDTRIFSTG  388

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSP  + Y +DFGWG+PKK++  S D +GA  +  +++ S  IE+GV++  A+M    T 
Sbjct  389  GSPLFEVYSIDFGWGRPKKVDMISTDKTGAFSLSESRDISGGIEIGVALSKAEMEDFSTF  448

Query  280  FEEGLQAL  257
            F +G  +L
Sbjct  449  FFQGFDSL  456



>ref|XP_007042677.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX98508.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=463

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 99/190 (52%), Gaps = 6/190 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVY-FLCAADCRARLDTPLPANYFGNCLV  641
            S+FVVTCA++W CL++SQ   +  + D DD+  Y F    DCR RL+ P+P  YFGNCL 
Sbjct  277  STFVVTCAFIWVCLIKSQESSTCNSSDADDNKFYYFQFPFDCRNRLEFPVPETYFGNCLK  336

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERILS  464
            P I   K  +L    G      A     ++  E E    R AE W  +        R +S
Sbjct  337  PGIAEVKKSEL---IGENGILLAAKAIGNKVKEIENRGFRDAESWVATLMERTRSGRFVS  393

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLK  287
            V+GSP+   Y ++FGWG+P+K+E   ID +  I +  C  E   IEVGV+    ++    
Sbjct  394  VSGSPKFYVYDINFGWGRPRKVELVHIDSTETISLAECRDELGGIEVGVASNKKQIDEFS  453

Query  286  TLFEEGLQAL  257
             +F + LQ L
Sbjct  454  AIFVQSLQLL  463



>gb|EYU36657.1| hypothetical protein MIMGU_mgv1a019731mg [Erythranthe guttata]
Length=466

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 100/174 (57%), Gaps = 6/174 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F   CA +W C  +S       +   DD+  +F   ADCR RL  P+PANYFGNC+V 
Sbjct  275  STFTAACALVWVCSAKSAG-----DDVADDEPEFFGFVADCRGRLKPPVPANYFGNCVVL  329

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             +   K GQ     G   AA+AIG+AI   +  E G+L GAE W   +  +  +R   VA
Sbjct  330  VLAELKHGQAKGPNGFVMAAKAIGDAIVENVYNENGILFGAEKWPEKYDELIGKRQYGVA  389

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKM  299
            GSPR D+Y +D+GWGKPKK E   +D +G+I +  A++    +E+G+S P  +M
Sbjct  390  GSPRFDFYAVDYGWGKPKKFEALFVDGNGSISLNKARDCEGGLEIGLSKPKLQM  443



>gb|EPS62073.1| hypothetical protein M569_12718 [Genlisea aurea]
Length=457

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 110/191 (58%), Gaps = 10/191 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            +SFV   A +W+CL ++   P  +    D +  YF  AAD R+RL+ P+P +YFGNCL+ 
Sbjct  273  TSFVAASALIWSCLAKAD--PEEV---ADGEPEYFGFAADGRSRLNPPVPNSYFGNCLIF  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERILSV  461
                   G L  EEG   AAE IGEAI   L+ E GVL GAE W   FFG +  +RI  +
Sbjct  328  IKAVTTHGALRGEEGFLTAAELIGEAIRAALQNERGVLEGAETWMEQFFGLLG-KRIFGI  386

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLK  287
            AGSPR D Y  DFGWG P+K E  SID   ++ + C    L+  +EVG+S PA  ++   
Sbjct  387  AGSPRFDLYDADFGWGSPEKYEAASIDADTSMSL-CKSRDLEGGLEVGLSRPAEIINPFT  445

Query  286  TLFEEGLQALS  254
             +F + L+ +S
Sbjct  446  AIFHQELRKIS  456



>gb|KEH25061.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=457

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 108/197 (55%), Gaps = 19/197 (10%)
 Frame = -3

Query  826  RQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLC-AADCRARLDTPLPANYFGN  650
            ++ S+F VTCAY+ +          G+  D+      FL  A DCR+RLD P+  NYFGN
Sbjct  273  KKVSTFAVTCAYLLSL---------GVKVDQQKPNKAFLVFAVDCRSRLDPPINENYFGN  323

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE--  476
            C+V  +V  +   L  + G  +A + I + ++   + E GVL G E+W S   + +    
Sbjct  324  CIVSRLVVHETEALLEDGGFISALKGIIDVLN---DLENGVLNGLENWMSMMQSKTSRTD  380

Query  475  ---RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-GCAKESLDIEVGVSVPA  308
               +I S+ GSPR + Y  DFGWGKPKK++ TS+D  GA Y+ G       IE+G+++  
Sbjct  381  ETYKIFSITGSPRFEVYSFDFGWGKPKKVDVTSVDRPGAFYLSGNRNNDGGIEIGLTLNK  440

Query  307  AKMHLLKTLFEEGLQAL  257
             +M     LF +GL++L
Sbjct  441  QQMEDFARLFVQGLESL  457



>ref|XP_008348092.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=465

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 105/186 (56%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++        +   +T   +  ADCR RLD PLP NYFGNC   
Sbjct  287  STFTLACAYXWVCIVKAE--------EIKGETTRMVFMADCRPRLDPPLPTNYFGNCTAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   +   L  E+G+  A  AI EAI +    E+GVL GAE+W S   TV+  R++S+A
Sbjct  339  CVPVVETKGLFGEDGLVVAVYAIREAIRK---LEKGVLDGAENWVSRVVTVTSGRMISIA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y  DFGWG+PKK+E  SID + AI     K     ++VG+ +    M +  +L
Sbjct  396  GSHRFRVYDTDFGWGRPKKVEIVSIDRNRAISFSDPKSDAGVVDVGLVLEKHHMEVFASL  455

Query  280  FEEGLQ  263
            F + L+
Sbjct  456  FYKDLK  461



>gb|EYU24861.1| hypothetical protein MIMGU_mgv1a006931mg [Erythranthe guttata]
Length=426

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFVVT +Y+WTCL +S      +   EDD   +F+ A D RAR++ P+PANYFGNCL  
Sbjct  246  SSFVVTVSYVWTCLAKS------LEEIEDDALEFFIFAVDVRARINPPVPANYFGNCLSY  299

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS----FFGTVSFERI  470
                 +   L  E G   AAEA+   I  ++  ++ VL+GAE+W S    F G V   R 
Sbjct  300  GRAIIEHKTLVGELGFFVAAEAMALDIKNRVNNKDEVLKGAENWMSDRKKFSGAV---RA  356

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSID---YSGAIYVGCAKESLDIEVGVSVPAAKM  299
            + V+GSP+ D    DFGWG+ +K+E  SID   YS ++      E   +E+G+S+P  +M
Sbjct  357  VGVSGSPKFDLCDADFGWGRARKLEVVSIDGEKYSISLCKSNGSEG-GLEIGLSLPKERM  415

Query  298  HLLKTLFEEGL  266
                T+F +GL
Sbjct  416  EAFATIFADGL  426



>pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- 
Methionine Derivative
 pdb|2E1V|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- 
Methionine Derivative
Length=454

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 108/189 (57%), Gaps = 13/189 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W+C+ +S+          +D    F    D RAR   P+P  YFGNC+  
Sbjct  274  SSFTVACAYIWSCIAKSR----------NDKLQLFGFPIDRRARXKPPIPTAYFGNCVGG  323

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRG-AEDWNSFFGTVSFERILS  464
            C   AK   L  +EG   AA+ IGE +H+ L + ++GVL+   E +N             
Sbjct  324  CAAIAKTNLLIGKEGFITAAKLIGENLHKTLTDYKDGVLKDDXESFNDLVSEGXPTTXTW  383

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKES-LDIEVGVSVPAAKMHLLK  287
            V+G+P+L +Y  DFGWGKPKK+ET SID++GAI +   KES  D+E+GV + A +     
Sbjct  384  VSGTPKLRFYDXDFGWGKPKKLETVSIDHNGAISINSCKESNEDLEIGVCISATQXEDFV  443

Query  286  TLFEEGLQA  260
             +F++GL+A
Sbjct  444  HIFDDGLKA  452



>ref|XP_007151362.1| hypothetical protein PHAVU_004G040200g [Phaseolus vulgaris]
 gb|ESW23356.1| hypothetical protein PHAVU_004G040200g [Phaseolus vulgaris]
Length=456

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 108/188 (57%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+  CL++         +   ++ V+F+ + DCR+RLD P+PA YFGNC+  
Sbjct  279  STFCVTCAYVLACLVKV--------KQVKEENVFFIFSIDCRSRLDPPIPATYFGNCVAG  330

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                    +L  ++G   A E I E ++R    EEGVL+GAE + +        R  S A
Sbjct  331  GSFVVLTKELVEKDGFICALEGIVETLNRV--KEEGVLKGAERFGAGMNKPRETRFFSTA  388

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GSP  + Y +DFGWG+PKK++  S D +GA  +  +++ S  IE+G+ +  A+M    TL
Sbjct  389  GSPLFEVYGIDFGWGRPKKVDMISTDKTGAFSLSESRDISGGIEIGLVLSKAEMEDFSTL  448

Query  280  FEEGLQAL  257
            F +GL +L
Sbjct  449  FVQGLDSL  456



>ref|XP_008357786.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=460

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 105/191 (55%), Gaps = 14/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL++++        +     V      DCR+RLD PLPA YFGNC+  
Sbjct  280  STFSLTCAYTWVCLVKAE--------EIKTKKVLXXFNVDCRSRLDPPLPATYFGNCIAA  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERILS  464
              V A+   L  E+G+  A  A+   I R L+  +GVL G E W    F    S +R  S
Sbjct  332  RGVIAETDDLVGEDGLFVALTAVSTPIKR-LDT-DGVLNGMETWIPXMFDAZTSTDRJFS  389

Query  463  VAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            VAGSPR + Y   DFGWG+P+ IE  SID +GAI +  +K     +E+G+++    M   
Sbjct  390  VAGSPRFELYDAADFGWGRPRTIEFVSIDRTGAISLSDSKNGGGGVEIGLALKKXSMEAF  449

Query  289  KTLFEEGLQAL  257
             +LF EGL+ L
Sbjct  450  ASLFAEGLEQL  460



>ref|XP_004306067.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467879.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=447

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 94/152 (62%), Gaps = 12/152 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++    G        T   + A D R+RLD P+PA YFGNC+V 
Sbjct  272  STFSLVCAYTWVCMVKAEEIKGG--------TTILIFAVDSRSRLDPPIPATYFGNCIVG  323

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS-FERILSV  461
             +  A+   L +E+G+  A  AI EA+      E+GVL GAEDW S F   S ++RI S+
Sbjct  324  RVAVAETKGLLSEDGLVVAVNAITEALR---SLEKGVLDGAEDWVSKFVDFSLYDRIYSI  380

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAI  365
            AGS RL+ Y  DFGWG+PK++E  SID +GAI
Sbjct  381  AGSHRLEVYDTDFGWGRPKRVEVISIDRTGAI  412



>emb|CBI18016.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 28/185 (15%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTCAY WTC++++Q + SG    E++   +F   ADCRA LD PLP NYF N +  
Sbjct  232  SSFTVTCAYTWTCIVKAQVW-SGEEVSENE-LEHFGFVADCRACLDPPLPENYFANLIGE  289

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             I                           +L  ++GVL G + W   F +++ ER + VA
Sbjct  290  AI-------------------------QEKLGSKKGVLEGLDKWVVNFSSINIERAVGVA  324

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFG G+ +K E  SID + +I +   K++  DIEVG+S P  KM    ++
Sbjct  325  GSPRFSVYDIDFGLGQLQKREFISIDETRSISLLEGKDNKSDIEVGLSFPKIKMDAFASI  384

Query  280  FEEGL  266
            F  GL
Sbjct  385  FTNGL  389



>ref|XP_009365966.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
1-like [Pyrus x bretschneideri]
Length=478

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 108/186 (58%), Gaps = 12/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W C+++++        +   +T   + +ADCR RLD P+P NYFGNC   
Sbjct  287  STFTLACAYTWVCIVKAE--------EIKGETTRMVFSADCRPRLDPPVPTNYFGNCTAG  338

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+   +  +L+ E+G+  AA AI EAI +    E+GVL G E+W S   TV+  R+L+VA
Sbjct  339  CVPVVETKRLSGEDGLFVAANAIREAIRK---LEKGVLDGVENWVSNVVTVTSARMLTVA  395

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKTL  281
            GS R   Y  DFGWG+PKK+E  +ID + AI     K     ++VG+ +    M +  +L
Sbjct  396  GSNRFRVYDTDFGWGRPKKVEIVTIDRTRAISFSHPKSDAGVVDVGLVLEKHCMEVFASL  455

Query  280  FEEGLQ  263
            F + L+
Sbjct  456  FYKDLK  461



>ref|XP_010089648.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB38119.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=473

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 111/193 (58%), Gaps = 20/193 (10%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F+VTCAY W CL++++        +  D+ + F  A D R+RL+ P+PA YFGNC+  
Sbjct  289  STFLVTCAYTWICLVKAE--------EISDNEIPFTFAMDLRSRLEPPIPATYFGNCVGE  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERILS  464
             ++  +   L  +EG+  A  AI EAI       EG L GAE+W  +S     +F R  S
Sbjct  341  NVIVVEREALLGKEGLFVAVNAISEAIKG---LNEGPLDGAENWVASSINAVKTFPRQYS  397

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPAAKMH  296
            VA SPR + Y  DFGWGKP++++  SID +GAI   C  E+ +    IE+G+ +    M 
Sbjct  398  VASSPRFEVYDTDFGWGKPREVDVVSIDGTGAI---CLSENRNGEGGIEIGLVLLKHHME  454

Query  295  LLKTLFEEGLQAL  257
               +LF EGL++L
Sbjct  455  ACASLFAEGLESL  467



>ref|XP_009365919.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
1-like [Pyrus x bretschneideri]
Length=460

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 106/191 (55%), Gaps = 14/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL+++        ++     V  +   DCR+RLD PLPA YFGNC+ P
Sbjct  280  STFSLTCAYTWVCLVKA--------KEIKAKKVLLVFNVDCRSRLDPPLPATYFGNCIAP  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS--FFGTVSFERILS  464
              V A+   L  E+G+     A+  AI R L+  +GVL G E W    F    S + I S
Sbjct  332  HGVIAETNDLMGEDGLFVVLTAVSTAIKR-LDT-DGVLNGMETWIPLMFDAETSTDGIFS  389

Query  463  VAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            VAGS R + Y   DFGWG+P+ IE  SID +GAI +  +K     +E+G+++    M   
Sbjct  390  VAGSHRFELYDAADFGWGRPRTIEFVSIDRTGAISLSDSKNGGGGVEIGLALKKHSMEAF  449

Query  289  KTLFEEGLQAL  257
             +LF EGL+ L
Sbjct  450  ASLFAEGLEQL  460



>ref|XP_006649178.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Oryza brachyantha]
Length=412

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 105/189 (56%), Gaps = 11/189 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY WTCL+R     +G  R       + L + +CR RL  P+P  Y GNCL P
Sbjct  233  SAFTVACAYAWTCLVRVDASAAGRER------AHLLFSVECRRRLTPPVPQEYLGNCLRP  286

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V    G L   +GV  AA  IG +I R L+  +GVL GA+ W     ++   R +SV 
Sbjct  287  CFVEVDMGGLLGADGVVTAAVGIGASI-RGLD--DGVLDGADGWFHKILSMMSHRPMSVG  343

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLKT  284
            GSPR   Y  DFG G+P+K+E  SID + G + +   ++    IE+GV++P A+M    +
Sbjct  344  GSPRYGVYDTDFGLGRPRKVELLSIDKTPGTVSMAEGRDGQGGIEIGVALPEAEMDQFTS  403

Query  283  LFEEGLQAL  257
             F +GL+ L
Sbjct  404  CFSDGLKQL  412



>ref|XP_008813246.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Phoenix 
dactylifera]
Length=544

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 113/198 (57%), Gaps = 11/198 (6%)
 Frame = -3

Query  841  AGQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            A + + Q S +   C ++W  L+ ++    G ++ ++    +F     CRARLD P+P+N
Sbjct  355  ASKTSAQCSPYAAACGFVWAGLVHAR---GGTSKKKE----HFGFVTGCRARLDPPIPSN  407

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS  482
            YFGNCL  C V AK  +L   +G   AA+AI + I      EEG  + AE+W       +
Sbjct  408  YFGNCLGICCVEAKQSELIGCDGPLIAADAIWKVIK---SLEEGAFKDAENWIRNVYNYA  464

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAA  305
                L+VAGSP+L  Y++DFGWG+P+K+E  SI  +GA+ +  ++E    IEVG+++P+ 
Sbjct  465  SVGALTVAGSPKLGMYEVDFGWGRPRKVEVISIARTGALSLAESREEKGGIEVGLALPSH  524

Query  304  KMHLLKTLFEEGLQALSL  251
            +M    + F  GL  LSL
Sbjct  525  EMEEFVSFFVNGLSGLSL  542



>ref|XP_010657386.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Vitis vinifera]
Length=432

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 28/185 (15%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VTCAY WTC++++Q + SG    E++   +F   ADCRA LD PLP NYF N +  
Sbjct  271  SSFTVTCAYTWTCIVKAQVW-SGEEVSENE-LEHFGFVADCRACLDPPLPENYFANLIGE  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             I                           +L  ++GVL G + W   F +++ ER + VA
Sbjct  329  AI-------------------------QEKLGSKKGVLEGLDKWVVNFSSINIERAVGVA  363

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFG G+ +K E  SID + +I +   K++  DIEVG+S P  KM    ++
Sbjct  364  GSPRFSVYDIDFGLGQLQKREFISIDETRSISLLEGKDNKSDIEVGLSFPKIKMDAFASI  423

Query  280  FEEGL  266
            F  GL
Sbjct  424  FTNGL  428



>ref|XP_003543881.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine 
max]
Length=469

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 106/190 (56%), Gaps = 12/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+ TCL++++       + E+DD V F+ + DCR+RL+ P+PA YFGNC+  
Sbjct  289  STFAVTCAYVLTCLVKAK-------QPEEDD-VGFVFSVDCRSRLNPPIPATYFGNCVAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT--VSFERILS  464
              V A    L        +A          ++ E GVL GAE W S       S  R+ S
Sbjct  341  QKVVAVTKNLVGISDGFISALEGISEALNIVKGE-GVLSGAETWVSLMLERGESVPRLFS  399

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLK  287
            +AGSP  + Y  DFGWG+PKK++ TSID +GA  +  +++ S  IE+G+ +   +M    
Sbjct  400  IAGSPLFEVYGTDFGWGRPKKVDMTSIDGTGAFSLSESRDNSGGIEIGLMLCQREMEAFS  459

Query  286  TLFEEGLQAL  257
            TLF  G ++ 
Sbjct  460  TLFVGGHESF  469



>ref|XP_010261004.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Nelumbo nucifera]
Length=463

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 105/195 (54%), Gaps = 11/195 (6%)
 Frame = -3

Query  835  QVARQP---SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARL-DTPLP  668
            Q+ + P   S+FVV CA  W CL++     S   +  +    +F+ +ADCR RL D P+P
Sbjct  264  QIQKSPLPFSTFVVICALTWVCLIKVGAVKSSPTKTME----HFVVSADCRGRLVDPPVP  319

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
              YFGNC+  C  +A  G L  E G   AA+AI +AI R    E+GVL GAE W S  G+
Sbjct  320  TTYFGNCVTLCFAKANRGDLIGERGFPIAAKAIADAIRR---LEDGVLNGAERWISESGS  376

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPA  308
            +  E  ++VAGSPR   Y+ DFGWG+PKK E          +   +     +EVG+++  
Sbjct  377  LVEEGAVTVAGSPRFGAYEADFGWGRPKKHEVVGKGEGHFSFYDGSDGEGAVEVGLALSK  436

Query  307  AKMHLLKTLFEEGLQ  263
             KM    TLF  GL 
Sbjct  437  PKMDAFATLFVNGLN  451



>ref|XP_008348091.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=460

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 105/191 (55%), Gaps = 14/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL++++        +     V  +   DCR+RLD PLPA YFGNC+  
Sbjct  280  STFSLXCAYTWVCLVKAE--------EIKTKKVLXIFNVDCRSRLDPPLPATYFGNCIAA  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFERILS  464
              V A+   L  E+G+  A  A+   I R L+  +GVL G E W    F    S +R  S
Sbjct  332  RGVIAETDDLXGEDGLFVALTAVSTPIKR-LDT-DGVLNGMETWIPXMFDAZTSTDRJFS  389

Query  463  VAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            VAGSPR + Y   DFGWG+P+ IE  SID +GAI +  +K     +E+G+++    M   
Sbjct  390  VAGSPRFELYDAADFGWGRPRTIEFVSIDRTGAISLSDSKNGGGGVEIGLALKKLSMEAF  449

Query  289  KTLFEEGLQAL  257
             +LF EGL+ L
Sbjct  450  ASLFAEGLEQL  460



>gb|KHN07114.1| Agmatine coumaroyltransferase [Glycine soja]
Length=469

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 106/190 (56%), Gaps = 12/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+ TCL++++       + E+DD V F+ + DCR+RL+ P+PA YFGNC+  
Sbjct  289  STFAVTCAYVLTCLVKAK-------QPEEDD-VGFVFSVDCRSRLNPPIPATYFGNCVAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT--VSFERILS  464
              V A    L        +A          ++ E GVL GAE W S       S  R+ S
Sbjct  341  QKVVAVTKNLVGISDGFISALEGISEALNIVKGE-GVLSGAETWVSLMLERGESVLRLFS  399

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLK  287
            +AGSP  + Y  DFGWG+PKK++ TSID +GA  +  +++ S  IE+G+ +   +M    
Sbjct  400  IAGSPLFEVYGTDFGWGRPKKVDMTSIDGTGAFSLSESRDNSGGIEIGLMLCQREMEAFS  459

Query  286  TLFEEGLQAL  257
            TLF  G ++ 
Sbjct  460  TLFVGGHESF  469



>ref|XP_011467881.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=460

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S F + CAY W CL++++         ED+  V F  +ADCR+RLD PLPA YFGNC V 
Sbjct  280  SLFSLACAYTWVCLVKAE------ETKEDEARVIF--SADCRSRLDPPLPATYFGNCTVG  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C+V AK   L  E+G+  A  AI EA+ R LE +EG+L GAE+W S   ++   R++ +A
Sbjct  332  CLVVAKTKGLLGEDGLVVALRAISEAL-RNLE-KEGILNGAENWVSRLSSLRSGRLVGIA  389

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAI  365
            GS R   Y+ DFGWG P K+E  SID + AI
Sbjct  390  GSHRFGMYETDFGWGSPCKVEIVSIDRTSAI  420



>ref|XP_008797924.1| PREDICTED: LOW QUALITY PROTEIN: malonyl-coenzyme A:anthocyanin 
3-O-glucoside-6''-O-malonyltransferase-like [Phoenix dactylifera]
Length=447

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 108/190 (57%), Gaps = 13/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VV  AY+W CL++ +   S       D   Y   A DCR RL  P+PA+YFGNC+  
Sbjct  268  STIVVALAYVWVCLVKMRGLAS-------DRKAYSGFAVDCRERLQPPVPASYFGNCVGS  320

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLE-CEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V    G +  EEG  AAAEAIG    + +E  + G+L GAE W   F ++  E+ ++V
Sbjct  321  CFVEVAVGDVIGEEGFVAAAEAIG----KAIEGIKHGILDGAESWLRRFVSILPEQPMTV  376

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKT  284
            AGSP+   Y+ DFGWG PKK+  TSI  +G I V  ++ E   IE+G+ +P   M   +T
Sbjct  377  AGSPKFRVYETDFGWGGPKKVLVTSISGAGNISVAESRAEQGGIEIGMVLPKHVMDEFRT  436

Query  283  LFEEGLQALS  254
             F  GL+ ++
Sbjct  437  HFLNGLKLIA  446



>ref|XP_010030472.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Eucalyptus grandis]
Length=480

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 104/197 (53%), Gaps = 16/197 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-----QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+F +TCA++W C++RS     QC     +  + D+  YF+  ADCR RL+  +P+ YFG
Sbjct  287  STFALTCAFVWVCIIRSKDRDCQCHNQSSSESDRDELRYFVFLADCRDRLEYSIPSTYFG  346

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCL  C +  K   L  + G+  A  AI     R  E   G  LRG E W   F      
Sbjct  347  NCLSACFLSEKRSTLLGKSGLPLATRAIA---RRVKEIRMGGALRGLEGWMRGFNIADST  403

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPA  308
             +++VAGSPR   Y  +FGWG+ +K  T  ID S AI +    ES D    +EVG+++  
Sbjct  404  DLVTVAGSPRHKVYDTNFGWGRLRKNHTVHIDQSAAISL---TESRDGDGGVEVGLALTR  460

Query  307  AKMHLLKTLFEEGLQAL  257
              M    +LFEEGL++ 
Sbjct  461  VCMEKFISLFEEGLKSF  477



>gb|KCW54645.1| hypothetical protein EUGRSUZ_I00591 [Eucalyptus grandis]
Length=468

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 106/192 (55%), Gaps = 12/192 (6%)
 Frame = -3

Query  814  SFVVTCAYMWTCLLRSQ------CFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            SFVV CA++W C+++S+      C  S   R +D+   YF   ADCR +L+  +P  YFG
Sbjct  281  SFVVMCAFVWICIIKSKEEEQQRCDHSSSERGKDE-LYYFAFLADCRDQLEYSIPLTYFG  339

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCLVPC +  K   +  + G+  AA AIG    R  E   G  LR  + W   F      
Sbjct  340  NCLVPCFISKKRSTVLGKSGILHAARAIGI---RVKEIRTGGALRVMDGWIRNFNIAKSR  396

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKM  299
             +L+VAGSPRL  Y+ DFGWG+P+K     ID SGA  +  ++ E   +EVG+++ +  M
Sbjct  397  DLLTVAGSPRLKVYETDFGWGRPRKSHVVHIDASGAFSLAESRDEDGGVEVGLALTSVCM  456

Query  298  HLLKTLFEEGLQ  263
            +    LFE+GL 
Sbjct  457  NKFIYLFEKGLN  468



>emb|CDP11899.1| unnamed protein product [Coffea canephora]
Length=144

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 1/144 (1%)
 Frame = -3

Query  685  LDTPLPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW  506
            +D PLP+NYFGNC        K G+L  EEG   A E+IGE IH++L+  + +   A+ W
Sbjct  1    MDPPLPSNYFGNCQTVIRKNEKNGKLIGEEGFPIAVESIGEGIHQRLKNNDSLFDDADTW  60

Query  505  NSFFGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKES-LDIE  329
                  ++ +R++SVAGSPR +YY +DFGWGKPKK E  SI+ SGAI +G ++ES   IE
Sbjct  61   LPGIAGINLDRLVSVAGSPRYNYYNLDFGWGKPKKFEFISIETSGAISLGGSRESDGGIE  120

Query  328  VGVSVPAAKMHLLKTLFEEGLQAL  257
            VG+S+   +M     +F + L +L
Sbjct  121  VGLSLSKPRMDAFTVIFNDRLNSL  144



>ref|XP_008357916.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=548

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 101/195 (52%), Gaps = 13/195 (7%)
 Frame = -3

Query  835  QVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYF  656
            Q  +  S+F +TCAY+W CL++++        +            D R+RLD P+P NY 
Sbjct  365  QXVQYLSTFCLTCAYIWICLIKAE--------EMQAKNAVMGFTVDARSRLDPPIPTNYV  416

Query  655  GNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV-SF  479
            GNCLV   +R    +     G      A+          ++G L GAEDW     +V + 
Sbjct  417  GNCLV---LRMAVAETKXLLGGEGLVVAVDAISEAVKSLDDGALNGAEDWIPLLYSVGTD  473

Query  478  ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAK  302
            E I S AGSPR + Y  DFGWG+PKK+E  SI+ +GA+ +  +K+    +++G+ +    
Sbjct  474  ESIFSTAGSPRFEIYDTDFGWGRPKKVEIVSIEGTGAMSISESKDGAGGLDIGLVMKKRH  533

Query  301  MHLLKTLFEEGLQAL  257
            M +  +LF +GL+ L
Sbjct  534  MEIFASLFAKGLENL  548



>ref|XP_010027980.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like isoform X1 [Eucalyptus grandis]
Length=478

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 106/192 (55%), Gaps = 12/192 (6%)
 Frame = -3

Query  814  SFVVTCAYMWTCLLRSQ------CFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            SFVV CA++W C+++S+      C  S   R +D+   YF   ADCR +L+  +P  YFG
Sbjct  291  SFVVMCAFVWICIIKSKEEEQQRCDHSSSERGKDE-LYYFAFLADCRDQLEYSIPLTYFG  349

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCLVPC +  K   +  + G+  AA AIG    R  E   G  LR  + W   F      
Sbjct  350  NCLVPCFISKKRSTVLGKSGILHAARAIGI---RVKEIRTGGALRVMDGWIRNFNIAKSR  406

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKM  299
             +L+VAGSPRL  Y+ DFGWG+P+K     ID SGA  +  ++ E   +EVG+++ +  M
Sbjct  407  DLLTVAGSPRLKVYETDFGWGRPRKSHVVHIDASGAFSLAESRDEDGGVEVGLALTSVCM  466

Query  298  HLLKTLFEEGLQ  263
            +    LFE+GL 
Sbjct  467  NKFIYLFEKGLN  478



>ref|XP_008230892.1| PREDICTED: phenolic glucoside malonyltransferase 1-like isoform 
X1 [Prunus mume]
Length=470

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +T AY   CL +++         + D  V      DCR+RLD PLPANYFGNC+  
Sbjct  289  STFSITYAYTCVCLAKAE-------EKQSDKPVLMAFTLDCRSRLDPPLPANYFGNCIAG  341

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFERIL  467
              +V  + G L  +    A  E             +G+L GAE W         S ER +
Sbjct  342  RSVVADRKGLLGEDGLTVAVNEISEAIKSVD---SDGILNGAETWVQILYPAVSSEERFM  398

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  +++ +  D+EVG+ +    M  
Sbjct  399  GVAGSPRFGIYDTDFGWGRPSKVEVVSIEETGAMSLAESRDGIAGDVEVGLVLEKHHMQA  458

Query  292  LKTLFEEGLQAL  257
              ++F +GLQ L
Sbjct  459  FASVFAKGLQDL  470



>gb|EYU24859.1| hypothetical protein MIMGU_mgv1a023480mg [Erythranthe guttata]
Length=458

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 109/200 (55%), Gaps = 14/200 (7%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV---YFLCAADCRARLDT  677
            +A++P     SSFVVT +Y+WT LL+S    +G   +EDDD     YF  A D R R++ 
Sbjct  262  LAKKPGLVHVSSFVVTTSYIWTTLLKS----AGAVEEEDDDHSTLEYFKFAVDARERVNP  317

Query  676  PLPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSF  497
            P+P NYFGNCL   I   K  +L  EEG+  AAE + E +      ++  L+GAE+W   
Sbjct  318  PVPTNYFGNCLGVGIAEIKHEKLVDEEGLLVAAEFMSELMKNMSNNKDEALKGAENWMDG  377

Query  496  FGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVG  323
                 + R + V+GSPR D+   DFGWG+ +K E  SID        C     +  +E+G
Sbjct  378  SMKHVWARAVGVSGSPRFDFCSADFGWGRARKFEVVSIDGERCSISLCKSNDSEGGLEIG  437

Query  322  VSVPAAKMHLLKTLFEEGLQ  263
            +S+P  +M     +F +GL+
Sbjct  438  LSLPKERMTAFAAIFADGLK  457



>gb|EYU24853.1| hypothetical protein MIMGU_mgv1a006246mg [Erythranthe guttata]
Length=451

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 111/198 (56%), Gaps = 10/198 (5%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLP  668
            +A++P     SSFVVT +Y+WT L++S      +  ++ +   YF+ A D R R++  +P
Sbjct  257  LAKKPDLGHVSSFVVTASYIWTTLVKSA---DHVEEEDQNTHEYFVFAVDIRERINPAVP  313

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             NYFGNCL       + G+L  EEG++ AAE + E I  ++  ++ VLRG E+W      
Sbjct  314  TNYFGNCLGAGTAEIEHGKLVGEEGLSVAAEYMAEDIKNRINNKDEVLRGVENWMDGSKN  373

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSV  314
               +R + V+GSPR D+   DFGWG+ +K+E  SID        C     +  +E+G+S+
Sbjct  374  HMLDRAVGVSGSPRFDFCDADFGWGRARKLEVVSIDGERCSISLCKSNDSEGGLEIGLSM  433

Query  313  PAAKMHLLKTLFEEGLQA  260
            P  +M     +F +GL++
Sbjct  434  PKERMDAFAAVFADGLKS  451



>ref|XP_009365888.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Pyrus 
x bretschneideri]
Length=460

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 105/191 (55%), Gaps = 14/191 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL+++        ++     V  +   DCR+RLD PLPA YFGNC+ P
Sbjct  280  STFSLACAYTWVCLVKA--------KEIKAKKVLLVFNVDCRSRLDPPLPATYFGNCIAP  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS--FFGTVSFERILS  464
              V A+   L  E+G+     A+  AI R L+  +GVL G E W    F    S + I S
Sbjct  332  HGVIAETNDLMGEDGLFVVLTAVSTAIKR-LDT-DGVLNGMETWIPLMFDAETSTDGIFS  389

Query  463  VAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            VAGS R + Y   DFGWG+P+ IE  SID +GAI +  +K     +E+G+++    M   
Sbjct  390  VAGSHRFELYDAADFGWGRPRTIEFVSIDRTGAISLSDSKNGGGGVEIGLALKKHSMEAF  449

Query  289  KTLFEEGLQAL  257
             +LF EGL+ L
Sbjct  450  ASLFAEGLEQL  460



>ref|XP_004956266.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Setaria italica]
Length=459

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 100/192 (52%), Gaps = 8/192 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV   A  W CLL+S    +G+   E     + L +A+CR+RL  PLPA YFGNCL P
Sbjct  273  SSFVAASALAWVCLLKSGS--AGVAGAERS---HMLFSAECRSRLAPPLPAEYFGNCLRP  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V A    L + +     A A         E E+GVL GAE W     +V  ER +SV 
Sbjct  328  CFVEAATADLLSGDTADGVAAAASAIGSAIREMEQGVLEGAEGWLGRVLSVLPERPMSVG  387

Query  457  GSPRLDYYK-MDFGWGKPKKIETTSIDYS-GAIYVGCAKES-LDIEVGVSVPAAKMHLLK  287
            GSPR   Y+  DFGWG+P ++E  S++ + G + +  + E    IE+GV +P   M    
Sbjct  388  GSPRHGVYETTDFGWGRPARVEMVSVEKTPGTVALADSPEGDGGIELGVVLPPDAMDAFA  447

Query  286  TLFEEGLQALSL  251
            + F + L   ++
Sbjct  448  SCFADALGGATI  459



>ref|XP_009382788.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQC-FPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            A   S+FVV CA+ W CL+R+Q  F +G        + + L + +CR RL+ P+PA YFG
Sbjct  275  ATHVSTFVVACAFAWACLVRAQAGFYAG------KKSAHLLFSVECRGRLEPPVPAGYFG  328

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLE-CEEGVLRGAEDWNSFFGTVSFE  476
            NCL PC V      L  ++GV AAAEAIG    R ++  E G+L+GAE W     +++ E
Sbjct  329  NCLRPCFVEVSMSDLIKDDGVFAAAEAIG----RAIKGLEHGILKGAEGWLEKIVSLTAE  384

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKE-SLDIEVGVSVPAAK  302
            R +S+AGSPR   Y  D GWG+P K+E TSI+ + G + +  +++    IE+G+ +P   
Sbjct  385  RPMSIAGSPRYRVYDADLGWGRPIKVEMTSIEKTPGTVSLAESRDGGGGIEMGLVLPEKD  444

Query  301  M  299
            M
Sbjct  445  M  445



>ref|XP_010265764.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=464

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 103/194 (53%), Gaps = 28/194 (14%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY W CL+++            ++   FL   DCR+RLD PLPA YFGNC+  
Sbjct  281  STFTVVCAYTWVCLVQA-----------GNERFRFLINVDCRSRLDPPLPATYFGNCIGT  329

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTVSFERILSV  461
             IV A+   L   + +A AA  I E   R    E GVL  AE W S      S    ++V
Sbjct  330  RIVNAERADLLRHDALAIAATLIDETTKR---LENGVLDDAELWLSRLLSAGSSAPKIAV  386

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV-------GCAKESLDIEVGVSVPAAK  302
            AGS RL +Y  DFGWG+PKK+E TS D +GAI++       G A+ SL ++ G      +
Sbjct  387  AGSNRLGFYDADFGWGRPKKVELTSNDRTGAIFITENPNGDGGAEISLTLKKG------E  440

Query  301  MHLLKTLFEEGLQA  260
            M    ++F  GL+A
Sbjct  441  MDAFASVFVNGLRA  454



>ref|XP_010247206.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Nelumbo 
nucifera]
Length=367

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 102/187 (55%), Gaps = 15/187 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY+W CL++S            D+ ++FL   DCR+RLD  +P  YFGNC+  
Sbjct  185  STFTVVCAYVWVCLVQS-----------GDERIHFLINVDCRSRLDPSVPWTYFGNCIGN  233

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             +V+A+   L   + +A AA+ I     +  + E+G+  GAE W S   +   +     A
Sbjct  234  RVVKAERDDLLEHDAIAKAAKLIE---EKTKQLEKGIFDGAEFWLSHILSAGADPKFGAA  290

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKTL  281
            GS  L +Y+ DFGWG+PKK+E  SID SG +++     +    E+ +++   +M +  ++
Sbjct  291  GSNHLGFYEADFGWGRPKKVELVSIDRSGLLFIAENPNDRGGAEISLTLEKHEMDVFSSM  350

Query  280  FEEGLQA  260
            F  GL A
Sbjct  351  FCNGLSA  357



>gb|KDO55796.1| hypothetical protein CISIN_1g012440mg [Citrus sinensis]
Length=463

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 108/189 (57%), Gaps = 11/189 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVY-FLCAADCRARLDTPLPANYFGNCLV  641
            S+FVVT A MW  ++  Q   S I    D D +Y F+  ADCR R + P+PA+YFGNCL 
Sbjct  278  STFVVTSALMWVYMIELQESESEIT---DGDMIYHFVPVADCRERFEFPIPASYFGNCLA  334

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFG-TVSFERIL  467
               + AK  +L  +EGV  AA+AIG    R++ E E+G L GAE W S     V   R+L
Sbjct  335  FLFISAKRSELMGKEGVVFAAKAIG----RKIGELEKGALVGAEKWTSNLNEVVKTGRVL  390

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLL  290
            +V GSP+   Y+ DFGWG+PKK+E       G+  +  ++ E   IE+G+ +   K+ LL
Sbjct  391  AVGGSPKFGVYETDFGWGRPKKLEFVHFGAYGSFSLAESRDEEGAIEIGLVIGRDKLDLL  450

Query  289  KTLFEEGLQ  263
              +F+  L 
Sbjct  451  NVVFQRRLN  459



>emb|CBI18015.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 93/187 (50%), Gaps = 28/187 (15%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W C+ +++   SG +  E++   +      CRA  D P+PANYF   +  
Sbjct  340  SSFTVACAYVWDCMGKARA-KSGEDVGENEPE-HLAFVGGCRAYFDPPIPANYFAKTIGE  397

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             I                           +L  +EGVL+ AE W S F T   +RI+ VA
Sbjct  398  AI-------------------------QERLRKKEGVLKDAEKWISEFETRKEDRIVGVA  432

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKTL  281
            GSPR   Y +DFG GKPKK E  SID +G+I +  C  +    E+G+S+P  KM   + +
Sbjct  433  GSPRFAVYDIDFGLGKPKKSEVVSIDMTGSISLNECKNDKESFEIGLSLPKIKMDAFEDI  492

Query  280  FEEGLQA  260
            F  G Q 
Sbjct  493  FANGFQV  499


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = -3

Query  835  QVARQP--SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            Q+ +Q   S+F V CAY+W+C+++++   SG +  E++   +F   ADCR  LD P+PA 
Sbjct  241  QIPKQSHVSAFTVVCAYVWSCMIKARS-RSGEDVGENE-LEHFAFTADCRTLLDPPIPAA  298

Query  661  YFGNCLVPCIVRAK  620
            YFGNCL+  +   K
Sbjct  299  YFGNCLMGGLATTK  312



>ref|XP_009391701.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=462

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 99/186 (53%), Gaps = 11/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VV  A+ W C +R++   S       D   +F+  ADCR RL   +PA YFGNC+ P
Sbjct  267  STVVVAFAFAWVCHVRARGHGS-------DRITHFIFMADCRGRLRPSVPAEYFGNCVRP  319

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  KA  L   +G   A+ AIG  I    E +  VL  AE+W         E+ L+VA
Sbjct  320  CFVDVKAEDLIRRDGFVVASAAIGRVIE---ELKADVLHDAEEWRGGAQAAMPEQALTVA  376

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+   Y  D GWG+P K+E TSI  SGAI VG ++E    +E+G+ +P  +M    T 
Sbjct  377  GSPKFSVYDTDMGWGRPNKVEVTSIRTSGAILVGKSREDEGGVEIGLVLPRNEMEEFGTQ  436

Query  280  FEEGLQ  263
            F   L+
Sbjct  437  FLGSLK  442



>gb|KHN48832.1| Agmatine coumaroyltransferase [Glycine soja]
Length=464

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 108/188 (57%), Gaps = 12/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S++ VTCAY+  CL++++            + V FL + DCRARL+ P+P+ YFGNC++ 
Sbjct  288  STYSVTCAYVLQCLVKTE--------QPKANGVAFLFSVDCRARLEPPIPSTYFGNCIIG  339

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
              V  +  +L  ++    A E I EA+ +    E+GVL GA   ++        RIL+ A
Sbjct  340  RRVMDETMKLLRDDAFINALEGINEAMKK---LEDGVLNGAVTLSTMMQIARDNRILTTA  396

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GSPR + Y +DFGWG+PKK++ TSI  +GA  V  ++ ++  IEV + +   +M      
Sbjct  397  GSPRFEVYSIDFGWGRPKKVDMTSIGKTGAFGVSESRNDTGGIEVSLVLNKQEMETFTAH  456

Query  280  FEEGLQAL  257
            F +GL++L
Sbjct  457  FTQGLESL  464



>ref|XP_004304225.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011468649.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 105/188 (56%), Gaps = 12/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL+++Q        +  +D    +   DCR+RLD P+PA YFGNC+  
Sbjct  285  STFCLACAYTWVCLVKTQ--------EAKEDKTRLIFPVDCRSRLDPPIPATYFGNCIAG  336

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             +  A+   L  E+G+  A  AI EAI      + GVL GAE+W S   TV  +R+ SVA
Sbjct  337  RLAIAETKGLLGEDGLVVAVNAIIEAIK---SLDYGVLNGAENWVSRLCTVLSDRVASVA  393

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTL  281
            GS R   Y+ DFGWG PKK++  SID +GAI +         ++VG+ +    + +  + 
Sbjct  394  GSHRFGVYETDFGWGIPKKVDLVSIDRTGAISLSDTNNGDRGLDVGLVLQKHYIDVFASQ  453

Query  280  FEEGLQAL  257
            F +GL+ L
Sbjct  454  FAKGLENL  461



>ref|XP_003554894.2| PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine 
max]
Length=479

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 108/188 (57%), Gaps = 12/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S++ VTCAY+  CL++++            + V FL + DCRARL+ P+P+ YFGNC++ 
Sbjct  303  STYSVTCAYVLQCLVKTE--------QPKANGVAFLFSVDCRARLEPPIPSTYFGNCIIG  354

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
              V  +  +L  ++    A E I EA+ +    E+GVL GA   ++        RIL+ A
Sbjct  355  RRVMDETMKLLRDDAFINALEGINEAMKK---LEDGVLNGAVTLSTMMQIARDNRILTTA  411

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GSPR + Y +DFGWG+PKK++ TSI  +GA  V  ++ ++  IEV + +   +M      
Sbjct  412  GSPRFEVYSIDFGWGRPKKVDMTSIGKTGAFGVSESRNDTGGIEVSLVLNKQEMETFTAH  471

Query  280  FEEGLQAL  257
            F +GL++L
Sbjct  472  FTQGLESL  479



>ref|XP_007214879.1| hypothetical protein PRUPE_ppa026936mg [Prunus persica]
 gb|EMJ16078.1| hypothetical protein PRUPE_ppa026936mg [Prunus persica]
Length=470

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 98/192 (51%), Gaps = 15/192 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VT AY   CL +++         + D  V    + DCR+R D P+PANYFGNC+  
Sbjct  289  SAFSVTYAYTCVCLAKAE-------EKQSDKPVLMAFSLDCRSRFDPPMPANYFGNCIAG  341

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFERIL  467
              +V  + G L  +    A  E             +G+L+GAE W         S ER +
Sbjct  342  RAVVADRKGVLGEDGLTVAVNEISETIKRVD---SDGILKGAETWVQILYPAVSSEERFM  398

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL--DIEVGVSVPAAKMHL  293
             VAGSPR   Y  DFGWG+P K+E  SI+ +GA+ +  ++  +  D+EVG+ +    M  
Sbjct  399  GVAGSPRFGIYDTDFGWGRPSKVEVVSIEETGAMSLAESRGGIAGDVEVGLVLEKHHMQA  458

Query  292  LKTLFEEGLQAL  257
              ++F +GLQ L
Sbjct  459  FASVFAKGLQNL  470



>gb|EAY88051.1| hypothetical protein OsI_09479 [Oryza sativa Indica Group]
Length=453

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 97/190 (51%), Gaps = 11/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY WTCL R     +   R       + L + +CR RL  P+P  Y GNCL P
Sbjct  272  SAFTVACAYAWTCLARVDATSAARER------AHLLFSVECRRRLTPPVPQEYLGNCLRP  325

Query  637  CIVRAK-AGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V    AG L +       A     A  R L+  +GVL GA+ W     ++   R +S+
Sbjct  326  CFVEVDTAGLLGSGADGVVTAAVAIGAAIRGLD--DGVLDGADGWFQKIVSLMPHRPMSI  383

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
             GSPR   Y  DFG G+P K+E  SID + G + +  A++    IE+GV++P A M    
Sbjct  384  GGSPRYGVYDTDFGLGRPAKVELLSIDKTPGTVSMAEARDGHGGIEIGVALPEADMARFS  443

Query  286  TLFEEGLQAL  257
            + F +GL+ L
Sbjct  444  SCFADGLKQL  453



>ref|NP_001048542.1| Os02g0820400 [Oryza sativa Japonica Group]
 dbj|BAD22976.1| putative anthocyanin acyltransferase [Oryza sativa Japonica Group]
 dbj|BAD23105.1| putative anthocyanin acyltransferase [Oryza sativa Japonica Group]
 dbj|BAF10456.1| Os02g0820400 [Oryza sativa Japonica Group]
 gb|EAZ25107.1| hypothetical protein OsJ_08902 [Oryza sativa Japonica Group]
 dbj|BAG87474.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 97/190 (51%), Gaps = 11/190 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY WTCL R     +   R       + L + +CR RL  P+P  Y GNCL P
Sbjct  272  SAFTVACAYAWTCLARVDATSAARER------AHLLFSVECRRRLTPPVPQEYLGNCLRP  325

Query  637  CIVRAK-AGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V    AG L +       A     A  R L+  +GVL GA+ W     ++   R +S+
Sbjct  326  CFVEVDTAGLLGSGADGVVTAAVAIGAAIRGLD--DGVLDGADGWFQKIVSLMPHRPMSI  383

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
             GSPR   Y  DFG G+P K+E  SID + G + +  A++    IE+GV++P A M    
Sbjct  384  GGSPRYGVYDTDFGLGRPAKVELLSIDKTPGTVSMAEARDGHGGIEIGVALPEADMARFS  443

Query  286  TLFEEGLQAL  257
            + F +GL+ L
Sbjct  444  SCFADGLKQL  453



>ref|XP_010102963.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXB94481.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=477

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 111/195 (57%), Gaps = 20/195 (10%)
 Frame = -3

Query  808  VVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVPCIV  629
            +VTCA +W CL +S+   S +N D+DD+  YF   A+CR+RL+ PLP  YFGNC+  C  
Sbjct  293  IVTCALIWVCLAKSEERNSALNTDKDDEPYYFAFVAECRSRLEFPLPTTYFGNCMKICFA  352

Query  628  RAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI-------  470
              K  +L  E G+ AAA+AIG+ +    E  E  L+  E+W      + F++I       
Sbjct  353  PVKRKELLRENGIVAAAKAIGKEVG---ELNEESLKKFENW-----MMKFKKIKELGWQH  404

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK---ESLDIEVGVSVPAAKM  299
            ++V GSP+L  Y+ DFGWG+PKK ET  + +S A  +  A+   E   +EVG+++   ++
Sbjct  405  VTVTGSPKLGVYEADFGWGRPKKSET--VHFSDATTISLAESRDEKSGVEVGLALNKDRL  462

Query  298  HLLKTLFEEGLQALS  254
                 + EE L  L+
Sbjct  463  SRFGAILEETLTHLA  477



>ref|XP_008779727.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Phoenix dactylifera]
Length=448

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 104/190 (55%), Gaps = 13/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VV  AY+W C ++ +   S       D   Y     DCR RL  PLPA+YFGNC+ P
Sbjct  269  STIVVAFAYVWVCFVKMRGLAS-------DRKAYSGFPVDCRGRLQPPLPASYFGNCVGP  321

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLE-CEEGVLRGAEDWNSFFGTVSFERILSV  461
            C V    G +  EEG  AAAEAIG    + +E  + G+L GAE W   F +V  E+ ++V
Sbjct  322  CFVEVAVGDVIGEEGFVAAAEAIG----KAIEGLKHGILDGAEIWLRRFVSVLPEQPMTV  377

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKT  284
            AGSP+   Y+ DFGWG PKK+  TSI   G I V  ++ E   IE+G+ +P   M     
Sbjct  378  AGSPKFRVYETDFGWGGPKKVLVTSISGPGNISVAESRAEQGGIEIGMVLPKHVMDEFSA  437

Query  283  LFEEGLQALS  254
             F  GL+ ++
Sbjct  438  HFFNGLKLIA  447



>gb|AGT37413.1| anthocyanin 5-aromatic acyltransferase [Vaccinium dunalianum]
Length=433

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 104/172 (60%), Gaps = 12/172 (7%)
 Frame = -3

Query  835  QVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYF  656
            + A  PS+F +T AY W CL+++        R    + V+   A DCRARL+ P+P++YF
Sbjct  273  KAAFSPSTFAITSAYTWVCLVKT--------RKLMTEKVHLGIAVDCRARLEPPIPSSYF  324

Query  655  GNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE  476
            GNC+    + A   ++  E+GVA AA AIGEAI      ++GVL+GAE+    F +    
Sbjct  325  GNCVTARFIDADTNKVMEEDGVAIAARAIGEAIGG---LDDGVLKGAEELMPNFSSRQGV  381

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVG  323
             + SVAGSPR ++YK DFGWG+P K+E  SI  SGA Y+   K+ +  +E+G
Sbjct  382  GLFSVAGSPRFEFYKTDFGWGRPSKVEMVSISKSGAFYLSDPKDGNGGVEIG  433



>gb|EYU24857.1| hypothetical protein MIMGU_mgv1a019718mg, partial [Erythranthe 
guttata]
Length=196

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 111/198 (56%), Gaps = 16/198 (8%)
 Frame = -3

Query  841  AGQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV--YFLCAADCRARLDTPLP  668
             G  +    S   TC   + CL++S+       R++ D  V  YF+ + D RAR++ P+P
Sbjct  7    VGSTSDSHESTFTTC-LRYACLVKSE-------REKVDKEVMEYFVFSVDVRARMNPPVP  58

Query  667  ANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT  488
             NYFGNCL   + R +   L  EEG   A EAI E +  ++  ++ VL+GAE+W S    
Sbjct  59   FNYFGNCLGYGMARIERKWLVEEEGFVTAVEAIVEDVKNRVNNKDEVLKGAENWLSEMKE  118

Query  487  VSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSID---YSGAIYVGCAKESLDIEVGVS  317
            +   R+L VAGSP+ D +  DFGWG+ KK+E+ SID   YS ++Y         +EVG+S
Sbjct  119  LGEIRVLGVAGSPKFDLHDADFGWGRAKKVESLSIDVDKYSMSLYKSVEG---GLEVGLS  175

Query  316  VPAAKMHLLKTLFEEGLQ  263
            +P  +M     +F++GL+
Sbjct  176  LPKERMIAFGAIFDDGLR  193



>gb|EPS62076.1| hypothetical protein M569_12721 [Genlisea aurea]
Length=453

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 111/197 (56%), Gaps = 9/197 (5%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDD----DTVYFLCAADCRARLD  680
            +A+ P     SSFVV+ AY+W+CL +S      ++ + ++    +  YFL A DCR+RLD
Sbjct  252  IAKNPNFSHLSSFVVSIAYIWSCLAKSDVHHGDLSYEPEEVPGGEKDYFLFAVDCRSRLD  311

Query  679  TPLPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS  500
             PLP NYFGNC+   +      +L  +EG  AAAE+I E I  ++  +E ++  AE+W +
Sbjct  312  PPLPENYFGNCVSYGLAAVPHEELVGDEGFFAAAESIAEQIKNKVNDKERIVTDAENWAA  371

Query  499  FFGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGV  320
                +  +R  SV+GS ++D Y +DFG+G  +K+E  +ID        C      +E GV
Sbjct  372  ELLPLLGKRFYSVSGSAKVDVYGLDFGFGSLRKLEMLAIDGEKYSISLCKSSGGGLEFGV  431

Query  319  SVPAAKMHLLKTLFEEG  269
            S+P AK+    ++F  G
Sbjct  432  SLPPAKLSTFSSIFTTG  448



>emb|CAN64565.1| hypothetical protein VITISV_044304 [Vitis vinifera]
Length=433

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 99/186 (53%), Gaps = 28/186 (15%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W C+ +++   SG +  E++   +     DCRA  D P+PANYF N +  
Sbjct  272  SSFTVACAYVWACMAKARA-KSGEHVGENEPE-HLAFVGDCRAYFDPPIPANYFANTI--  327

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                 KA Q                    +L  +EG+L+G E W S + +++ +RI  VA
Sbjct  328  ----GKAIQ-------------------ERLRNKEGILKGLEKWMSNYKSLNPKRIFGVA  364

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSP+   Y +DFG G+P K E  SID + +I +   + +  D+E+G+S P  KM +  ++
Sbjct  365  GSPKFSCYDIDFGLGRPCKGEIISIDVTKSISLNEGRNNKEDVEIGLSFPKIKMDVFTSI  424

Query  280  FEEGLQ  263
            F  GL+
Sbjct  425  FVNGLK  430



>ref|XP_010263233.1| PREDICTED: agmatine coumaroyltransferase-like [Nelumbo nucifera]
Length=452

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 116/197 (59%), Gaps = 19/197 (10%)
 Frame = -3

Query  835  QVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYF  656
            + A+  + + + CAY+W CL++++    G +R +     +F+ +A CR RLD P+P  YF
Sbjct  268  KYAKHTTRYALACAYVWICLVKAE----GASRRK----AHFVFSAGCRTRLDPPVPMTYF  319

Query  655  GNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRG-AEDWNSFFGTVSF  479
            GNC+   +V     QL  E+G+A A EAI + +    + + GVLR  AE  ++       
Sbjct  320  GNCIRANLVTMDMSQLLGEDGMAVAVEAIDKTVK---QLDNGVLRDLAETDSAITAAARS  376

Query  478  ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVP  311
            ER++SV+ SP+L  Y +DFGWGKP+K+E  S+  SGA  +    ES D    +EVG+++ 
Sbjct  377  ERLVSVSWSPKLSVYDIDFGWGKPRKVEIASVWKSGAFSM---VESRDGDGGVEVGLALG  433

Query  310  AAKMHLLKTLFEEGLQA  260
              +MH+  +LF  GL+A
Sbjct  434  RKQMHVFASLFVSGLEA  450



>ref|XP_006447403.1| hypothetical protein CICLE_v10015168mg [Citrus clementina]
 ref|XP_006469822.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Citrus sinensis]
 gb|ESR60643.1| hypothetical protein CICLE_v10015168mg [Citrus clementina]
Length=463

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 106/189 (56%), Gaps = 11/189 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVY-FLCAADCRARLDTPLPANYFGNCLV  641
            S+FVVT A MW  ++  Q   S I    D D +Y F+  ADCR R + P+PA+YFGNCL 
Sbjct  278  STFVVTSALMWVYMIELQESESEIT---DGDMIYHFVPVADCRERFEFPIPASYFGNCLA  334

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFG-TVSFERIL  467
               + AK  +L  +EGV  AA+AIG    R++ E E+G L GAE W S     V   R+L
Sbjct  335  FLFISAKRSELMGKEGVVFAAKAIG----RKIGELEKGALVGAEKWTSNLNEVVKTGRVL  390

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLL  290
            +V GSP+   Y+ DFGWG+PKK E       G+  +  ++ E   IE+G+ +   K+ L 
Sbjct  391  AVGGSPKFGVYETDFGWGRPKKFELVHFGAYGSFSLAESRDEEGAIEIGLVIGRDKLDLF  450

Query  289  KTLFEEGLQ  263
              +F+  L 
Sbjct  451  NVVFQRRLN  459



>ref|XP_004304224.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 95/159 (60%), Gaps = 11/159 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAYMW CL+++Q    G++ ++     +   + DCRARLD P+PANYFGNC+  
Sbjct  288  STFTLVCAYMWVCLVKAQ----GVDAEKLTIQAF---SVDCRARLDPPIPANYFGNCVTG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT-VSFERILSV  461
                 KA +L  E+G+  A  AI EAI      E+GVL GAE W S     V  E + S 
Sbjct  341  AAGFVKAKELLGEDGLVVAVRAISEAIQ---GLEKGVLNGAEVWVSKMKDFVQAEGVYST  397

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE  344
            AGS R   Y+ DFGWG+PKK+E  SID +GAI +  +K 
Sbjct  398  AGSHRFQIYETDFGWGRPKKVEVVSIDRTGAISLSESKN  436



>gb|EYU24855.1| hypothetical protein MIMGU_mgv1a005957mg [Erythranthe guttata]
Length=463

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 114/202 (56%), Gaps = 12/202 (6%)
 Frame = -3

Query  841  AGQVARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDT-VYFLCAADCRARLD  680
            A  +A++P     SSFVVT +Y+WT LL+S    S  +R +D +   YF+ + D R R++
Sbjct  266  ASVLAKKPDLGHVSSFVVTASYIWTTLLKS----SADDRVQDQNIHEYFVFSVDIRERMN  321

Query  679  TPLPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS  500
              +P NYFGNCL   I   +  +L  EEG+A +AE + E I  ++  ++ VL+GAE+W  
Sbjct  322  PAVPTNYFGNCLCAGITEIEHERLVGEEGIAVSAEFMSELIRNRMNNKDEVLKGAENWMD  381

Query  499  FFGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEV  326
                  + R + V+GSP+ D    DFGWG  +K+E  SID        C     +  +E+
Sbjct  382  GSRNKVWARAVGVSGSPKFDLCSADFGWGNARKLEVVSIDGQRCSISLCKSNDSEGGLEI  441

Query  325  GVSVPAAKMHLLKTLFEEGLQA  260
            G+S+P  KM +   +F +GL++
Sbjct  442  GLSLPKEKMDVFAAVFGDGLKS  463



>gb|ACG40604.1| anthocyanin 5-aromatic acyltransferase [Zea mays]
Length=454

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 98/193 (51%), Gaps = 8/193 (4%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            A + SSFV   A  W CLL+  C   G+         + L +A+CR+RL  PLPA YFGN
Sbjct  265  AAKASSFVAASALAWVCLLK--CGSVGVAGARRS---HMLFSAECRSRLTPPLPAEYFGN  319

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL PC V A    L + E     A A         E E+GVL GAE W     +V  ER 
Sbjct  320  CLRPCFVEAATADLLSGETEDGVAAAASAIGSAIQEMEQGVLEGAEGWLGRVLSVLPERP  379

Query  469  LSVAGSPRLDYYK-MDFGWGKPKKIETTSIDYS-GAIYVGCAKES-LDIEVGVSVPAAKM  299
            +SV GSPR   Y+  DFGWG+P ++E  S++ + G + +  + E    IE+GV +P   M
Sbjct  380  MSVGGSPRHGVYETTDFGWGRPARVEMVSVEKTPGTVALADSPEGDGGIELGVVLPPDAM  439

Query  298  HLLKTLFEEGLQA  260
                + F   + A
Sbjct  440  DAFASCFAHAVGA  452



>ref|XP_011079049.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Sesamum indicum]
Length=483

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 104/193 (54%), Gaps = 8/193 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVY----FLCAADCRARLDTPLPANYFGN  650
            SSFVV  A++WTCL+RS                     FL A D RAR + PLP NYFGN
Sbjct  291  SSFVVMAAHIWTCLVRSLTAGEEERAAAAAAPADELETFLFAVDTRARSNPPLPGNYFGN  350

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL   +VR +   +   EG   AAEAI + I  ++   E     AE+W +  G+V   RI
Sbjct  351  CLSYGLVRIRHQDMVGNEGFFLAAEAIADVIKNRVNDVEKTYADAENWFTEVGSVVQSRI  410

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSID---YSGAIYVGCAKESLDIEVGVSVPAAKM  299
            L+V+GS R+D Y  DFGWGK +K+ET SID   YS ++    A E   +EVG+S+P   M
Sbjct  411  LAVSGSARVDLYSTDFGWGKVRKLETLSIDGENYSMSLCKAGASEG-GLEVGLSLPKVIM  469

Query  298  HLLKTLFEEGLQA  260
                  F +G++ 
Sbjct  470  AAFAAAFADGIKG  482



>ref|NP_001140601.1| uncharacterized protein LOC100272672 [Zea mays]
 gb|ACF84155.1| unknown [Zea mays]
Length=454

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 98/193 (51%), Gaps = 8/193 (4%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            A + SSFV   A  W CLL+  C   G+         + L +A+CR+RL  PLPA YFGN
Sbjct  265  AAKASSFVAASALAWVCLLK--CGSVGVAGARRS---HMLFSAECRSRLTPPLPAEYFGN  319

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL PC V A    L + E     A A         E E+GVL GAE W     +V  ER 
Sbjct  320  CLRPCFVEAATADLLSGETEDGVAAAASAIGSAIQEMEQGVLEGAEGWLGRVLSVLPERP  379

Query  469  LSVAGSPRLDYYK-MDFGWGKPKKIETTSIDYS-GAIYVGCAKES-LDIEVGVSVPAAKM  299
            +SV GSPR   Y+  DFGWG+P ++E  S++ + G + +  + E    IE+GV +P   M
Sbjct  380  MSVGGSPRHGVYETTDFGWGRPARVEMVSVEKTPGTVALADSPEGDGGIELGVVLPPDAM  439

Query  298  HLLKTLFEEGLQA  260
                + F   + A
Sbjct  440  DAFASCFAHAVGA  452



>ref|XP_008670029.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Zea mays]
 gb|AFW74629.1| anthocyanin 5-aromatic acyltransferase [Zea mays]
 tpg|DAA39585.1| TPA: anthocyanin 5-aromatic acyltransferase [Zea mays]
Length=454

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 98/193 (51%), Gaps = 8/193 (4%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            A + SSFV   A  W CLL+  C   G+         + L +A+CR+RL  PLPA YFGN
Sbjct  265  AAKASSFVAASALAWVCLLK--CGSVGVAGARRS---HMLFSAECRSRLTPPLPAEYFGN  319

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL PC V A    L + E     A A         E E+GVL GAE W     +V  ER 
Sbjct  320  CLRPCFVEAATADLLSGETEDGVAAAASAIGSAIQEMEQGVLEGAEGWLGRVLSVLPERP  379

Query  469  LSVAGSPRLDYYK-MDFGWGKPKKIETTSIDYS-GAIYVGCAKES-LDIEVGVSVPAAKM  299
            +SV GSPR   Y+  DFGWG+P ++E  S++ + G + +  + E    IE+GV +P   M
Sbjct  380  MSVGGSPRHGVYETTDFGWGRPARVEMVSVEKTPGTVALADSPEGDGGIELGVVLPPDAM  439

Query  298  HLLKTLFEEGLQA  260
                + F   + A
Sbjct  440  DAFASCFAHAVGA  452



>dbj|BAF49307.1| putative anthocyanin malonyltransferase [Clitoria ternatea]
Length=456

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 112/188 (60%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+    ++       ++R + +  V FL + DCR RL      NYFGNC+V 
Sbjct  279  SSFSVACAYLLASAVK-------VDRPKAN-RVGFLFSVDCRPRLGVANLENYFGNCVVT  330

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
              V AK  ++  ++G     E I EA++ ++E E GVL G E+W     ++  +R+ SVA
Sbjct  331  QAVVAKREEVLGDDGFIRGLEGISEALN-EME-ERGVLNGMENWMEKIQSLMEDRLFSVA  388

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKTL  281
            GSPR + Y++DFGWG+P K++ TSID +GA  +  +K  S  IEVG+++   +M +  T+
Sbjct  389  GSPRFEVYEVDFGWGRPVKVDVTSIDKTGAFSLSESKNHSGGIEVGLALNKEQMEVFATV  448

Query  280  FEEGLQAL  257
            F +GL +L
Sbjct  449  FAQGLDSL  456



>gb|KJB79463.1| hypothetical protein B456_013G051200 [Gossypium raimondii]
Length=470

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 108/191 (57%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQ-CFPSGINRDEDDDTVYFLCAA-DCRARLDTPLPANYFGNCL  644
            S+FVVTCA  W  L++S+ C    ++  +D D +Y+L    DCR RL+ P+P+ YFGNCL
Sbjct  283  STFVVTCALTWASLIKSKACVVKNLSYVDDADELYYLLFPFDCRNRLEFPVPSTYFGNCL  342

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-RIL  467
             P IV  K  +L  E G+  AA+AIG  +    E  +  +  AE+W       S   R++
Sbjct  343  KPGIVEMKKKELTGENGIVLAAKAIGSKVK---EMGQSGISEAENWLPSIAERSKTGRLI  399

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLL  290
            S+AGSP+L  Y  +FGWGKP+K+E   ++    I +  C  E   IEVGV++   +M   
Sbjct  400  SLAGSPKLRVYDTNFGWGKPRKVEVMHVESGQTISMAECRDEEGGIEVGVALKKNQMDEF  459

Query  289  KTLFEEGLQAL  257
              +F + L+ L
Sbjct  460  VAIFGQSLKLL  470



>gb|KCW47095.1| hypothetical protein EUGRSUZ_K00901 [Eucalyptus grandis]
Length=463

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 103/193 (53%), Gaps = 8/193 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-----QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+FVVTCA++W C+++S     QC     +   +D+  YF+  ADCR RL   +P  YFG
Sbjct  270  STFVVTCAFIWVCIIKSKDKENQCHDQSSSESGNDEFCYFVFVADCRDRLGYSIPLTYFG  329

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFER  473
            NCL  C +  K   L  + G+  AA AIG           G LRG E W       + E 
Sbjct  330  NCLDICFISEKRSSLLGKSGLPLAARAIGRKAKEV--GTGGALRGVERWIKDLKIANDEG  387

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMH  296
            +++VAGSPR   Y  +FGWG+ +K     ID S AI +  +K+    +EVG+++    M 
Sbjct  388  LVTVAGSPRQKVYDTNFGWGRLRKSHMVHIDVSRAISLAESKDGDGGVEVGLALTRVCMD  447

Query  295  LLKTLFEEGLQAL  257
               +LFE+GL++ 
Sbjct  448  HFISLFEKGLKSF  460



>ref|XP_008379864.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
 ref|XP_008357917.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=463

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 109/189 (58%), Gaps = 15/189 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL++ +   +G++       ++F  + DCR+R D PLPANYFGNCL  
Sbjct  284  STFSLICAYAWVCLVKVEEMKAGVS------LMFF--SVDCRSRFDPPLPANYFGNCLTG  335

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS--FFGTVSFERI-L  467
                A   +L  E+G+  A  AI EAI      +EGVL+GAE+  S  + G  S +R   
Sbjct  336  RNAIAVTKELLGEDGLVVAVSAISEAIK---SLDEGVLKGAENRVSSLYSGVRSKDRTKF  392

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHLL  290
            SVAGS R   Y  DFGWG+P+K +  SID +GAI +  +K     +E+G+ +    M + 
Sbjct  393  SVAGSHRFKIYDTDFGWGRPRKTDVVSIDRTGAISLADSKNGGGGVEIGLVLKKHHMDVF  452

Query  289  KTLFEEGLQ  263
             +LF +GL+
Sbjct  453  ASLFAKGLE  461



>ref|XP_006361075.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=456

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 111/197 (56%), Gaps = 12/197 (6%)
 Frame = -3

Query  826  RQPS-----SFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPAN  662
            R+PS     S+ VTC Y W+CL++S+     I+ +  +   YF C+ + RAR D PLP++
Sbjct  265  RRPSLTHVTSYTVTCGYAWSCLVKSEDATEIIDENVME---YFGCSVNYRARFDPPLPSS  321

Query  661  YFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTV  485
            YFGNC++  I  AK   L   EG   A E+IGE I+++   +E +L G  DW        
Sbjct  322  YFGNCIIWYIASAKHIDLVGNEGFTIATESIGEIIYKRNNDKEYMLNG--DWLKEVDAAA  379

Query  484  SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPA  308
            +  R +S+AGSP+ D Y+ DFGWGKPKK           + +  +K+S  D+E+ +S+P 
Sbjct  380  NTGRYVSIAGSPKYDLYEADFGWGKPKKWHFVFSGSGLVMSLSKSKDSYGDLEISLSLPK  439

Query  307  AKMHLLKTLFEEGLQAL  257
             +M+    +F +GL  L
Sbjct  440  TRMNAFAAIFADGLSVL  456



>ref|XP_007033865.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY04791.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=465

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 108/200 (54%), Gaps = 13/200 (7%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCA----ADCRARLDTPL  671
            G    + S+FVVTCAYMW CL+  Q   SG +     D+   LC     ADCR RL   L
Sbjct  272  GSETLRTSTFVVTCAYMWVCLV--QLRESGTHDLSSTDSYNMLCHFIFLADCRDRLK--L  327

Query  670  PANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFG  491
            PA YFGNCL P    AK  +L   +G+  AA+AIG      +E E+G LR AE W S   
Sbjct  328  PATYFGNCLEPRFAAAKKSELLGGKGILLAAKAIG---REVMELEKGALREAEKWLSRAE  384

Query  490  TV-SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVS  317
             +  F R + +A SP+L  Y+ DFGWG+P K E   I   G+I +  ++E    +E G++
Sbjct  385  EIFKFGRHVCIAASPKLRVYETDFGWGRPIKTEVAHIGSFGSISMAESREEEGGVEFGLA  444

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +   ++     +FE+GL  L
Sbjct  445  LAQDELDSFNAVFEQGLLKL  464



>ref|XP_004507302.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Cicer arietinum]
Length=503

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 111/190 (58%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAYM +CL +++            D V F+ + DCR RLD P+   YFGNC+  
Sbjct  325  STFSVTCAYMLSCLAKAE--------QPKVDKVIFIFSVDCRTRLDPPISPMYFGNCIAG  376

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFERILS  464
              +  +   L  + G   A E I E++ R  + E  VL GA++W S+   G+ S  +I S
Sbjct  377  QKIVLETKDLVGKNGFFVALEGINESLKRVKDGE--VLNGAKNWLSYILEGSES-TKIYS  433

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLK  287
            +AGSPR + Y +DFG+GKPKK++ TSID +GA  +     ++  IE+G+++   ++    
Sbjct  434  IAGSPRFEVYGIDFGFGKPKKVDMTSIDKTGAFSLSERNDDNGGIEIGLALSNQQIQDFS  493

Query  286  TLFEEGLQAL  257
            TLF +GL+++
Sbjct  494  TLFVQGLESI  503



>gb|EYU24852.1| hypothetical protein MIMGU_mgv1a006230mg [Erythranthe guttata]
Length=452

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 113/200 (57%), Gaps = 12/200 (6%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVY--FLCAADCRARLDTP  674
            +A++P     SSFVVT +Y+WT L++S      +  +E+D ++   F+ A D R R++  
Sbjct  256  LAKKPGLGHVSSFVVTASYVWTTLVKSA---DHVEEEEEDQSMVECFIFAVDIRERVNPA  312

Query  673  LPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF  494
            +P NYFGNCL   I   + G+L  EEG++ AAE + E I  ++  ++ VLRG E+W    
Sbjct  313  VPTNYFGNCLGAGIAEIEHGKLVGEEGLSVAAEYMAEDIKNRINNKDEVLRGVENWMDGS  372

Query  493  GTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGV  320
             + ++ R + V+GSP+ D    DFGWG+ +K+E  SID        C     +  +E+G+
Sbjct  373  KSHTWARAVGVSGSPKFDLCDADFGWGRARKLEVVSIDGERCSISLCKSNDSEGGLEIGL  432

Query  319  SVPAAKMHLLKTLFEEGLQA  260
            S+P  +M      F  GL++
Sbjct  433  SMPKERMDAFAAAFANGLKS  452



>gb|KEH25130.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=460

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 108/188 (57%), Gaps = 11/188 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F+VT AY+  CL+++Q            + V F+ A DCR+RLD  +   Y GNC+  
Sbjct  283  STFLVTSAYVLACLVKAQ--------QPKVEKVIFIFAIDCRSRLDPSISTMYIGNCIAG  334

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
              +  +   L  + G   A E I +A++   +   GVL GAE+W S   +    +I S+A
Sbjct  335  KKIVFETKNLVGKNGFVNALEGINKALNSVKDV--GVLNGAENWVSNMSSGMEGKIYSIA  392

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKTL  281
            GSPR ++Y +DFG+GKPKK++ TS D SGA  +  ++ +   IE+G+++   +M    TL
Sbjct  393  GSPRFEFYSIDFGFGKPKKVDMTSTDKSGAFSLSESRNNNGGIEIGLALSKEEMEAFSTL  452

Query  280  FEEGLQAL  257
            F +GL+++
Sbjct  453  FVQGLESI  460



>ref|XP_010035654.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Eucalyptus grandis]
 gb|KCW47097.1| hypothetical protein EUGRSUZ_K00903 [Eucalyptus grandis]
Length=488

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 102/197 (52%), Gaps = 16/197 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-----QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+FVVTCA++W C+++S     QC         +D+  +F+  ADCR RL   +P  YFG
Sbjct  295  STFVVTCAFIWVCIVKSRDEEHQCHDQSSPERGNDEFCHFVFVADCRDRLKYSIPLTYFG  354

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCLV C +  K   L  + G+  A   IG    R  E   G  LRG E W   F  +   
Sbjct  355  NCLVACYLSEKRNTLLGKSGILHATRTIG---RRVKEIGTGGALRGMEGWIRNFNMIKGG  411

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPA  308
             ++SVAGSPR   Y  DF WG+ +K     ID S +I +    ES D    +EVG+++  
Sbjct  412  DVVSVAGSPRHKVYDTDFAWGRLRKSHVVHIDASRSISL---TESRDGDGGVEVGLALTT  468

Query  307  AKMHLLKTLFEEGLQAL  257
              M    +LFE+GL++ 
Sbjct  469  VCMEKFISLFEKGLKSF  485



>sp|Q8W1W9.1|5MAT1_SALSN RecName: Full=Malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; 
Short=Malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; 
Short=Ss5MaT1 [Salvia splendens]
 gb|AAL50566.1|AF405707_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Salvia splendens]
Length=462

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 8/180 (4%)
 Frame = -3

Query  787  WTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVPCIVRAKAGQL  608
            W+C+++S       ++ +++    F+  AD R R+D P+P NYFGNC+V  + + + G+L
Sbjct  276  WSCMVKSG------DKSDENAPELFIIPADARGRVDPPIPENYFGNCIVSSVAQVERGKL  329

Query  607  aaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVAGSPRLDYYKM  428
            AAE+G A AAEAIG  I  +L+  + +LRGAE+W S         +L V+GSP+ D  K 
Sbjct  330  AAEDGFAVAAEAIGGEIEGKLKNRDEILRGAENWMSDIFKCFGMSVLGVSGSPKFDLLKA  389

Query  427  DFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKTLFEEGLQALS  254
            DFGWGK +K+E  SID        C+    +  +EVG+S+P  +M   + +F   + A S
Sbjct  390  DFGWGKARKLEVLSIDGENHSMSLCSSSDFNGGLEVGLSLPRERMAAFEEVFRASIMAAS  449



>ref|XP_008365521.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=474

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 103/191 (54%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S++++TCAY W CL+R++   +        + V F+   DCR+RLD PLP  YFGNC+  
Sbjct  289  STYMLTCAYTWVCLVRAEEIKT--------EKVVFILHVDCRSRLDPPLPPTYFGNCIAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTV---SFERI  470
              V AK   L  E+G+  A  AI E I      ++ +  GAE W S    T+   S +R 
Sbjct  341  HGVVAKTKDLQGEDGLLVALNAISEVIK---SLDKTLFEGAETWVSRILNTLLQPSTDRT  397

Query  469  LSVAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSVPAAKMH  296
            ++ AGSPR D+Y   DFGWG+P K E  SID +GAI Y         +EVG+ +    M 
Sbjct  398  ITTAGSPRFDFYDAADFGWGRPTKHEIVSIDGTGAISYQKSKNGDGAVEVGLVLEKRYME  457

Query  295  LLKTLFEEGLQ  263
                LF EGL+
Sbjct  458  AFAYLFAEGLE  468



>ref|XP_010102962.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXB94480.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=475

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 104/190 (55%), Gaps = 6/190 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SS+V TCA +W CL +S+   S    ++DD+  YF   A+CR+RL+ PLPA YFGNCL  
Sbjct  288  SSYVATCALIWACLAKSEAKNSTEKINKDDEPYYFAIVAECRSRLEFPLPATYFGNCLAV  347

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV--SFERILS  464
              V  K  +L  E G  AAA+AIG+ +    E  +  L+  E+W   +  +  S  + ++
Sbjct  348  SFVPVKRKELLGENGTVAAAKAIGKEVR---EMNKQALKELENWVMKYKKIEESHRQHVT  404

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSI-DYSGAIYVGCAKESLDIEVGVSVPAAKMHLLK  287
            V GSP+   Y++DFGWG+PKK E     D S    V    E   +EVG+++   +M    
Sbjct  405  VTGSPKFGLYEVDFGWGRPKKSEAVHFSDSSTFSLVESRDEKGGVEVGLTLSRDRMSRFS  464

Query  286  TLFEEGLQAL  257
             + E+ L  L
Sbjct  465  AILEKILSEL  474



>ref|XP_010246275.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=469

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 104/187 (56%), Gaps = 10/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARL-DTPLPANYFGNCLV  641
            S+FVVTCA  W CL+++        ++ +    +FL + DCR RL + P+PA YFGNC+ 
Sbjct  287  SAFVVTCAITWVCLIKAGVIVDSPGKEME----HFLFSVDCRDRLRNPPVPATYFGNCVA  342

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
                 AK   L  +  +  AA+ I +A+ R    E GVLR AE W S   +   E  ++V
Sbjct  343  LGFADAKKTDLEGDNAIVVAAKMIADAVKRM---EYGVLRDAERWISDLSSRLPEGFVTV  399

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKT  284
             GSP+   Y+MDFGWGKPKK E   +   G I +  +++    +EVG+++P AKM    T
Sbjct  400  TGSPKFGVYEMDFGWGKPKKFEMLRMG-EGQISLFDSRDGEGAVEVGLALPKAKMEAFTT  458

Query  283  LFEEGLQ  263
             F + L+
Sbjct  459  FFADYLK  465



>ref|XP_010111948.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXC32129.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=482

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 104/191 (54%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL +++          DD  + FL   DCR+RLD PLPA Y GNC+ P
Sbjct  286  SAFSLICAYTWFCLAKAEEI-------SDDKNLVFLV--DCRSRLDPPLPATYLGNCIAP  336

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW------NSFFGTVSFE  476
                 +   L  ++G  AA  AI EA+ + LE  + VL GAE+W      N         
Sbjct  337  RFAVLEREALLGKQGFVAAVNAISEAM-KGLE-NKSVLDGAENWVSVVVGNMHRSINKRR  394

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMH  296
            ++ SVA SPR   Y  DFGWG+P+K++  S+D +GA+ +  ++    +E+G+ +   +M 
Sbjct  395  KVYSVASSPRFKVYDTDFGWGRPRKVDVVSVDVTGAMSLLESRNDDGVEIGIVLKKHQME  454

Query  295  LLKTLFEEGLQ  263
               +LF +GL+
Sbjct  455  AFASLFAQGLE  465



>ref|XP_007033867.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY04793.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=467

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 104/193 (54%), Gaps = 12/193 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLR---SQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNC  647
            S+FVVT A+MW CL++   S   P    R+ DD    F   ADCR RL   LP NYFGNC
Sbjct  279  STFVVTTAFMWVCLVKLKQSNKTPDQGLRN-DDAICVFTFLADCRYRLR--LPTNYFGNC  335

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV--SFER  473
            L PC+  AK  +L  E G+  AA+AIG      LE E+  LRGA  W S    V    E 
Sbjct  336  LEPCVATAKRSELIGENGMVVAAKAIG---REILEFEKEPLRGAATWISSGKEVLRKCEH  392

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMH  296
             +++AGSP+L  Y+ DFGWG+P K E   +   G+I +   + E   +E GV +   +  
Sbjct  393  YITLAGSPKLRVYETDFGWGRPAKSEVVHLGSQGSIAIAESSDEESGVEFGVPLAPDEFD  452

Query  295  LLKTLFEEGLQAL  257
                +FE+GL  L
Sbjct  453  KFNAIFEQGLLNL  465



>ref|XP_011038069.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Populus 
euphratica]
Length=489

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 100/187 (53%), Gaps = 13/187 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+T +Y   CL++++   S       D+ + F  AADCRAR+D P+P NYFGNC+  
Sbjct  312  SSFVITLSYALVCLVKARGLKS-------DEKIKFGIAADCRARVDPPIPTNYFGNCVSL  364

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI-LSV  461
            C+       +  +  V  A +            E+  L GA++       +    I + V
Sbjct  365  CVAVLAGPAMQDDGIVFVAQKVSEVIKG----IEKAALEGAKEKVKKLMAIEPAAIPVGV  420

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLKT  284
            AGS R + Y +DFGWG+PK +E TSID +GAI +  +K ES  +E+G+ +    M + + 
Sbjct  421  AGSARFEVYGVDFGWGRPKNVEVTSIDRTGAISMAESKGESGGVEIGLVLKKEVMDIFEN  480

Query  283  LFEEGLQ  263
            LF  GL+
Sbjct  481  LFGSGLK  487



>ref|XP_009397892.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 112/194 (58%), Gaps = 11/194 (6%)
 Frame = -3

Query  835  QVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYF  656
            + + Q S + + C  +W  L+R++      NR ++    +F     CRAR + P+PANYF
Sbjct  259  KASAQTSPYALACGLVWAGLVRAR---GDTNRKKE----HFGFVTGCRARTNPPIPANYF  311

Query  655  GNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE  476
            GNCL  C V A+  +L  E+G AAAA+AI + I      EEG   GAE+W       + +
Sbjct  312  GNCLGICRVEAERSELVGEDGAAAAADAIWKVIK---SLEEGAFSGAENWIRDVHDYAAK  368

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKM  299
            + L+VAGSP+L  Y +DFGWG+P+K+E  SI+ +GA+ +  ++ E   IEVG+++P  +M
Sbjct  369  KALTVAGSPKLGIYDVDFGWGRPRKVELVSIERTGALSLTESRGEKGGIEVGLALPKHEM  428

Query  298  HLLKTLFEEGLQAL  257
                + F   L  L
Sbjct  429  DGFLSYFVSSLLNL  442



>ref|XP_010035650.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like isoform X1 [Eucalyptus grandis]
 gb|KCW47094.1| hypothetical protein EUGRSUZ_K00900 [Eucalyptus grandis]
Length=494

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 104/194 (54%), Gaps = 10/194 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-----QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+FVVTCA++W C+++S     QC     +   +D+  YF+  ADCR RL   +P  YFG
Sbjct  301  STFVVTCAFIWVCIIKSRDKEHQCQDQLSSESGNDEFCYFVFVADCRERLGYSIPLTYFG  360

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-VLRGAEDWNSFFGTVSFE  476
            NCL  C +  K   L  + G+  AA AIG    R  E   G  LRGA+ W   F   +  
Sbjct  361  NCLDICFISEKRSSLLGKSGLPLAARAIG---KRAKEVGTGGALRGAKRWIEDFKIANDA  417

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKM  299
             ++ VAGSPR   Y  +FGWG+ +K     ID S AI +  +K+    +EVG+++    M
Sbjct  418  DVVMVAGSPRQKVYDTNFGWGRLRKSHMVHIDVSRAISLAESKDGDGGVEVGLALTRVSM  477

Query  298  HLLKTLFEEGLQAL  257
                 LFE+GL++ 
Sbjct  478  DHFIPLFEKGLKSF  491



>gb|EYU26102.1| hypothetical protein MIMGU_mgv1a005739mg [Erythranthe guttata]
Length=472

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 108/194 (56%), Gaps = 11/194 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF V CAY+W+C ++S+    G   DE++  V F  AADCR RL  PLPA YFGNC+V 
Sbjct  278  SSFTVICAYIWSCSVKSEA-AVGEKTDENE-PVCFTTAADCRPRLVPPLPAAYFGNCVVF  335

Query  637  CIVRAKAGQLaaeegv--aaaaeaigeaIHRQLEC--EEGVLRGAEDWNSFFGTVSFERI  470
             I  +  G L          AAE+IG+A+   L+    +G+L  A DW   F     +R+
Sbjct  336  VIAESMHGLLLKGNNEGFLIAAESIGKAVRETLDTSDNDGILDSA-DWPVDFARFDGKRV  394

Query  469  LSVAGSPRLDYYKMDFGW-GKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKM  299
            +SVAGSPR D Y++DFGW G+ KK E   +D   ++ + C     D   E+G+S    +M
Sbjct  395  MSVAGSPRFDVYEVDFGWGGRAKKYEFAHLDTEKSMSL-CKSREFDGGFEIGLSRTKLEM  453

Query  298  HLLKTLFEEGLQAL  257
               +  F +GL+ +
Sbjct  454  DAFQAFFRQGLEII  467



>ref|XP_008363917.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=475

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 104/193 (54%), Gaps = 17/193 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL+R++        D   D V F    DCR RLD PLP  YFGNC+  
Sbjct  290  STFSLTCAYTWVCLVRAE--------DTKTDKVLFAINVDCRPRLDPPLPVTYFGNCVAA  341

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF----GTVSFERI  470
                A+   L  E+G+  A +AI E I      ++ +L GAE W S       +   +R+
Sbjct  342  HRAVAETKDLLGEDGLFVALKAISEVIK---SLDKTLLDGAETWVSRMLNTRQSSGTDRV  398

Query  469  LSVAGSPRLDYY-KMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMH  296
            + ++GS RLD+Y   DFGWG+PKK E  SID SGAI +  +K     +EVG+ +    M 
Sbjct  399  IPISGSHRLDFYGAADFGWGRPKKYEIVSIDGSGAISLQESKNGDGGVEVGLVLEKRCME  458

Query  295  LLKTLFEEGLQAL  257
               +LF  GL+ +
Sbjct  459  AFASLFANGLEDM  471



>ref|XP_008231010.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Prunus mume]
Length=349

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 97/191 (51%), Gaps = 34/191 (18%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY W CLL+++         + D         DCR R D P+PANYFGNC+  
Sbjct  185  STFSVTCAYTWVCLLKAE-------EKQTDKPDMMGFTLDCRPRFDPPIPANYFGNCIAG  237

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEG-----VLRGAEDWNSFFGTVSFER  473
             ++ A+                      + L  E+G     VL GAE+W S    VS E+
Sbjct  238  RVIVAE---------------------RKGLLGEDGLTVNWVLDGAENWVSRGLGVSSEK  276

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSVPAAKMH  296
            +L +AGS R   Y+ DFG G+PKK+E  SID + AI +     ++  ++VG+ +    M 
Sbjct  277  MLVLAGSHRFGVYESDFGRGRPKKVEIVSIDRARAISFSDPQTDAGVVDVGLVLDKHNMQ  336

Query  295  LLKTLFEEGLQ  263
            +  +LF +GLQ
Sbjct  337  VSASLFAKGLQ  347



>ref|XP_009629767.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
tomentosiformis]
Length=465

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 112/201 (56%), Gaps = 16/201 (8%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRS--QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPA  665
            G V    S +V+TC+Y+W C L++  Q     I + E     YF   A    RL  P+P 
Sbjct  273  GSVQLLLSPYVITCSYIWMCWLKANMQHIEDPIEKTELH---YFGFIAGGITRLGYPVPV  329

Query  664  NYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAE----DWNSF  497
             Y GNC+      A+  +L  E G+  AA+AIG+ I    E +  VL G E    DWN F
Sbjct  330  TYVGNCIAFGRAMARRNELLGENGIVFAAKAIGDTIK---ELDRNVLGGVENWISDWNVF  386

Query  496  FGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGV  320
             G+      ++V GSP++D Y +DFGWG+P+KIE  SID +G++ +  ++E +  IE+G+
Sbjct  387  RGS---GLHITVTGSPKVDLYTLDFGWGRPRKIEEISIDRTGSVSLCESREMVGGIEIGL  443

Query  319  SVPAAKMHLLKTLFEEGLQAL  257
            ++P AKM   + L+ EGL  L
Sbjct  444  ALPLAKMEAFRVLYNEGLNNL  464



>ref|XP_002459867.1| hypothetical protein SORBIDRAFT_02g012620 [Sorghum bicolor]
 gb|EER96388.1| hypothetical protein SORBIDRAFT_02g012620 [Sorghum bicolor]
Length=457

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 98/193 (51%), Gaps = 8/193 (4%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            A + SSFV   A  W CLL+  C  +G+   +     + L +A+CR+RL  PL A YFGN
Sbjct  268  AAKASSFVAASALAWVCLLK--CGSAGVAGAQRS---HMLFSAECRSRLTPPLQAEYFGN  322

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL PC V A    L + E     A A         E E+GVL GAE W     +V  ER 
Sbjct  323  CLRPCFVEAATADLLSGETADGVAAAAAAIGSAIREMEQGVLDGAEGWLGSVLSVLPERP  382

Query  469  LSVAGSPRLDYYKM-DFGWGKPKKIETTSIDYS-GAIYVGCAKES-LDIEVGVSVPAAKM  299
            +S  GSPR   Y+  DFGWG+P ++E  S++ + G + +  + E    IE+GV +P   M
Sbjct  383  MSAGGSPRHGVYETADFGWGRPARVEMVSVEKTPGTVALAESPEGDGGIELGVVLPPDAM  442

Query  298  HLLKTLFEEGLQA  260
                + F   L A
Sbjct  443  DAFASCFAHALGA  455



>ref|XP_011467880.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 107/196 (55%), Gaps = 9/196 (5%)
 Frame = -3

Query  838  GQVARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANY  659
            G  +   SSF +TC Y W CL++++        +   D V  + + DCR+RLD P+ A Y
Sbjct  267  GSDSAHLSSFSLTCGYTWACLVKAE------EEEIKSDQVRIVFSVDCRSRLDPPVSAAY  320

Query  658  FGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS-  482
            FGNC+V  +  A+   L  E+G+  A +AI E I + L+   G+L GAE W S   +   
Sbjct  321  FGNCIVGHLAVAETKGLLGEDGLVVAVKAISETI-KALDVSGGLLNGAETWVSKMCSAKG  379

Query  481  FERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAA  305
             +R+ SVAGS   + Y  +FGWG+PK+ E  SID +GAI    ++     +EVG+ +   
Sbjct  380  TDRLYSVAGSRIFEIYDTNFGWGRPKRTEVVSIDMTGAISFSDSRNGGRGVEVGLVLNEP  439

Query  304  KMHLLKTLFEEGLQAL  257
             M +  +LF + L  L
Sbjct  440  NMQVFASLFAKSLADL  455



>gb|KHN36596.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=322

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 105/192 (55%), Gaps = 8/192 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVVTC+ +W C++R +         +  +  + +  ADCR R +  LP+ YFGNCL  
Sbjct  133  STFVVTCSLIWVCMIRLEESKGNYVAQDYAEFCHLVFLADCRGRPEFSLPSTYFGNCLTT  192

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFGTVSF--ERIL  467
            C V  K  ++  E G+   A+AI     RQ+ + +   LR AE   S++  +    + +L
Sbjct  193  CFVAMKRSEIVGENGIIGVAKAI----ERQIRDLKSDALRNAERLMSYYRELGKPGKSVL  248

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLL  290
             VAGSP+L  Y  DFGWGKPKK E   I+ SG+I +  C  E+  IEVG+++   + +  
Sbjct  249  VVAGSPKLGVYHTDFGWGKPKKSEAAHIESSGSISLSDCRDENGGIEVGLALERIQTNNF  308

Query  289  KTLFEEGLQALS  254
              + EE L  ++
Sbjct  309  FNILEEQLNNIN  320



>ref|XP_004306064.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 11/186 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F + CAY W CL++++       + E+  T   +   D R+RLD P+P  YFGNC+  
Sbjct  290  STFSLGCAYTWICLVKAEEI-----KGENSKTA-MIFGVDVRSRLDPPVPETYFGNCIAG  343

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS-FERILSV  461
             +  A+   L  E+G+A A +AI EA+ R L+  +GVL GAE W S F   S +++I S+
Sbjct  344  RVAVAETKGLIGEDGLAVAVKAITEAL-RSLD--DGVLNGAELWVSKFLDFSLYDKIYSI  400

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMHLLKT  284
            AGS R + Y  DFGWG+PKK E  SID + A+ +  +K     +EVG+++   +M +  +
Sbjct  401  AGSQRFEIYGTDFGWGRPKKFELVSIDKTDAVSLMDSKHGGGAVEVGLALKKPQMEVFAS  460

Query  283  LFEEGL  266
            LF  GL
Sbjct  461  LFARGL  466



>dbj|BAF93857.1| anthocyanin acyltransferase [Torenia hybrid cultivar]
Length=479

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 117/232 (50%), Gaps = 19/232 (8%)
 Frame = -3

Query  913  PARHVPRlslhkttskn*klt*sHAGQV-ARQP-----SSFVVTCAYMWTCLLRSQC-FP  755
            PA+H+P   +  T +           ++ +++P     SSF +  AY WTCL +S     
Sbjct  254  PAKHLPTNKVRATYTLRKNDIERLKTRIRSKKPGTTCLSSFTIATAYAWTCLAKSAAEAE  313

Query  754  SGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVPCIVRAK----AGQLaaeegva  587
              + +D DD+  + L   D R R+D PLP +YFGNC++P   +       G+L     V 
Sbjct  314  EQVVQDSDDE--HLLMPVDLRPRIDPPLPPSYFGNCVLPSFAKTTHGLLKGELGLFNAVE  371

Query  586  aaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVAGSPRLDYYKMDFGWGKP  407
              ++ I   + ++ +  + + R  E + + FG    +R+L++ GSP+ D Y++DFGWGKP
Sbjct  372  VISDVITGIVSKKYDLFKDLDRQGEIFRALFG----KRVLAIMGSPKFDLYEVDFGWGKP  427

Query  406  KKIETTSIDYS-GAIYVGCAKE-SLDIEVGVSVPAAKMHLLKTLFEEGLQAL  257
            KKIE  SID     +++  + E    +E+G S    KM      F  GL+ +
Sbjct  428  KKIEPVSIDRERTTMWISKSGEFEGGLEIGFSFNKKKMDAFGECFNSGLKDI  479



>ref|XP_003621460.1| Isoflavonoid malonyl transferase [Medicago truncatula]
Length=299

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 100/187 (53%), Gaps = 10/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TCAY   CL ++     G+ ++++     F    DCRARL+ PLP NYFGNC+  
Sbjct  117  SSFVLTCAYSLVCLAKAI---HGVEKEKE--KFGFAFTVDCRARLEPPLPNNYFGNCVWG  171

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI--LS  464
             +V  K   L           A       ++  E+GVL G  D    F +++ E++  + 
Sbjct  172  HLVDTKP--LDYINEDGVFLVAKCIHEKIKMINEKGVLDGVSDMFDKFASLASEKLEMMG  229

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            VAGS R   Y++DFGWG+P K+E  S D    I +  +K+    IEVG+ +    M+L +
Sbjct  230  VAGSNRFGVYEIDFGWGRPTKVEIVSADRGLTIALAESKDGKGGIEVGLVLNNHVMNLFR  289

Query  286  TLFEEGL  266
            TLF EGL
Sbjct  290  TLFVEGL  296



>ref|XP_011025419.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Populus 
euphratica]
Length=471

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 109/195 (56%), Gaps = 14/195 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINR---DEDDDTVYFLCAADCRARLDTPLPANYFGNC  647
            S +V+ CA++W CL++++    G  +      +D +Y    A    R+D P+P  YFGNC
Sbjct  282  SPYVLACAFLWVCLVKAKIQRGGSEKHCYSRGEDPIYLGFIAGGMTRIDFPVPTTYFGNC  341

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAE----DWNSFFGTVSF  479
            +      A   +L  E+G+  AA  IG  I R    ++ +  GAE    +W++  G+V  
Sbjct  342  VGFGRSTATRNELMGEDGIIVAANVIGNTIRR---LDKAMFGGAEKWIAEWDAMLGSVIH  398

Query  478  ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSVPAAK  302
               + V+GSP+L+ Y+ DFGWG+PKKIE TSID   AI  +    E   IEVG+++P  +
Sbjct  399  ---VIVSGSPKLNLYETDFGWGRPKKIEDTSIDKMRAISLIESRDEKGGIEVGLALPPVQ  455

Query  301  MHLLKTLFEEGLQAL  257
            M   KTLF + L+AL
Sbjct  456  MEAFKTLFIQELEAL  470



>ref|XP_008342065.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=474

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 105/190 (55%), Gaps = 16/190 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL+R++        +   + V+F+   DCR+RLD PLP  YFGNC+  
Sbjct  289  STFSLTCAYTWVCLVRAE--------ETKTERVFFIIPVDCRSRLDPPLPPTYFGNCIAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTV--SFERIL  467
                A+   L  E+G+  A +AI + I      ++ +L GAE W S  F T+  S +RI+
Sbjct  341  HRAVAETNDLLGEDGMFVALKAISDVIK---SLDKTLLEGAETWVSRMFNTLQPSADRII  397

Query  466  SVAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHL  293
              AGSPR ++Y   DFGWG+P K E  SID +G +    +K     +EVG+ +    M  
Sbjct  398  PAAGSPRFEFYDAADFGWGRPTKHEVVSIDRTGTMSXQESKNGDGGVEVGLVLKKHYMEX  457

Query  292  LKTLFEEGLQ  263
              +LF + L+
Sbjct  458  FASLFAKDLE  467



>ref|XP_008353552.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=474

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 105/190 (55%), Gaps = 16/190 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL+R++        +   + V+F+   DCR+RLD PLP  YFGNC+  
Sbjct  289  STFSLTCAYTWVCLVRAE--------ETKTERVFFIIPVDCRSRLDPPLPPTYFGNCIAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTV--SFERIL  467
                A+   L  E+G+  A +AI + I      ++ +L GAE W S  F T+  S +RI+
Sbjct  341  HRAVAETNDLLGEDGMFVALKAISDVIK---SLDKTLLEGAETWVSRMFNTLQPSADRII  397

Query  466  SVAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHL  293
              AGSPR ++Y   DFGWG+P K E  SID +G +    +K     +EVG+ +    M  
Sbjct  398  PAAGSPRFEFYDAADFGWGRPTKHEVVSIDRTGTMSXQESKNGDGGVEVGLVLKKHYMEX  457

Query  292  LKTLFEEGLQ  263
              +LF + L+
Sbjct  458  FASLFAKDLE  467



>ref|XP_009391749.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 107/187 (57%), Gaps = 11/187 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VVTCA++W CLL++         D  D+T +F   AD R RL +P+P  YFGNC+VP
Sbjct  266  STVVVTCAHVWVCLLKTLG-------DAGDETAHFTFTADARDRLRSPVPETYFGNCIVP  318

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  K   L  E+G+ AA+EAIG+AI    + + G L+G       +  V+ +  +++ 
Sbjct  319  CFVEVKVSDLVGEDGIFAASEAIGKAIE---DLKHGALKGVHGMCERWYHVTQKLPMTLT  375

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLKTLF  278
            GSP+   Y  DFGWG+P K+ET  +  + A+Y+  ++    +E+G+S    +M   +  F
Sbjct  376  GSPKFKVYDTDFGWGRPVKVETV-LQKTRAMYLQDSRSGDGVEIGLSFEQHQMDAFERHF  434

Query  277  EEGLQAL  257
              GL+ L
Sbjct  435  LSGLKLL  441



>ref|XP_006485702.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Citrus 
sinensis]
Length=483

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 108/200 (54%), Gaps = 24/200 (12%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRD-EDDDTVYFLCAADCRARLDTPLPANYFG  653
            A+  SSFV+TCA+++  L+++        RD E + TV F+   DCR+RLD P+PANYFG
Sbjct  299  AQYLSSFVITCAHVFVWLVKA--------RDVEANTTVRFVITTDCRSRLDPPIPANYFG  350

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGA------EDWNSFFG  491
            NC       AKA     E G A  A       H+  +  +G+ RGA      E  N    
Sbjct  351  NCTGGEFGEAKASGFMQENGFAFVA-------HKLSDLIKGIKRGAVLGSEDEFLNGMAK  403

Query  490  TVSFERI-LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVS  317
                +++ +SVAGS R D Y  DFGWG+P+K+E  SID +GAI +   ++     E+GV 
Sbjct  404  MREAQQLKISVAGSNRFDVYGSDFGWGRPEKVEVVSIDTTGAISLAETRDGCGGFEIGVV  463

Query  316  VPAAKMHLLKTLFEEGLQAL  257
            +   +M +  +LF + L+ L
Sbjct  464  LEKQQMEVFASLFVDALKDL  483



>ref|XP_003576889.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Brachypodium distachyon]
Length=457

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 80/150 (53%), Gaps = 7/150 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV----YFLCAADCRARLDTPLPANYFGN  650
            SSFV   A  W  LL+S+   S +   E++ T     + L +A+CR+RL  PLPA YFGN
Sbjct  273  SSFVAASALAWVSLLKSR---SSVPGAEEEGTAARSSHMLFSAECRSRLTPPLPAEYFGN  329

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI  470
            CL PC V A    L      A  A A         E E GVL GAE W     +V   R 
Sbjct  330  CLRPCFVEAPTEDLLLLPSSAGVAAAALAIGTAVREMERGVLEGAEGWLGKVMSVLPMRP  389

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSID  380
            +SVAGSPR   Y+ DFGWG+P ++E  SI+
Sbjct  390  VSVAGSPRYGVYETDFGWGEPVRVELVSIE  419



>ref|XP_006490135.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Citrus sinensis]
Length=295

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 111/194 (57%), Gaps = 20/194 (10%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FV+TCA+ + C +R++       R E + TV F    DCR RLD P+P NYFGNC+  
Sbjct  115  STFVLTCAHAYVCQIRAK-------RVEANTTVEFAVGGDCRGRLDPPVPTNYFGNCIGS  167

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGV-LRGAEDWNSFFGTVSFER----  473
             I  AKA  +  ++GVA  AE +       ++  +G  ++G+ED      T++  +    
Sbjct  168  VIAEAKASDMIRDDGVAVVAEKLS----EMIKVLKGNGVQGSED--KMVKTIAMLKEKGH  221

Query  472  -ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKM  299
             +L+ AGS R D Y  DFGWG+PKK+E  S+D +GAI +  +K+    +E+GV +   +M
Sbjct  222  VMLTAAGSNRFDDYGSDFGWGRPKKVEIVSVDRTGAISLAESKDGGGGVEIGVVLKKQQM  281

Query  298  HLLKTLFEEGLQAL  257
             +  +LF  GL+ L
Sbjct  282  EVFASLFVNGLEDL  295



>gb|KJB71711.1| hypothetical protein B456_011G138500 [Gossypium raimondii]
Length=457

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 107/192 (56%), Gaps = 13/192 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVVTCAYMW CL + Q   +       D  + F  +ADCR  L   LPA YFGNC+ P
Sbjct  273  STFVVTCAYMWVCLNKLQENETKHPSPSGDSHMVF--SADCRHHLK--LPATYFGNCIQP  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQ-LECEE-GVLRGAEDWNSFFGTVSFERI--  470
                AK  +L  E+GV  AA+AIG    RQ +E EE G LR AE W S    +    I  
Sbjct  329  RFATAKKAELVKEKGVIVAAKAIG----RQVMELEEVGALREAEKWLSKQKEILKPGIHF  384

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHL  293
            +S+A SP+   Y++DFGWG+P+K E   I   G+I +  ++E    +E G+++   ++H 
Sbjct  385  ISIAASPKFGVYEIDFGWGRPRKTEVAHIGSFGSISMAESREEEGGVEFGLALSQEELHS  444

Query  292  LKTLFEEGLQAL  257
               +F  GLQ L
Sbjct  445  FNDVFHRGLQQL  456



>gb|AES77714.2| transferase family protein [Medicago truncatula]
Length=262

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 104/190 (55%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TC+Y   CL ++     GI  +++     F    DCRARL+  LP NYFGNC+  
Sbjct  80   SSFVLTCSYALVCLAKAI---HGIKMEKEKFAFGF--TVDCRARLEPSLPNNYFGNCVWG  134

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLEC--EEGVLRGAEDWNSFFGTVSFE--RI  470
             +V  K      E+GV   A+ I    H +++   E+G L GA D  S F  +S E   I
Sbjct  135  HLVDTKPSDYINEDGVFLVAKCI----HEKIKMINEKGGLEGASDGFSKFNYLSTEGFEI  190

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHL  293
            + VAGS R   Y++DFGWG+P K+E  S+D    I +  +K+    IEVG+ +    M L
Sbjct  191  IGVAGSNRFGVYEIDFGWGRPTKVEIVSVDRGLTIGLAESKDGKGGIEVGLVLNKHVMDL  250

Query  292  LKTLFEEGLQ  263
             KTLF EGL 
Sbjct  251  FKTLFLEGLH  260



>ref|XP_006490134.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Citrus 
sinensis]
Length=249

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 111/194 (57%), Gaps = 20/194 (10%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FV+TCA+ + C ++++       R E + TV F    DCR RLD P+P NYFGNC+  
Sbjct  69   STFVLTCAHAYVCQIKAK-------RVEANTTVEFAVGGDCRGRLDPPVPTNYFGNCIGS  121

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGV-LRGAEDWNSFFGTVSFER----  473
             I  AKA  +  ++GVA  AE +       ++  +G  ++G+ED      T++  +    
Sbjct  122  VIAEAKASDMIRDDGVAVVAEKLS----EMIKVLKGNGVQGSED--KMVETIAMLKEKGH  175

Query  472  -ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKM  299
             +L+ AGS R D Y  DFGWG+PKK+E  S+D +GAI +  +K+    +E+GV +   +M
Sbjct  176  VMLTAAGSNRFDDYGSDFGWGRPKKVEIVSVDRTGAISLAESKDGGGGVEIGVVLKKQQM  235

Query  298  HLLKTLFEEGLQAL  257
             +  +LF  GL+ L
Sbjct  236  EVFASLFVNGLEDL  249



>ref|XP_012084860.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Jatropha curcas]
 gb|KDP27252.1| hypothetical protein JCGZ_19951 [Jatropha curcas]
Length=465

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 104/193 (54%), Gaps = 12/193 (6%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            +R  S+FV++ AY   CL + + F         +  ++   +AD RARLD P+P NYFGN
Sbjct  283  SRYLSTFVLSFAYTLVCLAKVKMFGK-------EKEIHIAFSADLRARLDPPVPENYFGN  335

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGT-VSFER  473
             ++  ++  +AG L  E G+    + + + I      E+G L+GA+  NS     +S   
Sbjct  336  LVIGNVILIEAGPLFEENGINFIVKKLDDKIQG---LEKGTLKGAKLANSLKPMELSKLE  392

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSVPAAKMH  296
             + VAGSP+   Y +DFGWG+PKK+E  SID SG I  V    ES  +E+G+ +   +M 
Sbjct  393  AIGVAGSPKFKLYDIDFGWGRPKKVEIVSIDRSGVISMVESKDESGGVEIGLVLQKYEME  452

Query  295  LLKTLFEEGLQAL  257
               +LF  G+  L
Sbjct  453  TFDSLFVNGILDL  465



>ref|XP_009387932.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 107/187 (57%), Gaps = 11/187 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VVTCA++W CLL++         D  D+T +F   AD R RL +P+P  YFGNC+VP
Sbjct  266  STLVVTCAHVWFCLLKTLG-------DAGDETAHFTFTADARDRLRSPVPETYFGNCIVP  318

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  K   L  E+G+ AA+EAIG+AI    + + G L+G       +  V+ +  +++ 
Sbjct  319  CFVEVKVSDLVGEDGIFAASEAIGKAIE---DLKHGALKGVHGLCERWYHVTQKLPMTLT  375

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLKTLF  278
            GSP+   Y  DFGWG+P K+ET  +  + A+Y+  ++    +E+G+S    +M   +  F
Sbjct  376  GSPKFKAYDTDFGWGRPVKVETV-LQKTRAMYLQDSRTGDGVEIGLSFEQHQMDAFERHF  434

Query  277  EEGLQAL  257
              GL+ L
Sbjct  435  LSGLKLL  441



>ref|XP_003608203.1| Isoflavonoid malonyl transferase [Medicago truncatula]
 ref|XP_003621496.1| Isoflavonoid malonyl transferase [Medicago truncatula]
Length=268

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 104/190 (55%), Gaps = 14/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TC+Y   CL ++     GI  +++     F    DCRARL+  LP NYFGNC+  
Sbjct  86   SSFVLTCSYALVCLAKA---IHGIKMEKE--KFAFGFTVDCRARLEPSLPNNYFGNCVWG  140

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLEC--EEGVLRGAEDWNSFFGTVSFE--RI  470
             +V  K      E+GV   A+ I    H +++   E+G L GA D  S F  +S E   I
Sbjct  141  HLVDTKPSDYINEDGVFLVAKCI----HEKIKMINEKGGLEGASDGFSKFNYLSTEGFEI  196

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHL  293
            + VAGS R   Y++DFGWG+P K+E  S+D    I +  +K+    IEVG+ +    M L
Sbjct  197  IGVAGSNRFGVYEIDFGWGRPTKVEIVSVDRGLTIGLAESKDGKGGIEVGLVLNKHVMDL  256

Query  292  LKTLFEEGLQ  263
             KTLF EGL 
Sbjct  257  FKTLFLEGLH  266



>ref|XP_003531870.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Glycine max]
Length=469

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++FVVTC+ +W C ++S+    G     +D++      ADCR R +  +P  YFGNCLV 
Sbjct  279  TTFVVTCSLIWVCKVKSEEAEVGTILPNNDESYILAFMADCRNRPECSIPLEYFGNCLVC  338

Query  637  CIVRAKAGQLa-aeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
                 K G+L      V AA     E  H Q E  EG      ++   F TV  + +  +
Sbjct  339  GNAEVKRGKLVGENGVVEAALAIGSEVRHLQRETFEGAQTLMSNFTE-FATVG-KHMTIL  396

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKT  284
            AGSP+L+ Y+ DFGWGKPK+ E   +D SG I +  C  +   IEVG+++   +M+   T
Sbjct  397  AGSPKLEVYQTDFGWGKPKRSEVVHVDNSGTISLSDCRDKEGRIEVGLALQKIQMNQFST  456

Query  283  LFEEGLQALSL  251
            + EE L  + +
Sbjct  457  ILEEHLTEIGV  467



>ref|XP_006452621.1| hypothetical protein CICLE_v10010723mg [Citrus clementina]
 gb|ESR65861.1| hypothetical protein CICLE_v10010723mg [Citrus clementina]
Length=502

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 110/192 (57%), Gaps = 17/192 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDT-VYFLCAADCRARLDTPLPANYFGNCLV  641
            S+FV+TCA+++ CL+++        R ED +T V F   ADCR+RLD PLP NYFG+C++
Sbjct  304  STFVLTCAHVFVCLVKA--------RGEDTNTTVTFWVPADCRSRLDPPLPGNYFGSCIL  355

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-----  476
               V AKAG    E+G+A  AE + +++ + L+  + ++ G ED  +    V  E     
Sbjct  356  GEFVVAKAGDFMQEDGIAFVAEKLSDSV-KGLKKGDAII-GTEDRIARELEVMKETGEQS  413

Query  475  -RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKM  299
              I    G+   D+Y  DFGWGKP K+E  SID +GAI +  +++   +E+GV +   +M
Sbjct  414  IEIAIAGGTSHFDFYDSDFGWGKPNKVEIVSIDGTGAISLMQSRDGGSVEIGVVLDEPQM  473

Query  298  HLLKTLFEEGLQ  263
             +   LF  GL 
Sbjct  474  EVFTYLFVSGLN  485



>gb|ABY91222.1| isoflavonoid malonyl transferase 2 [Medicago truncatula]
Length=450

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 100/187 (53%), Gaps = 10/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TCAY   CL ++     G+ ++++     F    DCRARL+ PLP NYFGNC+  
Sbjct  268  SSFVLTCAYSLVCLAKAI---HGVEKEKEK--FGFAFTVDCRARLEPPLPNNYFGNCVWG  322

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI--LS  464
             +V  K   L           A       ++  E+GVL G  D    F +++ E++  + 
Sbjct  323  HLVDTKP--LDYINEDGVFLVAKCIHEKIKMINEKGVLDGVSDMFDKFASLASEKLEMMG  380

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            VAGS R   Y++DFGWG+P K+E  S D    I +  +K+    IEVG+ +    M+L +
Sbjct  381  VAGSNRFGVYEIDFGWGRPTKVEIVSADRGLTIALAESKDGKGGIEVGLVLNNHVMNLFR  440

Query  286  TLFEEGL  266
            TLF EGL
Sbjct  441  TLFVEGL  447



>ref|XP_004305990.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Fragaria vesca subsp. vesca]
Length=469

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 111/193 (58%), Gaps = 17/193 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFVV CA+ W  +++++         +D+   +F  AA+CR RL  PLP +YFGNCL  
Sbjct  280  SSFVVICAFTWVSMVKAE------EISDDEMQCHFNYAANCRDRLGYPLPGSYFGNCLSL  333

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFERI--  470
               +AK   L  E G+ AA  AIG  +    + E GVLR AEDW + +  G    + I  
Sbjct  334  RSAQAKESDLVGENGIVAAVNAIGNNVK---DLENGVLRNAEDWTAGWVKGATRKKSIPR  390

Query  469  --LSVAGSPRLDYY-KMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAK  302
               ++AGSPR D+Y ++DFGWG+PKK E  ++D+   IYV  ++E    IE+ +++   +
Sbjct  391  HFTTLAGSPRFDFYNELDFGWGRPKKCEVINVDFDRCIYVSNSREEEGGIEILLALKREQ  450

Query  301  MHLLKTLFEEGLQ  263
            M    ++F++ L+
Sbjct  451  MDSFCSMFKQALK  463



>ref|XP_011009741.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Populus 
euphratica]
Length=296

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S++V+ C+Y+  CL++++         + D  VYF  +ADCR+RLD PLP N+FGN  V 
Sbjct  116  STYVLACSYVSICLVKARG-------GDADREVYFAWSADCRSRLDPPLPPNHFGNTAVV  168

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-RILSV  461
              + +KAG    E G+A  AE +  +I R    E+G++ G+ +      ++  E +++SV
Sbjct  169  HHIVSKAGDFMQENGLAIIAEKLSASIKR---LEKGLIEGSNERLEMLLSLGPEVQLISV  225

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLK  287
            AGS  L++Y  DFGWG  +K+E TSID +G+  V   +   D   E+GV++   +M    
Sbjct  226  AGSTGLEFYNTDFGWGNVEKVELTSIDRTGSFSVLDIRNGSDRRTEIGVALKRPEMESFA  285

Query  286  TLFEEGLQAL  257
            + F  G++ +
Sbjct  286  SFFSNGVEVI  295



>gb|KHN30328.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=469

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            ++FVVTC+ +W C ++S+    G     +D++      ADCR R +  +P  YFGNCLV 
Sbjct  279  TTFVVTCSLIWVCKVKSEEAEVGTILPNNDESYILAFMADCRNRPECSIPLEYFGNCLVC  338

Query  637  CIVRAKAGQLa-aeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
                 K G+L      V AA     E  H Q E  EG      ++   F TV  + +  +
Sbjct  339  GNAEVKRGKLVGENGVVEAALAIGSEVRHLQHETFEGAQTLMSNFTE-FATVG-KHMTIL  396

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLLKT  284
            AGSP+L+ Y+ DFGWGKPK+ E   +D SG I +  C  +   IEVG+++   +M+   T
Sbjct  397  AGSPKLEVYQTDFGWGKPKRSEVVHVDNSGTISLSDCRDKEGRIEVGLALQKIQMNQFST  456

Query  283  LFEEGLQALSL  251
            + EE L  + +
Sbjct  457  ILEEHLTEIGV  467



>gb|AES77678.2| anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
Length=476

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 100/187 (53%), Gaps = 10/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TCAY   CL ++     G+ ++++     F    DCRARL+ PLP NYFGNC+  
Sbjct  294  SSFVLTCAYSLVCLAKAI---HGVEKEKEK--FGFAFTVDCRARLEPPLPNNYFGNCVWG  348

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI--LS  464
             +V  K   L           A       ++  E+GVL G  D    F +++ E++  + 
Sbjct  349  HLVDTKP--LDYINEDGVFLVAKCIHEKIKMINEKGVLDGVSDMFDKFASLASEKLEMMG  406

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            VAGS R   Y++DFGWG+P K+E  S D    I +  +K+    IEVG+ +    M+L +
Sbjct  407  VAGSNRFGVYEIDFGWGRPTKVEIVSADRGLTIALAESKDGKGGIEVGLVLNNHVMNLFR  466

Query  286  TLFEEGL  266
            TLF EGL
Sbjct  467  TLFVEGL  473



>gb|AAS77404.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Lamium purpureum]
Length=461

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 98/186 (53%), Gaps = 4/186 (2%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSF VT A++W CL +S          ED +  YF  A D R+RLD  +PA YFGNC+  
Sbjct  274  SSFTVTIAHVWACLAKSSA--EAGEEVEDAEPEYFGVAVDARSRLDPTVPATYFGNCITL  331

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
                ++ G++  ++G   AAE IG+ + +++  +  ++R A++    +  +  +R   V+
Sbjct  332  AAAESRRGEMKGKDGFFVAAELIGDVMSKKVNKKGELMRDADELLVKYAPLFSKRFYGVS  391

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLKT  284
            GSP+ D Y  DFGWG P K E  SID        C     +  +E+GVS P  KM   + 
Sbjct  392  GSPKFDLYDTDFGWGNPNKFEALSIDEESYSISLCKSREFEGGLEIGVSFPERKMDAFQA  451

Query  283  LFEEGL  266
            +F + L
Sbjct  452  VFYDRL  457



>ref|XP_010107163.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXC13928.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=436

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 104/190 (55%), Gaps = 7/190 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFVV  A +W CL +S+   S +N+D DDD  YF    +CR+RL+ PLP  YFGNCL  
Sbjct  250  SSFVVISALIWVCLAKSEERNSKVNKD-DDDPYYFAFVEECRSRLEFPLPTTYFGNCLTV  308

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV--SFERILS  464
            C    KA +L  E GVA AA+AIG+ +    E     L+  E++   F  +  S  + ++
Sbjct  309  CFALVKAAELLGENGVATAAKAIGKEVG---ELNRKPLKELENFLIKFKKIKDSGWKHVT  365

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAKMHLLK  287
            V GSP+ D Y+ DFGWG+PKK E+     S A  +  ++ E    EV + +   +M    
Sbjct  366  VVGSPKFDLYETDFGWGRPKKCESIHFRDSTAFLIAQSRDEKGGAEVSLVLSKDQMSRFN  425

Query  286  TLFEEGLQAL  257
             + EE L  L
Sbjct  426  AILEEILMGL  435



>ref|XP_004491975.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Cicer arietinum]
Length=512

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 102/190 (54%), Gaps = 10/190 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDED--DDTVYFLCAADCRARLDTPLPANYFGNCL  644
            S+FVVTC+ +W C+++S+   S I  D    DD  Y +  ADCR R    LP NYFGNCL
Sbjct  287  STFVVTCSLIWFCMVKSE--QSKIEEDNAVVDDVCYLVFMADCRDRPRFLLPKNYFGNCL  344

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVS--FERI  470
              CIV  K  +L  + G+  AA  I     +  + +   L G E   S +  +S   + I
Sbjct  345  ATCIVAVKRDELVGKNGIVVAANGIE---RKIRDFKSDALLGFETLMSDYRELSEPSKSI  401

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHL  293
            + VAGSP+L  Y+ DFGWGKP K E   ID SG+I +  C      IEVG+++   +M  
Sbjct  402  VYVAGSPKLAVYETDFGWGKPVKSEAVHIDSSGSISLSECRVGGGGIEVGLALERIRMTN  461

Query  292  LKTLFEEGLQ  263
               +FEE L 
Sbjct  462  FINIFEEVLH  471



>ref|XP_010680633.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=513

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 104/194 (54%), Gaps = 10/194 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S + VTCA++WTC LR++   S + + +    +YF   A    R+   +P+ YFGNC+  
Sbjct  325  SPYAVTCAFIWTCFLRARVQNSAVTKAKAKGPMYFGFIAGGITRVPFQVPSKYFGNCVGF  384

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAE----DWNSFFGTVSFERI  470
                A   +L  E+    AA        + L+ +  +L GA+    DW    G+   E  
Sbjct  385  GRAVANREELLKEDEGMLAAADAIALTIKTLDND--ILGGAKKWISDWQKLIGS---EDH  439

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHL  293
            + V GSP+++ Y+ DFGWGKPKKI+  SID S AI +  +++    IE+G+S+P + M  
Sbjct  440  IHVVGSPKVNLYETDFGWGKPKKIQEISIDQSRAISLTQSRDMKGGIEIGLSLPNSIMDA  499

Query  292  LKTLFEEGLQALSL  251
              TLF +GL   +L
Sbjct  500  FSTLFTKGLHHFTL  513



>ref|XP_010089640.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB38111.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=471

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 108/193 (56%), Gaps = 15/193 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDT----VYFLCAADCRARLDTPLPANYFGN  650
            SSFVVT AY   C+L+       ++ +ED++T      F   AD R+RL  P+P NYFGN
Sbjct  286  SSFVVTFAYALVCILK-------VDIEEDEETNKKKTVFGFTADLRSRLKPPVPENYFGN  338

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF--GTVSFE  476
            C+        A +L  EE   AAA      + ++LE E+ V+ GA +  +    G +   
Sbjct  339  CVGALASFEDARELLKEEDAFAAAAVKTGELIKELE-EKDVMEGAREILARMVSGLLEGA  397

Query  475  RILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKM  299
            R + VAGSPR   Y  DFGWGKPKK+E  S+D +GAI +  +++ +  IE+GV +   +M
Sbjct  398  RAVGVAGSPRFGVYGTDFGWGKPKKVEIVSVDRTGAIAMAESRDGNGGIEIGVVLNKHEM  457

Query  298  HLLKTLFEEGLQA  260
             +  +LF  G+++
Sbjct  458  DVFSSLFLSGVKS  470



>ref|XP_006452620.1| hypothetical protein CICLE_v10008059mg [Citrus clementina]
 gb|ESR65860.1| hypothetical protein CICLE_v10008059mg [Citrus clementina]
Length=506

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 102/190 (54%), Gaps = 15/190 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SS+V+TCA+++ C++++      I  D +  TV F   ADCR+RLD PLP NYFGNC+  
Sbjct  314  SSYVLTCAHVYACMVKA------ITEDANT-TVVFSFNADCRSRLDPPLPVNYFGNCVSA  366

Query  637  CI-VRAKAGQLaaeegvaaaaeaigeaIHRQ----LECEEGVLRGAEDWNSFFGTVSFER  473
             + V AKA       G+    +        +    +  E+ ++R  E      G  S   
Sbjct  367  AVCVVAKASDFLQGNGIDFVEKLSDSIKGLRGDAIVGSEDKIVRKYEMLKQM-GEQSI--  423

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHL  293
            +L ++GS R D Y  DFGWGKPKK+E  SID SGAI +   K+   +EV V +   +M +
Sbjct  424  VLRISGSHRFDVYGPDFGWGKPKKVEPVSIDRSGAICLVENKDGGGVEVAVVLEKQQMEV  483

Query  292  LKTLFEEGLQ  263
              +LF +GL 
Sbjct  484  FASLFIDGLN  493



>gb|KEH25128.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=463

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 111/191 (58%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F+VT AY+  CL +++            + V F+ + DCR+RLD  +   Y GNC+  
Sbjct  286  STFLVTSAYILACLAKAE--------QPKVEKVVFIISMDCRSRLDPSISTMYIGNCIAG  337

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW--NSFFGTVSFE-RIL  467
              +  +   L  + G   A E I +A++   +   GVL GAE+W  N + G   FE +I 
Sbjct  338  QKIVFETKNLVGKNGFLNALEGINKALNSVKDV--GVLNGAENWVSNMYSG---FEGKIY  392

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLL  290
            S+AGSPR ++Y +DFG+GKPKK++ TS D +GA  +G ++ +   IE+G+++   ++   
Sbjct  393  SIAGSPRFEFYSIDFGFGKPKKVDMTSTDKTGAFSLGESRNNNGGIEIGLALNKEELEAF  452

Query  289  KTLFEEGLQAL  257
             T+F EGL+++
Sbjct  453  STIFVEGLESI  463



>ref|XP_009378321.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Pyrus 
x bretschneideri]
Length=474

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 103/190 (54%), Gaps = 17/190 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ ++TCAY W CL+R++        +   + V F+   DCR+RLD PLP  YFGNC+  
Sbjct  289  STNLLTCAYTWVCLVRAE--------EIKTEKVVFILHVDCRSRLDPPLPPTYFGNCIAG  340

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS-FFGTV---SFERI  470
              V AK   L  E+G+  A  AI E I      ++ +L GAE W S    T+   S +R 
Sbjct  341  HSVVAKTKDLLGEDGLLVALNAISEVIK---SLDKTLLEGAETWVSRILNTLLQPSTDRT  397

Query  469  LSVAGSPRLDYYK-MDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSVPAAKMH  296
            ++ AGSP+ ++Y   DFGWG+P K E  SID +GAI Y         +EVG+ +  + M 
Sbjct  398  ITTAGSPQFEFYDAADFGWGRPTKHEIVSIDGTGAISYQKSKNGDGAVEVGLVLQKSYME  457

Query  295  LLKTLFEEGL  266
                LF EGL
Sbjct  458  AFAYLFAEGL  467



>gb|KEH25127.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=463

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 110/189 (58%), Gaps = 12/189 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F VTCAY+  CL +++            + V F+ + D RARL+  +   YFGNC+  
Sbjct  285  STFSVTCAYVLACLAKAE--------QPKAEEVVFIFSVDSRARLEPSISPMYFGNCVTG  336

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERILSV  461
              V  +  +L  ++G  +A E + EA+++     +GVL GA+DW  + F      +I S+
Sbjct  337  QKVVLETKKLVGKDGFLSALEGMNEALNKV--KNDGVLNGAKDWLATMFNGKKDAKIYSI  394

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLKT  284
            AGSPR + Y +DFG+GKPKK++ TS D +GA  +  ++ +   IE+G+++   +M    T
Sbjct  395  AGSPRFEVYSIDFGFGKPKKVDMTSTDKTGAFSISESRNNNGGIEIGLALGKEEMEAFST  454

Query  283  LFEEGLQAL  257
            LF +GL+++
Sbjct  455  LFVQGLESI  463



>ref|XP_009354720.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Pyrus 
x bretschneideri]
Length=478

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 104/193 (54%), Gaps = 11/193 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S +V+TCA++W CLL++Q   +  ++  D+D  YF   A    RL  P+PA Y GNC+  
Sbjct  292  SPYVLTCAFIWVCLLKTQVNYNNYSKCCDEDPNYFGFIAGGVTRLGDPVPATYVGNCV--  349

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAE----DWNSFFGTVSFERI  470
               R+ A +  A  G      A     +   + ++ +L GAE    +W   FG+   E  
Sbjct  350  GFGRSVASR-KALLGANGVVVAAKAIGNTIKKLDKAILGGAEKWISEWEEMFGS---ELH  405

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHL  293
            + V GSP++D Y+ DFGWG+P+KIE   ID    I +  +++ S  IEVG+ +P  +M  
Sbjct  406  VVVLGSPKVDLYETDFGWGRPRKIEEIGIDGVTGISLSESRDMSGGIEVGLVLPKPRMDA  465

Query  292  LKTLFEEGLQALS  254
              TL  EGL A+S
Sbjct  466  FTTLIIEGLNAIS  478



>ref|XP_003608200.1| Isoflavonoid malonyl transferase [Medicago truncatula]
Length=508

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 100/187 (53%), Gaps = 10/187 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SSFV+TCAY   CL ++     G+ ++++     F    DCRARL+ PLP NYFGNC+  
Sbjct  294  SSFVLTCAYSLVCLAKAI---HGVEKEKEK--FGFAFTVDCRARLEPPLPNNYFGNCVWG  348

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERI--LS  464
             +V  K   L           A       ++  E+GVL G  D    F +++ E++  + 
Sbjct  349  HLVDTKP--LDYINEDGVFLVAKCIHEKIKMINEKGVLDGVSDMFDKFASLASEKLEMMG  406

Query  463  VAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            VAGS R   Y++DFGWG+P K+E  S D    I +  +K+    IEVG+ +    M+L +
Sbjct  407  VAGSNRFGVYEIDFGWGRPTKVEIVSADRGLTIALAESKDGKGGIEVGLVLNNHVMNLFR  466

Query  286  TLFEEGL  266
            TLF EGL
Sbjct  467  TLFVEGL  473



>gb|KDO59147.1| hypothetical protein CISIN_1g010609mg [Citrus sinensis]
Length=506

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 101/190 (53%), Gaps = 15/190 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SS+V+TCA+++ C++++      I  D +  TV F   ADCR+RLD PLP NYFGNC+  
Sbjct  314  SSYVLTCAHVYACMVKA------ITEDANT-TVVFSFNADCRSRLDPPLPVNYFGNCVSA  366

Query  637  CI-VRAKAGQLaaeegvaaaaeaigeaIHRQ----LECEEGVLRGAEDWNSFFGTVSFER  473
             + V AKA       G+    +        +    +  E+ ++R  E      G  S   
Sbjct  367  AVCVVAKASDFLQGNGIDFVEKLSDSIKGLRGDAIVGSEDKIVRKYEMLKQM-GEQSI--  423

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHL  293
            +L ++GS R D Y  DFGWGKPKK+E  SID  GAI +   K+   +EV V +   KM +
Sbjct  424  VLRISGSHRFDVYGPDFGWGKPKKVEPVSIDRRGAICLVENKDGGGVEVAVVLEKQKMEV  483

Query  292  LKTLFEEGLQ  263
              +LF +GL 
Sbjct  484  FSSLFIDGLN  493



>ref|XP_008231013.1| PREDICTED: BAHD acyltransferase At3g29680-like [Prunus mume]
Length=472

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 96/189 (51%), Gaps = 17/189 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLV-  641
            S+F +TCAY W CL +++        + + D +  + + DCR+RLD PLP+NYFGNCL  
Sbjct  296  STFSLTCAYAWVCLAKTE--------EIEGDKIVMIFSVDCRSRLDPPLPSNYFGNCLAG  347

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF---GTVSFERI  470
              +V  + G L  +  V A               ++G+L GAE+W S        +  R+
Sbjct  348  RAVVAERKGLLGEDGLVLAVNAITEVIK----GLDKGLLNGAENWISTLYRDMQSTDVRV  403

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHL  293
            L++ GS R   Y  DFGWG+PK+ E  SID SG I +  +K     +E+G+ +    M  
Sbjct  404  LTIVGSNRFQLYDTDFGWGRPKRTEVASIDKSGPISLSDSKNGGGGVEIGLVLKKQYMDA  463

Query  292  LKTLFEEGL  266
               L  + L
Sbjct  464  FAVLLAKDL  472



>ref|XP_003543364.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Glycine max]
Length=469

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 105/192 (55%), Gaps = 8/192 (4%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FVVTC+ +W C++R +         +  +  + +  ADCR R +  LP+ YFGNCL  
Sbjct  280  STFVVTCSLIWVCMIRLEESKGNYVAQDYAEFCHLVFLADCRGRPEFSLPSTYFGNCLTT  339

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFGTVSF--ERIL  467
            C V  K  ++  E G+   A+AI     RQ+ + +   LR AE   S++  +    + +L
Sbjct  340  CFVAMKRSEIVGENGIIGVAKAI----ERQIRDLKSDALRNAERLMSYYRELGKPGKSVL  395

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAKMHLL  290
             VAGSP+L  Y  DFGWGKPKK E   I+ SG+I +  C  E+  IEVG+++   + +  
Sbjct  396  VVAGSPKLGVYHTDFGWGKPKKSEAAHIESSGSISLSDCRDENGGIEVGLALERIQTNNF  455

Query  289  KTLFEEGLQALS  254
              + EE L  ++
Sbjct  456  FNILEEQLNNIN  467



>ref|XP_011000255.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Populus 
euphratica]
Length=474

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S++V+ C+Y+  CL++++         + D  VYF  +ADCR+RLD PLP N+FGN  V 
Sbjct  294  STYVLACSYVSICLVKARG-------GDADREVYFAWSADCRSRLDPPLPPNHFGNTAVV  346

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFE-RILSV  461
              + +KAG    E G+A  AE +  +I R    E+G++ G+ +      ++  E +++SV
Sbjct  347  HHIVSKAGDFMQENGLAIIAEKLSASIKR---LEKGLIEGSNERLEMLLSLGPEVQLISV  403

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD--IEVGVSVPAAKMHLLK  287
            AGS  L++Y  DFGWG  +K+E TSID +G+  V   +   D   E+GV++   +M    
Sbjct  404  AGSTGLEFYNTDFGWGNVEKVELTSIDRTGSFSVLDIRNGSDRRTEIGVALKRPEMESFA  463

Query  286  TLFEEGLQAL  257
            + F  GL+ +
Sbjct  464  SFFSNGLEVI  473



>ref|XP_006474854.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Citrus sinensis]
Length=506

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 101/190 (53%), Gaps = 15/190 (8%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            SS+V+TCA+++ C++++      I  D +  TV F   ADCR+RLD PLP NYFGNC+  
Sbjct  314  SSYVLTCAHVYACMVKA------ITEDANT-TVVFSFNADCRSRLDPPLPVNYFGNCVSA  366

Query  637  CI-VRAKAGQLaaeegvaaaaeaigeaIHRQ----LECEEGVLRGAEDWNSFFGTVSFER  473
             + V AKA       G+    +        +    +  E+ ++R  E      G  S   
Sbjct  367  AVCVVAKASDFLQGNGIDFVEKLSDSIKGLRGDAIVGSEDKIVRKYEMLKQM-GEQSI--  423

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHL  293
            +L ++GS R D Y  DFGWGKPKK+E  SID  GAI +   K+   +EV V +   KM +
Sbjct  424  VLRISGSHRFDVYGPDFGWGKPKKVEPVSIDRRGAICLVENKDGGGVEVAVVLEKQKMEV  483

Query  292  LKTLFEEGLQ  263
              +LF +GL 
Sbjct  484  FSSLFIDGLN  493



>gb|EYU32009.1| hypothetical protein MIMGU_mgv1a006060mg [Erythranthe guttata]
Length=459

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 105/188 (56%), Gaps = 6/188 (3%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +  +  WTC+++S+   + I+ DE   ++YF   AD R R + PLP  YFGNCL  
Sbjct  274  SAFTLASSLAWTCMVKSENSIACIDEDE---SLYFAFLADARLRCNPPLPEGYFGNCLAS  330

Query  637  -CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSV  461
              IV ++ G L  E G     E IGE I R+   ++ +  G E W   +  ++ +R++ V
Sbjct  331  GFIVESRNGDLRGENGFLIGVEKIGELIRRKANDKDEIFVGVEKWWENYAGLAGKRVIGV  390

Query  460  AGSPRLDYYKMDFGWGKPKKIETTSIDYSG-AIYVGCAKESL-DIEVGVSVPAAKMHLLK  287
            A S ++D Y  DFGWG+PKK E  SID  G ++ V  ++E +  +E+G+S+P   M    
Sbjct  391  AESSKIDVYDADFGWGRPKKFEFLSIDEDGYSMSVVKSREFVGGLEIGLSLPVVLMDAFA  450

Query  286  TLFEEGLQ  263
              F + L+
Sbjct  451  GFFADALK  458



>gb|KHN36593.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Glycine soja]
Length=454

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 96/187 (51%), Gaps = 12/187 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV--YFLCAADCRARLDTPLPANYFGNCL  644
            S FVVTCA++W C+++++C       D +DD    YF   A+CR RL+ P+P  YFGNCL
Sbjct  272  SKFVVTCAFVWVCMVKTRC-----RNDAEDDVQEDYFFFGANCRDRLEHPVPKTYFGNCL  326

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERIL  467
              C    K   L  E G   A + I +      + +  + + AE+W  SF      E IL
Sbjct  327  TLCSAMLKRKDLKGEGGFLNAVKLIEK---EVTDLKSDLFKDAENWRESFTKMFVLETIL  383

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLK  287
             V GSP+   Y+ DFG+G+P K+E     + G        E   +EVG+   + ++  L 
Sbjct  384  MVTGSPKFGVYETDFGFGRPTKVEMVH-SFKGMSLAESGDEEGGLEVGLVCTSTEIEYLN  442

Query  286  TLFEEGL  266
            ++ E+GL
Sbjct  443  SVIEQGL  449



>ref|XP_003541923.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Glycine max]
Length=464

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 96/187 (51%), Gaps = 12/187 (6%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV--YFLCAADCRARLDTPLPANYFGNCL  644
            S FVVTCA++W C+++++C       D +DD    YF   A+CR RL+ P+P  YFGNCL
Sbjct  282  SKFVVTCAFVWVCMVKTRC-----RNDAEDDVQEDYFFFGANCRDRLEHPVPKTYFGNCL  336

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW-NSFFGTVSFERIL  467
              C    K   L  E G   A + I +      + +  + + AE+W  SF      E IL
Sbjct  337  TLCSAMLKRKDLKGEGGFLNAVKLIEK---EVTDLKSDLFKDAENWRESFTKMFVLETIL  393

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLK  287
             V GSP+   Y+ DFG+G+P K+E     + G        E   +EVG+   + ++  L 
Sbjct  394  MVTGSPKFGVYETDFGFGRPTKVEMVH-SFKGMSLAESGDEEGGLEVGLVCTSTEIEYLN  452

Query  286  TLFEEGL  266
            ++ E+GL
Sbjct  453  SVIEQGL  459



>ref|XP_002313292.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa]
 gb|EEE87247.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa]
Length=471

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 108/195 (55%), Gaps = 14/195 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINR---DEDDDTVYFLCAADCRARLDTPLPANYFGNC  647
            S +V+TCA++W CL+R++    G         +D +Y    A    R+D P+P  YFGNC
Sbjct  282  SPYVLTCAFLWVCLVRAKIQRGGSENHCYSRGEDPIYLGFIAGGMTRIDFPVPTTYFGNC  341

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNS----FFGTVSF  479
            +      A   +L  E+G+  AA  IG  I R    ++ +  GAE W S     FG+V  
Sbjct  342  VGFGRSTATRNELMGEDGIIVAANVIGNTIRR---LDKEIFGGAEKWISEWEVMFGSVIH  398

Query  478  ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAK-ESLDIEVGVSVPAAK  302
               + V+GSP+L+ Y+ DFGWG+PKKIE  SID   AI +  ++ E   IE+G++ P  +
Sbjct  399  ---VIVSGSPKLNLYETDFGWGRPKKIEDISIDKIRAISLLESRDEKGGIELGLAFPTGE  455

Query  301  MHLLKTLFEEGLQAL  257
            M   KTLF + L+AL
Sbjct  456  MDAFKTLFIQELEAL  470



>ref|XP_008379902.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Malus domestica]
Length=472

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 105/191 (55%), Gaps = 6/191 (3%)
 Frame = -3

Query  826  RQPSSFVVTCAYMWTCLLRS-QCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            +  S FVVTC ++W CL+++     +G+   +DDD +    AAD R+    P+P  YFGN
Sbjct  282  KHLSKFVVTCGFVWVCLMKALHASETGVTSMKDDDLLRLGFAADIRSLFQNPVPITYFGN  341

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFG-TVSFER  473
            CL  C V  K  ++ AE G+A A +A+  AI    E +   L G +    F G  V  E 
Sbjct  342  CLSACYVADKKREIMAECGIAKAVKALEAAI---FELKNRDLEGLKRMVPFRGELVVAES  398

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD-IEVGVSVPAAKMH  296
             +++AGSP+L  Y  DFGWG+ KK+E      S    +  +++  D IEVG+++P   M 
Sbjct  399  SVAIAGSPKLGVYGTDFGWGRAKKVEVVHFVDSTVFSLAESRDEEDGIEVGLALPRTTMD  458

Query  295  LLKTLFEEGLQ  263
               +LFE+GL+
Sbjct  459  AFTSLFEQGLK  469



>ref|XP_009398032.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 103/188 (55%), Gaps = 10/188 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+ VVT AY W CL+++  +         D   + +  AD RARL  PLP +YFGNC+VP
Sbjct  265  STAVVTYAYAWICLVKTFGY-------AGDKIAHLIFLADYRARLQPPLPMSYFGNCIVP  317

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V  K   L  E+G+  AAEAIG+AI  Q   +   L G   W   +   + ++ ++VA
Sbjct  318  CFVEVKVSDLVGEDGIVVAAEAIGKAI--QGLRDGAALEGVHGWGGRWQFAATQQAMTVA  375

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAAKMHLLKTLF  278
            GS R   Y  DFGWG+P K+E   I  +GA+ +  ++    +E+G+S    +M L +  F
Sbjct  376  GSSRFRVYDADFGWGRPVKVEMV-IQRAGALSLAESRSGDGVEIGLSFDRTEMDLFERHF  434

Query  277  EEGLQALS  254
              GL+ LS
Sbjct  435  SAGLELLS  442



>ref|XP_007149905.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris]
 gb|ESW21899.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris]
Length=473

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 101/196 (52%), Gaps = 8/196 (4%)
 Frame = -3

Query  829  ARQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGN  650
            A   S+FVV C+ +W C +RS+   +     E D+  + +  ADCR   +  LP+ YFGN
Sbjct  280  ALHISTFVVACSTIWVCKIRSEEKKANCFSQECDELCHLVFLADCRDLPEFSLPSTYFGN  339

Query  649  CLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQL-ECEEGVLRGAEDWNSFFGTVSF--  479
            CL   IV  K  +L       +       +I RQ+ + +   LR AE   S +  +    
Sbjct  340  CLTSYIVAIKRSEL----VGKSGIVGAANSIERQVRDLKSDALRNAETLMSDYREIGKPG  395

Query  478  ERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVG-CAKESLDIEVGVSVPAAK  302
            + +L +AGSP+L  Y+ DFGWGKPKK E   I+ SG+I +  C  E   IEVG+++    
Sbjct  396  KSVLVIAGSPKLGVYQTDFGWGKPKKCEAAHIESSGSISLSECRDEKRGIEVGLALERTH  455

Query  301  MHLLKTLFEEGLQALS  254
            M+    + +E L  ++
Sbjct  456  MNKFTNILQEQLHNIN  471



>ref|XP_010265765.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Nelumbo 
nucifera]
Length=458

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 103/188 (55%), Gaps = 17/188 (9%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CAY+W CL+++            D+ V F    DCR RL  P+PA YFGNC+  
Sbjct  276  STFTVLCAYIWVCLVKA-----------GDERVSFSFNVDCRTRLKPPVPATYFGNCVGT  324

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
             +V A+      ++G+  AA+ I ++I+      +G L GAE W S   +   +  +  A
Sbjct  325  RVVTAERADFMRQDGIVVAAKLIEDSIN---GLNDGSLDGAEFWISRLLSSGVKGKVWAA  381

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYV--GCAKESLDIEVGVSVPAAKMHLLKT  284
            GSPRL  Y+ DFGWG+PKK+E  SID +GAI++   C  +    E+ +++   +M    +
Sbjct  382  GSPRLGIYEADFGWGRPKKVELASIDKTGAIFISESCNGDG-GAEITLTLRGPEMDAFAS  440

Query  283  LFEEGLQA  260
            +F  GL+ 
Sbjct  441  VFVNGLEG  448



>gb|KJB50065.1| hypothetical protein B456_008G151700 [Gossypium raimondii]
 gb|KJB50066.1| hypothetical protein B456_008G151700 [Gossypium raimondii]
Length=498

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 99/199 (50%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQ-----CFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFG  653
            S+FVVTC+ MW C+++SQ        +G + D+DD   Y L A DCR R+   LP  YFG
Sbjct  308  STFVVTCSIMWICMIKSQENNIQVSTNGDDDDDDDTFYYLLFAVDCRNRIGFSLPVTYFG  367

Query  652  NCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFER  473
            NCL P I+RAK  +L    G      A      +  E E G L  AE      G  + E 
Sbjct  368  NCLAPGIIRAKKSEL---MGAKGIVTAGKAIAKKVKEMESGALTEAEK-----GPSNLEE  419

Query  472  I------LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAI-YVGCAKESLDIEVGVSV  314
            +      + ++GSP+   Y MDFGWG+P KIE   ID  G++  +    ES  +EV + +
Sbjct  420  MFRSGHHVGISGSPKFRVYDMDFGWGRPLKIEFIHIDDGGSLSLIESKNESGGMEVSLVL  479

Query  313  PAAKMHLLKTLFEEGLQAL  257
               +M    +   E L+A 
Sbjct  480  SKNQMDAFTSNLAESLKAF  498



>ref|XP_010657394.1| PREDICTED: LOW QUALITY PROTEIN: malonyl-coenzyme A:anthocyanin 
3-O-glucoside-6''-O-malonyltransferase-like [Vitis vinifera]
Length=418

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = -3

Query  814  SFVVTCAYMWTCLLRSQCFPSGINRD---------EDDDTVYFLCAADCRARLDTPLPAN  662
            S VVTC   ++    S C   G++            +++  +F+  ADCRA LD  LP N
Sbjct  225  SNVVTCLKFYS----SMCLHMGLHVKARACSGEEVSENELEHFIFVADCRAHLDPTLPEN  280

Query  661  YFGNCLVPCIVRA-KAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTV  485
            YFGNC+VP ++ A K       +G   AA  IGEAI  +L   +GVL G + W   F ++
Sbjct  281  YFGNCVVPSLLTACKEYATNRXDGFIIAANLIGEAIQEKLGSNKGVLEGLDKWVVNFSSI  340

Query  484  SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPA  308
            + +R + VAGSP    Y +DFG G+ +K E+ SID +  I +   K++  DIEVG+S P 
Sbjct  341  NIKRAVGVAGSPGFAVYGIDFGLGQLQKRESISIDETRCISLHEGKDNKGDIEVGLSFPK  400

Query  307  AKMHLLKTLFEEGLQA  260
             KM+   ++F +GL  
Sbjct  401  IKMNAFASIFTDGLMV  416



>ref|XP_008231011.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
1-like [Prunus mume]
Length=473

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (56%), Gaps = 13/189 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F +TCAY W CL +S+       ++   + +  + + DCR+RLD PLPANYFGN +  
Sbjct  292  STFSLTCAYAWVCLAKSKA------KEIRGEKIAMIFSIDCRSRLDPPLPANYFGNGIAG  345

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFF----GTVSFERI  470
              V A+   L  E+G+  A  AI EAI + L+  +G+L GAE+W S         ++  +
Sbjct  346  GRVVAETKGLFGEDGLVLAVHAIREAI-KGLD-NKGILNGAENWVSTLYSSDAQTNYFIL  403

Query  469  LSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEVGVSVPAAKMHL  293
             SVAGS R   Y  DFGWG+P++ E  SID +GAI +  +K     +E+G+ +    M  
Sbjct  404  TSVAGSNRFQIYDTDFGWGRPRRTEVVSIDXNGAISLSDSKNGGGGVEIGLVLKKQYMDA  463

Query  292  LKTLFEEGL  266
               LF  GL
Sbjct  464  FAALFAHGL  472



>gb|KCW47092.1| hypothetical protein EUGRSUZ_K00898 [Eucalyptus grandis]
Length=333

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 111/203 (55%), Gaps = 11/203 (5%)
 Frame = -3

Query  838  GQVARQP---SSFVVTCAYMWTCLLRS--QCFPSGINR--DEDDDTVYFLC-AADCRARL  683
            G +  +P   S+FVVTCA++W C+++S  Q     I    + +D+ +  LC  ADCR +L
Sbjct  130  GDLESEPIHLSTFVVTCAFVWVCMIKSKDQEHQHRIQESSESNDNELCHLCFVADCRDQL  189

Query  682  DTPLPANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWN  503
               +P+ YFGNCL    +  K   L  + G++  A A+G  + ++++  EG LRGAE W 
Sbjct  190  KYSIPSTYFGNCLGIYFLSEKRSTLLGKSGISHVARALGGRV-KEVKTSEG-LRGAERWI  247

Query  502  SFFGTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKE-SLDIEV  326
              F       ++ +AGSPRL  Y  DFGWG+P K     +D S AI +  ++     +EV
Sbjct  248  RDFNAAKNGDLVILAGSPRLKVYDTDFGWGRPTKSHVVHVDTSRAIALAESRNGDGGVEV  307

Query  325  GVSVPAAKMHLLKTLFEEGLQAL  257
            G+++    M    +LFEEG ++ 
Sbjct  308  GLALTKVCMEKFVSLFEEGSRSF  330



>gb|KJB50068.1| hypothetical protein B456_008G151900 [Gossypium raimondii]
Length=416

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 91/180 (51%), Gaps = 37/180 (21%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRS-QCFPSGINRDEDDDTVY-FLCAADCRARLDTPLPANYFGNCL  644
            S+FVVTCAY+W CL++S +   S ++ D  DD +Y FL   D R RL+  +P  Y GNCL
Sbjct  261  STFVVTCAYIWVCLIKSKESVASNLSHDNSDDELYYFLFPYDSRNRLEFWVPTTYLGNCL  320

Query  643  VPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGA----------EDWNSFF  494
             PC +  K                      R++  E G++  A          E  +   
Sbjct  321  KPCAIEIKK---------------------REVLGESGIILAAKAIGKGIKEMERSDKRI  359

Query  493  GTVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSV  314
            GT++  R   VAGSP+L  Y+ +FGWG+P K+E T IDY GAI +    E  D E GV V
Sbjct  360  GTMT-GRFTVVAGSPKLQVYETNFGWGRPCKVELTHIDYDGAISLA---ECRDGESGVEV  415



>ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF49158.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=464

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 115/196 (59%), Gaps = 21/196 (11%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDD-DTVYFLCAADCRARLDTPLPANYFGNCLV  641
            S +V+TC+++W CL+++Q     ++++E++ D  YF   A    R+D P+PA YFGNC+ 
Sbjct  281  SPYVLTCSFLWVCLVKAQV---QMDQEENEEDLNYFAFVAGGLTRIDYPVPATYFGNCVG  337

Query  640  PCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAE----DWNSFFGTVSFER  473
                +A   +L  E+G+  AA  IG  I R+L+ E  +   AE    DW   FG+   E 
Sbjct  338  FGRAKAIRSELLGEDGIIVAANVIGNMI-RKLDKE--IFSEAEKWISDWEVLFGS---EV  391

Query  472  ILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLD----IEVGVSVPAA  305
             + V+GSP+L  Y +DFGWG PKKIE  SID + AI +    ES D    IE+G+++  +
Sbjct  392  HVMVSGSPKLKLYSVDFGWGSPKKIEDISIDKNRAISL---TESRDVKGGIEIGLALRKS  448

Query  304  KMHLLKTLFEEGLQAL  257
            +M +  + F EGL+ L
Sbjct  449  QMEIFGSHFNEGLRIL  464



>ref|XP_010089646.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB38117.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=228

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 17/192 (9%)
 Frame = -3

Query  826  RQPSSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNC  647
            +  S+F + CAY W CL +++          DD  + FL   DCR++LD PLPA Y GNC
Sbjct  33   KNVSAFSLICAYTWFCLAKAEEI-------SDDKNLVFLV--DCRSQLDPPLPATYLGNC  83

Query  646  LVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDW------NSFFGTV  485
            + P     +   L  ++G  AA  AI EA+ + LE  + VL GAE+W      N      
Sbjct  84   IAPRFAVVEREALFGKQGFVAAVNAISEAM-KGLE-NKSVLDGAENWVSVVVGNMHRSIN  141

Query  484  SFERILSVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESLDIEVGVSVPAA  305
            +  ++ SVA SP+   Y  DFGWG+P+K++  SID +GA+ +   +    +E+G+ +   
Sbjct  142  TRRKVYSVASSPQFKVYDTDFGWGRPRKVDVVSIDGTGAMSLLDRRNEDGVEIGIVLKKH  201

Query  304  KMHLLKTLFEEG  269
            +M    +LF + 
Sbjct  202  QMEAFASLFAQA  213



>ref|XP_012084861.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Jatropha curcas]
 gb|KDP27253.1| hypothetical protein JCGZ_19952 [Jatropha curcas]
Length=476

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+FV++ AY   C+++++         E    +    +ADCRARLD PLP NYFGNC+  
Sbjct  289  STFVISLAYTIVCMVKARML-------ERKQKIAIGFSADCRARLDPPLPENYFGNCISA  341

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGA-EDWNSFFGTVSFERI--L  467
             +  A+   L  E G+   AE +   I      + GVL GA E   +F   +    +  +
Sbjct  342  RLSLAEVAPLLEENGITFVAERLTNMIKG---LDNGVLEGAKEKLANFLKEIELGEVEMI  398

Query  466  SVAGSPRLDYYKMDFGWGKPKKIETTSIDYSGAIYVGCAKESL-DIEVGVSVPAAKMHLL  290
             V  SP+ + Y  DFGWG+PK++E T+ID +G+I +  +K+    IEVG+ +   +M L 
Sbjct  399  GVHSSPKFEVYGTDFGWGRPKRVEFTTIDRTGSISMSESKDGTGGIEVGLVLKQHEMKLF  458

Query  289  KTLFEEGL  266
            K+LF  GL
Sbjct  459  KSLFVNGL  466



>ref|XP_004954417.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Setaria italica]
Length=455

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 105/189 (56%), Gaps = 10/189 (5%)
 Frame = -3

Query  817  SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTVYFLCAADCRARLDTPLPANYFGNCLVP  638
            S+F V CA+ W CL R         R + +   + L + +CR RL  P+P  Y GNCL P
Sbjct  274  SAFTVACAFAWACLARVDG-----GRADAERRAHLLFSVECRRRLAPPIPQEYLGNCLRP  328

Query  637  CIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFGTVSFERILSVA  458
            C V    G+L   +GV AAA AIG ++ R L+  +GVL GA  W     ++  ER +SV 
Sbjct  329  CFVEVGLGELLGGDGVVAAASAIGASV-RALD--DGVLAGAGGWFHKILSLVPERPMSVG  385

Query  457  GSPRLDYYKMDFGWGKPKKIETTSIDYS-GAIYVGCAKESL-DIEVGVSVPAAKMHLLKT  284
            GSPR   Y+ DFG G+P K+E  SID + G + +   ++ L  IE+GV +P A M    +
Sbjct  386  GSPRYGVYETDFGLGRPIKVELVSIDKTPGTVSLAEGRDKLAGIEIGVVLPEADMARFSS  445

Query  283  LFEEGLQAL  257
             F +GL+ L
Sbjct  446  CFADGLEQL  454



>gb|EYU24851.1| hypothetical protein MIMGU_mgv1a006146mg [Erythranthe guttata]
Length=455

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 13/198 (7%)
 Frame = -3

Query  832  VARQP-----SSFVVTCAYMWTCLLRSQCFPSGINRDEDDDTV-YFLCAADCRARLDTPL  671
            +A++P     SSFVVT +Y+WT LL+S      +  + DDD   +F+   D R R + P+
Sbjct  262  LAKKPDLGHVSSFVVTASYVWTTLLKSG---DAVGEEVDDDVFEFFIFTVDARGRTNPPM  318

Query  670  PANYFGNCLVPCIVRAKAGQLaaeegvaaaaeaigeaIHRQLECEEGVLRGAEDWNSFFG  491
            P NYFGNCL   + + +   L  +EG   AAEAI   I  ++  ++ VL+G E+W S   
Sbjct  319  PLNYFGNCLGGSMAKIEHKNLVGDEGFVIAAEAIALDIKNRVNNKDEVLKGVENWMSDSE  378

Query  490  TVSFERILSVAGSPRLDYYKMDFGWGKPKKIETTSID---YSGAIYVGCAKESLDIEVGV  320
                 R + V+GSP+ D    DFG G+ +K+E  SID   YS ++      E   +E+G+
Sbjct  379  KFVGMRAVGVSGSPKFDLCDADFGLGRARKLEVVSIDGEKYSISLCKSGGSEG-GLEIGL  437

Query  319  SVPAAKMHLLKTLFEEGL  266
            ++P  +M     +F  GL
Sbjct  438  ALPKDRMEAFAAIFANGL  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996