BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4121

Length=825
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797839.1|  PREDICTED: heat shock factor protein HSF24         188   5e-54   Nicotiana sylvestris
ref|XP_009589845.1|  PREDICTED: heat shock factor protein HSF24         188   8e-54   Nicotiana tomentosiformis
dbj|BAA83710.1|  heat shock factor                                      186   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_006339901.1|  PREDICTED: heat shock factor protein HSF24-like    179   2e-50   Solanum tuberosum [potatoes]
ref|XP_004232034.1|  PREDICTED: heat shock factor protein HSF24         175   8e-49   
sp|P22335.1|HSF24_SOLPE  RecName: Full=Heat shock factor protein ...    172   9e-48   Solanum peruvianum [Peruvian tomato]
ref|XP_002277765.2|  PREDICTED: heat shock factor protein HSF24         137   1e-34   Vitis vinifera
dbj|BAI99728.1|  heat stress transcription factor                       134   1e-33   Carica papaya [mamon]
emb|CDP02491.1|  unnamed protein product                                138   1e-33   Coffea canephora [robusta coffee]
emb|CAN61780.1|  hypothetical protein VITISV_028661                     135   2e-33   Vitis vinifera
ref|XP_007047250.1|  Heat shock factor 4                                130   7e-32   
ref|XP_011099137.1|  PREDICTED: heat shock factor protein HSF24         127   5e-31   Sesamum indicum [beniseed]
gb|KJB17912.1|  hypothetical protein B456_003G023500                    125   5e-30   Gossypium raimondii
gb|AII99897.1|  heat shock transcription factor                         125   6e-30   Gossypium hirsutum [American cotton]
ref|XP_012079229.1|  PREDICTED: heat shock factor protein HSF24         124   7e-30   Jatropha curcas
ref|XP_006425894.1|  hypothetical protein CICLE_v10026058mg             123   1e-29   Citrus clementina [clementine]
ref|XP_006425895.1|  hypothetical protein CICLE_v10026058mg             123   5e-29   Citrus clementina [clementine]
gb|KDO79222.1|  hypothetical protein CISIN_1g026263mg                   121   6e-29   Citrus sinensis [apfelsine]
ref|XP_006466606.1|  PREDICTED: heat shock factor protein HSF24-like    120   1e-28   Citrus sinensis [apfelsine]
ref|XP_010263545.1|  PREDICTED: heat shock factor protein HSF24-like    120   3e-28   Nelumbo nucifera [Indian lotus]
gb|KJB71093.1|  hypothetical protein B456_011G105700                    118   2e-27   Gossypium raimondii
ref|XP_010093647.1|  Heat shock factor protein HSF24                    118   6e-27   
gb|KHG26651.1|  Heat shock factor HSF24                                 115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_010269874.1|  PREDICTED: heat shock factor protein HSF24         115   2e-26   Nelumbo nucifera [Indian lotus]
gb|ADL36733.1|  HSF domain class transcription factor                   114   5e-26   Malus domestica [apple tree]
ref|XP_008340075.1|  PREDICTED: heat shock factor protein HSF24         113   9e-26   
ref|XP_009375707.1|  PREDICTED: heat stress transcription factor ...    108   7e-24   Pyrus x bretschneideri [bai li]
gb|KJB71094.1|  hypothetical protein B456_011G105700                    107   1e-23   Gossypium raimondii
gb|KJB40253.1|  hypothetical protein B456_007G053900                    107   1e-23   Gossypium raimondii
ref|XP_008352525.1|  PREDICTED: heat shock factor protein HSF24-like    106   1e-23   
ref|XP_009367059.1|  PREDICTED: heat shock factor protein HSF24         105   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_004288037.1|  PREDICTED: heat shock factor protein HSF24         105   9e-23   Fragaria vesca subsp. vesca
ref|XP_008338368.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    105   1e-22   
ref|XP_008241456.1|  PREDICTED: heat shock factor protein HSF24         104   2e-22   Prunus mume [ume]
ref|XP_007202372.1|  hypothetical protein PRUPE_ppa009274mg             101   1e-21   Prunus persica
ref|XP_004141916.1|  PREDICTED: heat shock factor protein HSF24       99.8    5e-21   Cucumis sativus [cucumbers]
ref|XP_008440278.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...  97.1    5e-20   
ref|XP_011043547.1|  PREDICTED: heat shock factor protein HSF24       96.7    7e-20   Populus euphratica
ref|XP_007155926.1|  hypothetical protein PHAVU_003G244000g           96.3    1e-19   Phaseolus vulgaris [French bean]
ref|XP_010432090.1|  PREDICTED: heat stress transcription factor ...  92.4    2e-18   Camelina sativa [gold-of-pleasure]
gb|ACJ85410.1|  unknown                                               89.7    1e-17   Medicago truncatula
ref|XP_010446698.1|  PREDICTED: heat stress transcription factor ...  90.1    1e-17   Camelina sativa [gold-of-pleasure]
gb|AAC31756.1|  heat shock transcription factor 4                     89.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195416.1|  heat stress transcription factor B-1                89.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHN01274.1|  Heat shock factor protein HSF24                       89.7    2e-17   Glycine soja [wild soybean]
ref|XP_010550365.1|  PREDICTED: heat shock factor protein HSF24-like  89.0    2e-17   
gb|AFK42633.1|  unknown                                               88.2    5e-17   Medicago truncatula
ref|XP_002866968.1|  hypothetical protein ARALYDRAFT_490909           86.3    2e-16   
ref|XP_003550068.1|  PREDICTED: heat shock factor protein HSF24-like  85.5    4e-16   
ref|XP_010437260.1|  PREDICTED: heat stress transcription factor B-1  85.5    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010437261.1|  PREDICTED: heat stress transcription factor ...  85.5    4e-16   Camelina sativa [gold-of-pleasure]
gb|ABV89640.1|  heat shock factor 4                                   84.7    8e-16   Brassica rapa
ref|XP_009138768.1|  PREDICTED: heat stress transcription factor B-1  84.7    8e-16   Brassica rapa
gb|KFK30320.1|  hypothetical protein AALP_AA7G246600                  84.3    1e-15   Arabis alpina [alpine rockcress]
gb|KHN36225.1|  Heat shock factor protein HSF24                       83.6    1e-15   Glycine soja [wild soybean]
ref|XP_006284246.1|  hypothetical protein CARUB_v10005408mg           84.0    2e-15   Capsella rubella
ref|NP_001241597.1|  heat shock factor                                83.6    2e-15   Glycine max [soybeans]
ref|XP_004511933.1|  PREDICTED: heat stress transcription factor ...  82.8    3e-15   Cicer arietinum [garbanzo]
emb|CDY42722.1|  BnaA03g53750D                                        82.8    3e-15   Brassica napus [oilseed rape]
ref|XP_010028256.1|  PREDICTED: heat shock factor protein HSF24       82.8    4e-15   Eucalyptus grandis [rose gum]
ref|XP_006411927.1|  hypothetical protein EUTSA_v10025906mg           82.8    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_003537320.1|  PREDICTED: heat shock factor protein HSF24-like  82.4    5e-15   
ref|XP_003611751.1|  Heat shock transcription factor                  84.0    5e-15   
ref|XP_004509144.1|  PREDICTED: heat shock factor protein HSF24-like  81.6    8e-15   Cicer arietinum [garbanzo]
tpg|DAA61768.1|  TPA: heat shock factor protein 4                     81.6    8e-15   
ref|XP_009138469.1|  PREDICTED: heat stress transcription factor ...  81.3    1e-14   Brassica rapa
tpg|DAA61767.1|  TPA: hypothetical protein ZEAMMB73_394338            81.6    1e-14   
ref|XP_010666616.1|  PREDICTED: heat shock factor protein HSF24       81.3    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008670235.1|  PREDICTED: heat stress transcription factor ...  81.3    1e-14   Zea mays [maize]
ref|XP_006826240.1|  PREDICTED: heat shock factor protein HSF24       80.9    2e-14   Amborella trichopoda
gb|KCW54959.1|  hypothetical protein EUGRSUZ_I00929                   82.8    2e-14   Eucalyptus grandis [rose gum]
ref|NP_001150318.1|  heat shock factor protein 4                      80.9    2e-14   Zea mays [maize]
ref|XP_004957012.1|  PREDICTED: heat stress transcription factor ...  80.9    2e-14   Setaria italica
ref|XP_007156806.1|  hypothetical protein PHAVU_002G019100g           80.1    3e-14   Phaseolus vulgaris [French bean]
emb|CDX69274.1|  BnaC01g01790D                                        79.3    6e-14   
emb|CDY67770.1|  BnaCnng56320D                                        78.6    8e-14   Brassica napus [oilseed rape]
ref|XP_010547515.1|  PREDICTED: heat shock factor protein HSF24-like  74.7    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_010943066.1|  PREDICTED: heat stress transcription factor ...  75.1    3e-12   Elaeis guineensis
ref|XP_010531239.1|  PREDICTED: heat stress transcription factor ...  73.9    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_003638742.1|  Heat stress transcription factor A3              70.9    4e-11   
ref|XP_002460330.1|  hypothetical protein SORBIDRAFT_02g026590        65.5    7e-09   Sorghum bicolor [broomcorn]
dbj|BAJ97434.1|  predicted protein                                    65.1    9e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008808108.1|  PREDICTED: heat stress transcription factor ...  64.7    1e-08   Phoenix dactylifera
ref|XP_009410099.1|  PREDICTED: heat stress transcription factor ...  63.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797267.1|  PREDICTED: heat stress transcription factor ...  62.0    1e-07   Phoenix dactylifera
ref|XP_009381466.1|  PREDICTED: heat stress transcription factor ...  60.1    4e-07   
ref|XP_003602208.1|  Heat shock factor                                57.0    4e-07   
gb|AFG54850.1|  hypothetical protein 2_1014_01                        57.4    7e-07   Pinus taeda
gb|AFG54840.1|  hypothetical protein 2_1014_01                        57.4    7e-07   Pinus taeda
gb|AFB33185.1|  hypothetical protein 2_1014_01                        56.6    1e-06   Pinus mugo [mountain pine]
gb|AFB33182.1|  hypothetical protein 2_1014_01                        56.6    1e-06   Pinus mugo [mountain pine]
ref|XP_003578229.1|  PREDICTED: heat stress transcription factor ...  58.9    1e-06   Brachypodium distachyon [annual false brome]
gb|EAZ09371.1|  hypothetical protein OsI_31644                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
gb|EEE69850.1|  hypothetical protein OsJ_29627                        57.0    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT31202.1|  Heat stress transcription factor B-1                  57.4    3e-06   
ref|XP_010939421.1|  PREDICTED: heat stress transcription factor ...  57.4    4e-06   Elaeis guineensis
ref|XP_006661309.1|  PREDICTED: heat stress transcription factor ...  57.4    5e-06   
ref|XP_010548862.1|  PREDICTED: heat stress transcription factor ...  55.1    5e-06   Tarenaya hassleriana [spider flower]
ref|NP_001063364.1|  Os09g0456800                                     57.0    5e-06   
gb|AHZ44770.1|  heat shock factor B1b                                 56.6    7e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010919270.1|  PREDICTED: heat stress transcription factor ...  55.5    2e-05   Elaeis guineensis
ref|XP_007146140.1|  hypothetical protein PHAVU_006G015700g           54.7    3e-05   Phaseolus vulgaris [French bean]
gb|KJB52055.1|  hypothetical protein B456_008G244400                  52.4    2e-04   Gossypium raimondii
gb|KJB52056.1|  hypothetical protein B456_008G244400                  52.4    2e-04   Gossypium raimondii
ref|XP_009119797.1|  PREDICTED: heat stress transcription factor ...  51.6    4e-04   Brassica rapa
emb|CDY06765.1|  BnaA10g05440D                                        51.6    4e-04   
ref|XP_007015249.1|  Heat shock transcription factor B4               50.8    5e-04   
gb|EMT20815.1|  Heat stress transcription factor B-2b                 50.4    0.001   



>ref|XP_009797839.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana sylvestris]
Length=292

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 121/161 (75%), Gaps = 6/161 (4%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSVDTPGKSQF DL+DENEKLK+DNQMLSSELAQ KKQC+ELV FL QYVKV P+ I
Sbjct  138  KNPGSVDTPGKSQFADLSDENEKLKKDNQMLSSELAQAKKQCDELVAFLNQYVKVAPDMI  197

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            NRIMSQG SGSS+ + + +V    +   +Q      DDDE G+TLKLFGVLLKE K+KR 
Sbjct  198  NRIMSQGTSGSSYGELVKEVIGGVNDLEAQG----SDDDEKGDTLKLFGVLLKENKKKRG  253

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+N D S +  K MK ++D  N PWMK+S  PG+S KVCN
Sbjct  254  PDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKVCN  292



>ref|XP_009589845.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana tomentosiformis]
Length=296

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSVDTPGKSQF DL+DENEKLK+DNQML+SELAQ KKQC+ELV FL QYVKV P+ I
Sbjct  138  KNPGSVDTPGKSQFTDLSDENEKLKKDNQMLNSELAQAKKQCDELVAFLNQYVKVAPDMI  197

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            NRIMSQG SGSSH + + +V  +      Q  +DD DDDE G+TLKLFGVLLKE K+KR 
Sbjct  198  NRIMSQGTSGSSHGELVKEVIGAVKDLEEQGSNDDQDDDEKGDTLKLFGVLLKENKKKRG  257

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+N D S +  K M  ++D  N PWMK+S   G+S K+CN
Sbjct  258  PDENADISGSHGK-MTKTVDY-NLPWMKLSSATGESSKICN  296



>dbj|BAA83710.1| heat shock factor [Nicotiana tabacum]
Length=292

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 121/161 (75%), Gaps = 6/161 (4%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSVDTPGKSQF DL+DENEKLK+DNQMLSSELAQ KKQC+ELV FL QYVKV P+ I
Sbjct  138  KNPGSVDTPGKSQFADLSDENEKLKKDNQMLSSELAQAKKQCDELVAFLNQYVKVAPDMI  197

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            NRI+SQG SGSS+ + + +V    +   +Q      DDDE G+TLKLFGVLLKE K+KR 
Sbjct  198  NRIISQGTSGSSYGELVKEVIGGVNDLEAQG----SDDDEKGDTLKLFGVLLKENKKKRG  253

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+N D S +  K MK ++D  N PWMK+S  PG+S KVCN
Sbjct  254  PDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKVCN  292



>ref|XP_006339901.1| PREDICTED: heat shock factor protein HSF24-like [Solanum tuberosum]
Length=302

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 122/166 (73%), Gaps = 6/166 (4%)
 Frame = -1

Query  822  KNPGSVDTPGKS-QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            KNPGSVDTPGKS QF DL+DENEKLK+DNQMLSSEL Q KKQC ELV FL+QYVKV P+ 
Sbjct  138  KNPGSVDTPGKSSQFTDLSDENEKLKKDNQMLSSELVQAKKQCNELVAFLSQYVKVAPDM  197

Query  645  INRIMSQGI-SGSSHDDSINKVDNSADL---NSSQNKddddddDENGETLKLFGVLLKEK  478
            INRIMSQG  SGSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEK
Sbjct  198  INRIMSQGTPSGSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEK  257

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            K+KR  D+N D      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  258  KKKRGPDENIDTCGGRGKMMKTTVDY-NGPWMKMSSAAGESSKVCN  302



>ref|XP_004232034.1| PREDICTED: heat shock factor protein HSF24 [Solanum lycopersicum]
Length=301

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = -1

Query  822  KNPGSVDTPGK-SQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            KNPGSVDTPGK SQF DL+DENEKLK+DNQMLSSEL Q KKQC ELV FL+QYVKV P+ 
Sbjct  138  KNPGSVDTPGKLSQFTDLSDENEKLKKDNQMLSSELVQAKKQCNELVAFLSQYVKVAPDM  197

Query  645  INRIMSQGI-SGSSHDDSINKVDNSADL---NSSQNKddddddDENGETLKLFGVLLKEK  478
            INRIMSQG  SGSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEK
Sbjct  198  INRIMSQGTPSGSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEK  257

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            K+KR  DDN +      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  258  KKKRGPDDNIETCGGRGKMMK-TVDY-NGPWMKMSSTAGESSKVCN  301



>sp|P22335.1|HSF24_SOLPE RecName: Full=Heat shock factor protein HSF24; AltName: Full=Heat 
shock transcription factor 24; Short=HSTF 24; AltName: 
Full=Heat stress transcription factor [Solanum peruvianum]
 emb|CAA39034.1| heat stress transcription factor [Solanum peruvianum]
Length=301

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = -1

Query  822  KNPGSVDTPGK-SQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            KNPGSVDTPGK SQF DL+DENEKLK+DNQMLSSEL Q KKQC ELV FL+QYVKV P+ 
Sbjct  138  KNPGSVDTPGKLSQFTDLSDENEKLKKDNQMLSSELVQAKKQCNELVAFLSQYVKVAPDM  197

Query  645  INRIMSQGI-SGSSHDDSINKVDNSADL---NSSQNKddddddDENGETLKLFGVLLKEK  478
            INRIMSQG  SGSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEK
Sbjct  198  INRIMSQGTPSGSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEK  257

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            K+KR  D+N +      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  258  KKKRGPDENIETCGGRGKMMK-TVDY-NGPWMKMSSPAGESSKVCN  301



>ref|XP_002277765.2| PREDICTED: heat shock factor protein HSF24 [Vitis vinifera]
 emb|CBI21429.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 108/162 (67%), Gaps = 15/162 (9%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +QF DL+DENEKLK+DN+ LS+ELAQTK+QCEEL+ FLT+YVKV P+Q
Sbjct  140  SKNPGSVETTTTAQFADLSDENEKLKKDNESLSTELAQTKRQCEELIAFLTEYVKVAPDQ  199

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM Q   GS H   + ++  S D +    KD+D ++    E+LKLFGV LK KK KR
Sbjct  200  INRIMKQESCGSGHGGLVGEIGGSVDDDDDDEKDEDPNE----ESLKLFGVWLKGKK-KR  254

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++   +     KEMK ++D + APWM        + KVCN
Sbjct  255  GREEKMGYGGPHQKEMK-TVDFE-APWM--------TSKVCN  286



>dbj|BAI99728.1| heat stress transcription factor [Carica papaya]
Length=278

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 86/136 (63%), Gaps = 12/136 (9%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T G +QF DL+DENEKLKRDNQMLSSELA  KKQC+EL+ FLT+YVKV P+QI
Sbjct  139  KNPGSVETAGTAQFADLSDENEKLKRDNQMLSSELAHAKKQCDELIAFLTEYVKVGPDQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            NRIM QG  GS  D          D +               E LKLFGV +K +KRKRD
Sbjct  199  NRIMRQGNCGSIFDGPGGVAPGGDDGDGEG------------EGLKLFGVWVKGEKRKRD  246

Query  462  HDDNTDFSAASTKEMK  415
             D+N  FS    K  K
Sbjct  247  DDENMGFSGTQLKGTK  262



>emb|CDP02491.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 113/170 (66%), Gaps = 9/170 (5%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SK+PGSVDT    QF DL+DENEKLK+DNQMLSSELAQTKKQC++LV FLT++V V P+Q
Sbjct  142  SKSPGSVDTLSAEQFADLSDENEKLKKDNQMLSSELAQTKKQCDDLVAFLTKHVNVAPDQ  201

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGV-LLKEKKRK  469
            IN IM+QG +    + + N       ++S +  DDDDD++ NG +LKLFGV LL EK RK
Sbjct  202  INSIMNQGAAVGEMNFNENNCVVDDRVDSKEADDDDDDENGNGGSLKLFGVTLLTEKNRK  261

Query  468  RDHDDNTDFSAASTKEMKPSIDCKN----APWMKISPVPGKSGKVCN*RA  331
            R  DD  D   A   E++P  D K     APWM+I+   G++ K    +A
Sbjct  262  RGRDD-MDVGYA---EVRPRKDVKTLDFCAPWMRIASCAGETSKAAGQKA  307



>emb|CAN61780.1| hypothetical protein VITISV_028661 [Vitis vinifera]
Length=354

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 7/148 (5%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +QF DL+DENEKLK+DN+ LS+ELAQTK+QCEEL+ FLT+YVKV P+Q
Sbjct  188  SKNPGSVETTTTAQFADLSDENEKLKKDNESLSTELAQTKRQCEELIAFLTEYVKVAPDQ  247

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM Q   GS H   + ++  S D +    KD+D ++    E+LKLFGV LK KK KR
Sbjct  248  INRIMKQESCGSGHGGLVGEIGGSVDDDDDDEKDEDPNE----ESLKLFGVWLKGKK-KR  302

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWM  382
              ++   +     KEMK ++D + APWM
Sbjct  303  GREEKMGYGGPHQKEMK-TVDFE-APWM  328



>ref|XP_007047250.1| Heat shock factor 4 [Theobroma cacao]
 gb|EOX91407.1| Heat shock factor 4 [Theobroma cacao]
Length=299

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 110/171 (64%), Gaps = 16/171 (9%)
 Frame = -1

Query  825  SKNPGSVDT--PGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVP  652
            SKNPGSV+T     +QF DL+DENEKLK+DN+MLSSELAQ KKQC+ELV FLT+ VKV P
Sbjct  136  SKNPGSVETTPAAVTQFADLSDENEKLKKDNEMLSSELAQAKKQCDELVAFLTECVKVGP  195

Query  651  EQINRIMSQGISGSSH--DDSINKVDNSADLNSSQNKddddddDENG-----ETLKLFGV  493
            +QINRIM QG  GS+   DD     D     +  Q  DDDDDDDE G      +LKLFGV
Sbjct  196  DQINRIMRQGSFGSTRDADDRGRTHDVDDLDDHDQVDDDDDDDDEKGGKEGNGSLKLFGV  255

Query  492  LLKEKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             LK  +RKR  ++   +     KEMK ++D ++ P +       KSGKVCN
Sbjct  256  WLKGAERKRAREEKIVYGGPHAKEMK-TVDFRHVPLVM------KSGKVCN  299



>ref|XP_011099137.1| PREDICTED: heat shock factor protein HSF24 [Sesamum indicum]
Length=271

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 101/161 (63%), Gaps = 28/161 (17%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGS++T   +Q  DL+ ENEKL++DNQMLSSELAQT+KQC+EL+ FLTQ VKV PEQI
Sbjct  139  KNPGSLETHVSAQLADLSGENEKLRKDNQMLSSELAQTRKQCDELIAFLTQRVKVAPEQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            + IM+  + G + D   ++ +N                      +KLFGV++   K+KR 
Sbjct  199  SHIMNLQVGGGNSDCDDHETEN---------------------CMKLFGVMV---KKKRG  234

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              +NTDFS  + KE K S++  + PW+KIS    +S KVCN
Sbjct  235  CSENTDFSGPNRKETKTSMEV-SVPWLKISE---ESSKVCN  271



>gb|KJB17912.1| hypothetical protein B456_003G023500 [Gossypium raimondii]
Length=295

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 103/166 (62%), Gaps = 15/166 (9%)
 Frame = -1

Query  825  SKNPGSVDT---PGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVV  655
            SKNPGSV+T      +Q+ DL+DENEKLK+DN+MLSSELAQ KKQC+ELV FLT+ VKV 
Sbjct  141  SKNPGSVETTPAANTNQYADLSDENEKLKKDNEMLSSELAQAKKQCDELVAFLTECVKVG  200

Query  654  PEQINRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGE-TLKLFGVLLKEK  478
            P+QI+RIM QG  GS    ++   D         N DD+    E+G  +LKLFGV LK  
Sbjct  201  PDQIDRIMRQGNGGS----TLEGDDLGCFYGVDDNDDDEKGGGEDGNGSLKLFGVWLKSA  256

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             +KR  ++   +     KEMK +ID ++   M       KSGKVCN
Sbjct  257  GKKRAREEKIVYGGPHAKEMK-TIDFRHVALMM------KSGKVCN  295



>gb|AII99897.1| heat shock transcription factor [Gossypium hirsutum]
Length=295

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 105/167 (63%), Gaps = 17/167 (10%)
 Frame = -1

Query  825  SKNPGSVDTP---GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVV  655
            SKNPGSV+T      +Q+ DL+DENEKLK+DN+MLSSELAQ KKQC+ELV FLT+ VKV 
Sbjct  141  SKNPGSVETTPAVNTNQYADLSDENEKLKKDNEMLSSELAQAKKQCDELVAFLTECVKVG  200

Query  654  PEQINRIMSQGISGSS-HDDSINKVDNSADLNSSQNKddddddDENGE-TLKLFGVLLKE  481
            P+QI+RIM QG  GS+   D + +     D     N DD+    E+G  +LKLFGV LK 
Sbjct  201  PDQIDRIMRQGNGGSTLEGDDLGRFYGVDD-----NDDDEKGGGEDGNGSLKLFGVWLKS  255

Query  480  KKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              +KR  ++   +     KEMK ++D ++   M       KSGKVCN
Sbjct  256  AGKKRAREEKIVYGGPHAKEMK-TVDFRHVALMM------KSGKVCN  295



>ref|XP_012079229.1| PREDICTED: heat shock factor protein HSF24 [Jatropha curcas]
 gb|KDP31930.1| hypothetical protein JCGZ_12391 [Jatropha curcas]
Length=288

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = -1

Query  825  SKNPGSVDTPGKS----QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKV  658
            SKNPGSV+T        QF DL+ ENEKLK+DN+MLSSELAQ KKQC+EL+ FLT+YVKV
Sbjct  141  SKNPGSVETAATMTATAQFADLSGENEKLKKDNEMLSSELAQAKKQCDELIAFLTEYVKV  200

Query  657  VPEQINRIMSQGIS-GSSHDDSINKVDNSADLN---SSQNKddddddDENGETLKLFGVL  490
             P+QINRIM QG S GS+ D  ++     AD +    S NKDD+ DD    ++ KLFGVL
Sbjct  201  GPDQINRIMRQGSSCGSTLDGLVSGATAGADDHDDDESGNKDDEGDDGGKVQSFKLFGVL  260

Query  489  LKEKKRKRDHDDNTDFSAASTKEMK  415
            L+ K +KR   +N  F+    KE+K
Sbjct  261  LEGKTKKRGRVENIGFAGPHAKEIK  285



>ref|XP_006425894.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
 gb|ESR39134.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
Length=270

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 97/162 (60%), Gaps = 26/162 (16%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKN GSV+T   ++F DL+DEN KL+RDN+ LSSELAQ KKQC+EL+TFLT+YVKV P+Q
Sbjct  135  SKNQGSVET---AKFADLSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVKVGPDQ  191

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM QG  GS  D  +   D+     SS            G  LKLFGV LK +++KR
Sbjct  192  INRIMGQGSCGSILDGLVGDTDDDEKKESS------------GGDLKLFGVWLKGERKKR  239

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++        + EMK    C  AP++       KS KVCN
Sbjct  240  AREETV--VCGGSHEMKKVEFC--APYI-------KSSKVCN  270



>ref|XP_006425895.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
 gb|ESR39135.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
Length=329

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 97/162 (60%), Gaps = 26/162 (16%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKN GSV+T   ++F DL+DEN KL+RDN+ LSSELAQ KKQC+EL+TFLT+YVKV P+Q
Sbjct  194  SKNQGSVET---AKFADLSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVKVGPDQ  250

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM QG  GS  D  +   D+     SS            G  LKLFGV LK +++KR
Sbjct  251  INRIMGQGSCGSILDGLVGDTDDDEKKESS------------GGDLKLFGVWLKGERKKR  298

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++        + EMK    C  AP++       KS KVCN
Sbjct  299  AREETV--VCGGSHEMKKVEFC--APYI-------KSSKVCN  329



>gb|KDO79222.1| hypothetical protein CISIN_1g026263mg [Citrus sinensis]
Length=241

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 99/162 (61%), Gaps = 26/162 (16%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKN GSV+T   ++F DL+DEN KL+RDN+ LSSELAQ KKQC+EL+TFLT+YVKV P+Q
Sbjct  106  SKNQGSVET---AKFADLSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVKVGPDQ  162

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM QG  GS  D  +   D+   + SS            G  LKLFGV LK +++KR
Sbjct  163  INRIMGQGSCGSILDGLVGDTDDDEKMESS------------GGDLKLFGVWLKGERKKR  210

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++        + EMK  ++ + AP++        S KVCN
Sbjct  211  AREETV--VCGGSHEMK-KVEFR-APYI-------NSSKVCN  241



>ref|XP_006466606.1| PREDICTED: heat shock factor protein HSF24-like [Citrus sinensis]
Length=270

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 99/162 (61%), Gaps = 26/162 (16%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKN GSV+T   ++F DL+DEN KL+RDN+ LSSELAQ KKQC+EL+TFLT+YVKV P+Q
Sbjct  135  SKNQGSVET---AKFADLSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVKVGPDQ  191

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            INRIM QG  GS  D  +   D+   + SS            G  LKLFGV LK +++KR
Sbjct  192  INRIMGQGSCGSILDGLVGDTDDDEKMESS------------GGDLKLFGVWLKGERKKR  239

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++        + EMK  ++ + AP++        S KVCN
Sbjct  240  AREETV--VCGGSHEMK-KVEFR-APYI-------NSSKVCN  270



>ref|XP_010263545.1| PREDICTED: heat shock factor protein HSF24-like [Nelumbo nucifera]
Length=291

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 98/164 (60%), Gaps = 14/164 (9%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKN  S +        DL+DENEKL++DNQ+L+SELAQ KKQCEE++ FL++YV V P+Q
Sbjct  140  SKNHPSGEATVTQHLWDLSDENEKLRKDNQLLNSELAQKKKQCEEIIAFLSKYVSVSPDQ  199

Query  645  INRIMSQGISGS-SHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRK  469
            INRIM QG  GS SHD  ++K +N  D            + E   +LKLFGV LK  KR 
Sbjct  200  INRIMMQGRKGSNSHDGLLDKKENDDD------------EKEENVSLKLFGVWLKGSKRG  247

Query  468  RDHDDNTDFSAASTKEMKPSIDCKN-APWMKISPVPGKSGKVCN  340
            R+ +     +     + K  +D +   PWMKI+   G++ KVCN
Sbjct  248  REENGVISGTRTPPLKKKKRMDFEAPWPWMKINSSSGETSKVCN  291



>gb|KJB71093.1| hypothetical protein B456_011G105700 [Gossypium raimondii]
Length=284

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 106/166 (64%), Gaps = 25/166 (15%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +QF DL++EN+KLKRDN+MLS ELAQ K++C+ELV FLT+ VKV P+Q
Sbjct  140  SKNPGSVET---NQFTDLSEENQKLKRDNEMLSIELAQAKRKCDELVAFLTECVKVGPDQ  196

Query  645  INRIMSQGISGSSHDDS----INKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK  478
            INRIM QG  GS+ +      I  VD+  D  +S+         E+   LKLFGV LK  
Sbjct  197  INRIMPQGSCGSTINGEGPGRICGVDD--DEKTSE---------EDMGGLKLFGVWLKGV  245

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            ++KR  +++  +     KEMK ++D ++ P +       +SGKVC+
Sbjct  246  EKKRAREESIMYGGPHAKEMK-TVDFRHVPLVM------ESGKVCS  284



>ref|XP_010093647.1| Heat shock factor protein HSF24 [Morus notabilis]
 gb|EXB54408.1| Heat shock factor protein HSF24 [Morus notabilis]
Length=406

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKS-QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPE  649
            SKNPGSV+T   + QF DL+DENEKLK+DN++L+S+LAQTKKQC+EL+TFLT+Y+KV P+
Sbjct  174  SKNPGSVETAAVTVQFADLSDENEKLKKDNEVLTSKLAQTKKQCDELITFLTKYMKVGPD  233

Query  648  QINRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK---  478
            QINRIM QGI+  S     ++ D+  + +   + DD ++     E LKLFGV L+ K   
Sbjct  234  QINRIMRQGINCGSTRGGEDRDDDENEADDHDDGDDGEE-----EGLKLFGVWLRGKDHN  288

Query  477  ------KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMK  379
                  K+KR   + T F+    K+MK  +D    P M+
Sbjct  289  EKDQKNKKKRTRGEETGFTGPHAKKMK-GVDFHAPPLMQ  326



>gb|KHG26651.1| Heat shock factor HSF24 [Gossypium arboreum]
Length=284

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 101/162 (62%), Gaps = 17/162 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +QF DL++ENEKLKRD +MLS ELAQ K++C+ELV FLT+ VKV P+Q
Sbjct  140  SKNPGSVET---NQFADLSEENEKLKRDKEMLSIELAQAKRKCDELVAFLTECVKVEPDQ  196

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKR  466
            IN IM QG  GS    +IN  D         ++      +E+  +LKLFGV LK  ++KR
Sbjct  197  INGIMRQGSCGS----TINGEDPGRICGVDDDE---KTSEEDMGSLKLFGVWLKGVEKKR  249

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              ++   +     KEMK +++ ++ P +       +SGKVCN
Sbjct  250  AREETIMYGGPHAKEMK-TVEFRHVPLVM------ESGKVCN  284



>ref|XP_010269874.1| PREDICTED: heat shock factor protein HSF24 [Nelumbo nucifera]
Length=303

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%), Gaps = 15/170 (9%)
 Frame = -1

Query  822  KNPGSVDTPGKS--QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPE  649
            KN  S +T   +     DL+DENEKL++DNQ+LSSEL QTKKQCEEL+ FL++Y+ V PE
Sbjct  140  KNHASDETTATATQHLSDLSDENEKLRKDNQLLSSELEQTKKQCEELIAFLSKYINVPPE  199

Query  648  QINRIMSQGISGSSHDDSINK--VDNSADLNSSQNKddddddDENG---ETLKLFGVLLK  484
            QINRIM QG    S +D ++   VD+  + N+ + ++  D+D++     ++LKLFGV LK
Sbjct  200  QINRIMMQG----SDNDRLSMLLVDDKKNNNNKEEEEKGDEDEKGEEERQSLKLFGVWLK  255

Query  483  EKKRKRDHDDNTDFSAAST--KEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             KKR R+       +++S+  K+MK  +D  +APWMKIS  PG++ +VCN
Sbjct  256  GKKRMREEKGEGGGASSSSLKKQMK-RMDF-DAPWMKISSSPGETSEVCN  303



>gb|ADL36733.1| HSF domain class transcription factor [Malus domestica]
Length=294

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 101/170 (59%), Gaps = 21/170 (12%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  +L+DEN+KLKR+N+ L+SELAQTKKQC ELV FL +YVK+ PEQ
Sbjct  138  SKNPGSVETATLSQVVNLSDENKKLKRENENLNSELAQTKKQCNELVGFLVKYVKMGPEQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE----K  478
            INRI+ +G  G + DD         D     N D  DDD+E  E LKLFGV +K     K
Sbjct  198  INRIIGRGSYGPTCDDF-----EPNDRGLGLNMDGGDDDEEEKEGLKLFGVWVKGDEKMK  252

Query  477  KRKRDHDDNTDFSAAS----TKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             +K   D+    S  S    TK MK  +D  + P M       +SGKVCN
Sbjct  253  GKKTGRDEKLGVSGISGVPRTKRMKGGVDF-HVPMM-------RSGKVCN  294



>ref|XP_008340075.1| PREDICTED: heat shock factor protein HSF24 [Malus domestica]
Length=294

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 101/170 (59%), Gaps = 21/170 (12%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  +L+DEN+KLKR+N+ L+SELAQTKKQC ELV FL +YVK+ PEQ
Sbjct  138  SKNPGSVETATLSQVVNLSDENKKLKRENENLNSELAQTKKQCNELVGFLVKYVKMGPEQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE----K  478
            INRI+ +G  G + DD     +    LN        DDD+E  E LKLFGV +K     K
Sbjct  198  INRIIGRGSYGPTCDD-FEXNBRGLGLNMDGG----DDDEEEKEGLKLFGVWVKGDEKMK  252

Query  477  KRKRDHDDNTDFSAAS----TKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             +K   D+    S  S    TK MK  +D  + P M       +SGKVCN
Sbjct  253  GKKTGRDEKLGVSGISGVPRTKRMKGGVDF-HXPMM-------RSGKVCN  294



>ref|XP_009375707.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
 ref|XP_009350716.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
Length=295

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 103/171 (60%), Gaps = 22/171 (13%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  DL+DENEKLKR+N+ L+SELAQTKKQC+ELV FL +++K+ P+Q
Sbjct  138  SKNPGSVETAAPSQVSDLSDENEKLKRENENLNSELAQTKKQCDELVGFLVEHMKMKPDQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK----  478
            INRI+ QGI G S DD     D+  DL+     D+++++    E LKLFGV +K +    
Sbjct  198  INRIIGQGICGPSGDD-FEADDHGLDLDMEGGDDEEEEE----EGLKLFGVWVKGEEKMK  252

Query  477  -----KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
                 + ++             K MK  ++  +AP M       ++GKVCN
Sbjct  253  GKKTGRYEKLGVGGGGAGGPRAKRMKGGVEF-HAPMM-------RTGKVCN  295



>gb|KJB71094.1| hypothetical protein B456_011G105700 [Gossypium raimondii]
Length=276

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 101/166 (61%), Gaps = 33/166 (20%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +QF DL++EN+KLKRDN+MLS ELAQ K++C+ELV FLT+ VKV P+Q
Sbjct  140  SKNPGSVET---NQFTDLSEENQKLKRDNEMLSIELAQAKRKCDELVAFLTECVKVGPDQ  196

Query  645  INRIMSQGISGSSHDDS----INKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK  478
            INRIM QG  GS+ +      I  VD+  D  +S+         E+   LKLFGV LK  
Sbjct  197  INRIMPQGSCGSTINGEGPGRICGVDD--DEKTSE---------EDMGGLKLFGVWLK--  243

Query  477  KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
                   ++  +     KEMK ++D ++ P +       +SGKVC+
Sbjct  244  ------GESIMYGGPHAKEMK-TVDFRHVPLVM------ESGKVCS  276



>gb|KJB40253.1| hypothetical protein B456_007G053900 [Gossypium raimondii]
Length=295

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 105/170 (62%), Gaps = 18/170 (11%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQ--FPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVP  652
            SKNPGSV+T  ++   F +L++ENEKLK+ N++LSSELAQ KKQC+ELV FLT+ VKV P
Sbjct  136  SKNPGSVETKQETMNVFSNLSNENEKLKKHNELLSSELAQAKKQCDELVAFLTERVKVSP  195

Query  651  EQINRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGE-----TLKLFGVLL  487
            +Q NRIM QG   S+ DD  +     A      +  D DDDDENG      +LKLFGV L
Sbjct  196  DQFNRIMRQGSYDSTRDDDDHGRRYGA---GDPDDHDHDDDDENGSQDWNGSLKLFGVWL  252

Query  486  KEKKRKR-DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            K   +KR   +    +     K+MK ++D  +A  M++     KSGKVCN
Sbjct  253  KGAGKKRLPKEKKIVYGEPYAKQMK-TVDFNHAG-MRM-----KSGKVCN  295



>ref|XP_008352525.1| PREDICTED: heat shock factor protein HSF24-like, partial [Malus 
domestica]
Length=230

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  DL+DEN+KLKR+N+ L+SELAQTKKQC+ELV FL +++K+ P+Q
Sbjct  72   SKNPGSVETAAPSQVADLSDENQKLKRENENLNSELAQTKKQCDELVGFLVEHMKMKPDQ  131

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL  487
            INRI+ QGI G   DD     D+  DL+     D++++     E LKLFGV +
Sbjct  132  INRIIGQGICGPXGDD-FEADDHGLDLDMEGGDDEEEE-----EGLKLFGVWV  178



>ref|XP_009367059.1| PREDICTED: heat shock factor protein HSF24 [Pyrus x bretschneideri]
Length=294

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 100/170 (59%), Gaps = 21/170 (12%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  DL+DEN+KLKR+N+ L+SELAQTKKQC+ELV FL +YVK+ PEQ
Sbjct  138  SKNPGSVETTTLSQVADLSDENKKLKRENENLNSELAQTKKQCDELVGFLVEYVKMGPEQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLK--EKKR  472
            INRI+ +G  G + DD         D     + D  DDD+E  E LKLFGV +K  EK +
Sbjct  198  INRIIRRGSYGPTRDDF-----EPDDRGLGLDMDGGDDDEEEKEGLKLFGVWVKGDEKMK  252

Query  471  KRDHDDNTDFSAAST------KEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             +    +  F           K MK  +D  +A  M       +SGKVCN
Sbjct  253  GKKTGRDEKFGVCGVGGVPRAKRMKGGVDF-HASMM-------RSGKVCN  294



>ref|XP_004288037.1| PREDICTED: heat shock factor protein HSF24 [Fragaria vesca subsp. 
vesca]
Length=290

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = -1

Query  825  SKNPGSVDTP-GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPE  649
            SKNPGSV+T        DL+DENEKLK+DN+ LSSELAQTKKQC+ELV FL +Y+KV P+
Sbjct  137  SKNPGSVETAVAVGHTADLSDENEKLKKDNETLSSELAQTKKQCDELVAFLMEYMKVGPD  196

Query  648  QINRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLK  484
            QIN+IM QG  GSS D      D+      + N +     +E G  LKLFGV +K
Sbjct  197  QINKIMRQGSFGSSCDGD----DHERGTGENDNDEKVVAGEEEG--LKLFGVWVK  245



>ref|XP_008338368.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-1-like [Malus domestica]
Length=294

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   SQ  DL+DEN+KLKR+N+ L+SELAQTKKQC+ELV FL +++K+ P+Q
Sbjct  138  SKNPGSVETAAPSQVADLSDENQKLKRENENLNSELAQTKKQCDELVGFLVEHMKMKPDQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL  487
            INRI+ QGI G   DD     D+  DL+     D++++     E LKLFGV +
Sbjct  198  INRIIGQGICGPXGDD-FEADDHGLDLDMEGGDDEEEE-----EGLKLFGVWV  244



>ref|XP_008241456.1| PREDICTED: heat shock factor protein HSF24 [Prunus mume]
Length=288

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 95/166 (57%), Gaps = 19/166 (11%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPG+V+T    Q  DL+ ENEKLK++N+ LSSELAQTKKQC+ELV FL  Y+KV P+Q
Sbjct  138  SKNPGAVETAAMGQASDLSGENEKLKKENENLSSELAQTKKQCDELVGFLMDYLKVGPDQ  197

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLK---EKK  475
            INRIM QG   S+ D+  N+ D++ D +    K          E LKLFGV +K   +KK
Sbjct  198  INRIMRQGSYVSTRDEDENEDDDADDDDDDDGKQK--------EGLKLFGVWVKGDEKKK  249

Query  474  RKR-DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             KR + D+        T   K       AP +       K GKVCN
Sbjct  250  SKRTERDEKFGVGVGGTYAKKMKRAEFGAPML-------KRGKVCN  288



>ref|XP_007202372.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
 gb|EMJ03571.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
Length=299

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 95/169 (56%), Gaps = 14/169 (8%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T    Q  DL+ ENEKLK++N+ LSSELAQTKKQC+ELV FL  Y+KV P+Q
Sbjct  138  SKNPGSVETAAMGQASDLSGENEKLKKENENLSSELAQTKKQCDELVGFLMDYLKVGPDQ  197

Query  645  INRIMSQG-ISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL------  487
            INRIM QG    +  +D     D   D + +   DDDDDD +  E LKLFGV +      
Sbjct  198  INRIMRQGSYVPTRDEDEDEDDDLDFDRDENDAADDDDDDGKQKEGLKLFGVWVKGNEKK  257

Query  486  KEKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            K K+ +RD           T   K       AP +       KSGKVCN
Sbjct  258  KSKRTERDEKFGVGIGVGGTYAKKMKSAEFGAPMV-------KSGKVCN  299



>ref|XP_004141916.1| PREDICTED: heat shock factor protein HSF24 [Cucumis sativus]
 gb|KGN48523.1| hypothetical protein Csa_6G490870 [Cucumis sativus]
Length=290

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 12/117 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            + NPGSVD    +QF DLT+EN+KL++DN+ML+SEL QTKKQC+ELV FLT Y+KV P+Q
Sbjct  137  TSNPGSVDMGTIAQFADLTEENDKLRKDNEMLNSELVQTKKQCDELVAFLTDYLKVAPDQ  196

Query  645  INRIMSQGISGSSHDDSINKV--DNSADLNSS--QNKddddddDENGETLKLFGVLL  487
            INRIM Q        ++ N+V  +  AD   S  + ++++++++E GETLKLFGV L
Sbjct  197  INRIMKQ--------EANNRVCSEGGADNGRSEDEEEEEEEEEEEEGETLKLFGVWL  245



>ref|XP_008440278.1| PREDICTED: LOW QUALITY PROTEIN: heat shock factor protein HSF24 
[Cucumis melo]
Length=290

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            + NPGSV+    +QF DLT+EN+KL++DN+ML+SEL QTKKQC+ELV FLT Y+KV P+Q
Sbjct  137  TSNPGSVEMGTIAQFADLTEENDKLRKDNEMLNSELVQTKKQCDELVAFLTDYLKVAPDQ  196

Query  645  INRIMSQ  625
            INRIM Q
Sbjct  197  INRIMKQ  203



>ref|XP_011043547.1| PREDICTED: heat shock factor protein HSF24 [Populus euphratica]
Length=288

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 12/148 (8%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+T   +Q  DL+ ENE+LK+DN +LSSEL Q KKQC EL+ FLT+YVKV P+Q
Sbjct  139  SKNPGSVET-AATQVADLSIENEQLKKDNDVLSSELEQAKKQCGELINFLTEYVKVSPDQ  197

Query  645  INRIMSQGISGSSHDDSIN----------KVDNSADLNSSQNKddddddDENGETLKLFG  496
            INRI+  G S  + +  +             D +   ++  +  D D D   G  LKLFG
Sbjct  198  INRIIGCGGSTCNGEADVGDNQSEDDDDDDDDENTSDDTDHDDTDHDGDGGEGGGLKLFG  257

Query  495  VLLK-EKKRKRDHDDNTDFSAASTKEMK  415
            VLLK + K+KR  D+         KE+K
Sbjct  258  VLLKCQNKKKRGRDEKMGLGGPRAKEIK  285



>ref|XP_007155926.1| hypothetical protein PHAVU_003G244000g [Phaseolus vulgaris]
 gb|ESW27920.1| hypothetical protein PHAVU_003G244000g [Phaseolus vulgaris]
Length=278

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 88/155 (57%), Gaps = 19/155 (12%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            S + GSV+    SQ  DL+ ENEKLK+DN+ LS ELA+ KKQC ELV+FL + + V P+ 
Sbjct  128  STSTGSVEGATTSQCADLSGENEKLKKDNEKLSGELARAKKQCNELVSFLRESLNVCPDV  187

Query  645  INRIMSQGISGSSHDDSIN--KVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK--  478
            INRI+ QG  GSS DD++    + +  D N+        DD+  GE+LKLFGV LK +  
Sbjct  188  INRIIRQGTCGSS-DDAVRFECIRDDDDENAVGECGAKVDDERGGESLKLFGVWLKGENG  246

Query  477  -----------KRKRDHDDNTDFSAASTKEMKPSI  406
                        RKR  DD     A + KE+K  +
Sbjct  247  NEEDKVKIGTNWRKRGRDDPM---AGTAKELKTLV  278



>ref|XP_010432090.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=288

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 91/162 (56%), Gaps = 17/162 (10%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PE+I
Sbjct  143  KNPGSVE----NMVADLSGENEKLKRENNSLSSELAAAKKQRDELVTFLTDHLKVKPEKI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            ++++  G  G       +  + S+D     N    D+    GE LKLFGV LK +++KR 
Sbjct  199  DQMIKGG--GKFKPVLESDEEESSDCEGCDNGGGADEGV--GEGLKLFGVWLKGERKKRG  254

Query  462  HDDNTDFSAAS-TKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+N      S   E+K ++D     W        KS KVCN
Sbjct  255  RDENNYVVGGSHMTEVKKNVDFHAPLW--------KSSKVCN  288



>gb|ACJ85410.1| unknown [Medicago truncatula]
Length=248

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 84/168 (50%), Gaps = 27/168 (16%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T    Q  +L+ ENEKLK+DN+ L+ ELA+ KKQCEELV FL   + V P+QI
Sbjct  101  KNPGSVETTTLPQCVNLSSENEKLKKDNETLNCELARAKKQCEELVAFLKDNLNVGPDQI  160

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-----  478
            +RIM Q        +    V N+   N    +          + LKLFGV L+E+     
Sbjct  161  DRIMKQ------QGNCCESVQNAVGENEESGR----------DCLKLFGVWLREENYTNE  204

Query  477  --KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
               +KR  +D   F     K     +D      + +     KSGKVCN
Sbjct  205  RNNKKRGCEDQLSFGGPRAKVGNNVVDFSAVNVVNMM----KSGKVCN  248



>ref|XP_010446698.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=289

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 92/163 (56%), Gaps = 19/163 (12%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSEL   KKQ +ELVTFLT ++KV PE+I
Sbjct  144  KNPGSVE----NMVADLSGENEKLKRENNSLSSELEAAKKQRDELVTFLTDHLKVKPEKI  199

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            +++    I G      + + D   + +S         D+  GE LKLFGV LK +++KRD
Sbjct  200  DQM----IKGGGKFKPVLESDEEEESSSDCEGCGGGADEGVGEGLKLFGVWLKGERKKRD  255

Query  462  HDDNTDFSAAS--TKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+N      S  TKE+K ++D     W        KS KVCN
Sbjct  256  RDENNYLVGGSHITKELK-NVDFHAPLW--------KSSKVCN  289



>gb|AAC31756.1| heat shock transcription factor 4 [Arabidopsis thaliana]
Length=284

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 22/162 (14%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  144  KNPGSVE----NMVADLSGENEKLKRENNNLSSELAAAKKQRDELVTFLTGHLKVRPEQI  199

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            ++++  G            V++  +            ++  GE LKLFGV LK +++KRD
Sbjct  200  DKMIKGG--------KFKPVESDEESECEGCDGGGGAEEGVGEGLKLFGVWLKGERKKRD  251

Query  462  HDD-NTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+ N   S +   E+K ++D     W        KS KVCN
Sbjct  252  RDEKNYVVSGSRMTEIK-NVDFHAPLW--------KSSKVCN  284



>ref|NP_195416.1| heat stress transcription factor B-1 [Arabidopsis thaliana]
 sp|Q96320.2|HSFB1_ARATH RecName: Full=Heat stress transcription factor B-1; Short=AtHsfB1; 
AltName: Full=AtHsf-16; AltName: Full=Heat shock factor 
protein 4; Short=HSF 4; AltName: Full=Heat shock transcription 
factor 4; Short=HSTF 4 [Arabidopsis thaliana]
 emb|CAB16764.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 emb|CAA74398.1| Heat Shock Factor 4 [Arabidopsis thaliana]
 emb|CAB80365.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 gb|AAM53318.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 gb|AAO30002.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 dbj|BAH30561.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86732.1| heat stress transcription factor B-1 [Arabidopsis thaliana]
Length=284

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 22/162 (14%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  144  KNPGSVE----NMVADLSGENEKLKRENNNLSSELAAAKKQRDELVTFLTGHLKVRPEQI  199

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            ++++  G            V++  +            ++  GE LKLFGV LK +++KRD
Sbjct  200  DKMIKGG--------KFKPVESDEESECEGCDGGGGAEEGVGEGLKLFGVWLKGERKKRD  251

Query  462  HDD-NTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+ N   S +   E+K ++D     W        KS KVCN
Sbjct  252  RDEKNYVVSGSRMTEIK-NVDFHAPLW--------KSSKVCN  284



>gb|KHN01274.1| Heat shock factor protein HSF24 [Glycine soja]
Length=286

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 85/142 (60%), Gaps = 22/142 (15%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSS  607
            Q  DL+ ENEKLK+DN+ LS ELA+TKK C++LV FL   + V P+ I+ I+ QG  GSS
Sbjct  146  QCADLSGENEKLKKDNEKLSDELARTKKHCDDLVAFLRDSLNVGPDVIDCIIRQGTCGSS  205

Query  606  HDDSINKVDNSADLNSSQNKddddddDE---------NGETLKLFGVLLKEKK-------  475
            +DD++ + D + +LN+  + DD++   E         NGE+LKLFGV LK +        
Sbjct  206  NDDAV-RFDATENLNNHNHDDDENAVGECEPEQPKGDNGESLKLFGVWLKGQNGKENSIG  264

Query  474  --RKRDHDDNTDFSAASTKEMK  415
              RKR   D     AA+ KE+K
Sbjct  265  SCRKRGRQDPI---AATAKELK  283



>ref|XP_010550365.1| PREDICTED: heat shock factor protein HSF24-like [Tarenaya hassleriana]
Length=281

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 87/163 (53%), Gaps = 28/163 (17%)
 Frame = -1

Query  819  NPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQIN  640
            NP SV T    QF +L+ ENEKL+R N++LSSELA  KKQCEELV FL++++KV  +QI+
Sbjct  144  NPASVTT----QFAELSGENEKLRRSNEILSSELASAKKQCEELVAFLSEFLKVGRDQID  199

Query  639  RIM---SQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRK  469
            +I+   S GI      D    V N  +   S N +        G  +K+FGV LK +K+K
Sbjct  200  QIIQRRSIGIVAGDGFDGGRGVGNEDEEKVSDNGEGL------GGDVKIFGVRLKCEKKK  253

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D++    A + K   P +               KS +VCN
Sbjct  254  RARDESIRGPARALKIHAPML---------------KSNRVCN  281



>gb|AFK42633.1| unknown [Medicago truncatula]
 gb|AFK47571.1| unknown [Medicago truncatula]
 gb|AES94709.2| heat shock transcription factor [Medicago truncatula]
Length=288

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 84/168 (50%), Gaps = 27/168 (16%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T    Q  +L+ ENEKLK+DN+ L+ ELA+ KKQCEELV FL   + V P+QI
Sbjct  141  KNPGSVETTTLPQCVNLSSENEKLKKDNETLNCELARAKKQCEELVAFLKDNLNVGPDQI  200

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-----  478
            +RIM Q        +    V N+   N    +          + LKLFGV L+E+     
Sbjct  201  DRIMKQ------QGNCCESVQNAVGENEESGR----------DCLKLFGVWLREENYTNE  244

Query  477  --KRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
               +KR  +D   F     K     +D      + +     KSGKVCN
Sbjct  245  RNNKKRGCEDQLSFGGPRAKVGNNVVDFSAVNVVNMM----KSGKVCN  288



>ref|XP_002866968.1| hypothetical protein ARALYDRAFT_490909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43227.1| hypothetical protein ARALYDRAFT_490909 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 84/161 (52%), Gaps = 21/161 (13%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  143  KNPGSVE----NMVADLSGENEKLKRENNNLSSELAAAKKQRDELVTFLTDHLKVRPEQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            ++++  G       D  ++ +      + +            E LKLFGV LK +++KRD
Sbjct  199  DQMIKGGKFKPVESDEESECEGCGGGGAEEGVG---------EGLKLFGVWLKGERKKRD  249

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+       S      ++D     W        KS KVCN
Sbjct  250  RDEKHYLVGGSGMTELKNVDFHAPLW--------KSSKVCN  282



>ref|XP_003550068.1| PREDICTED: heat shock factor protein HSF24-like [Glycine max]
Length=282

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 75/137 (55%), Gaps = 18/137 (13%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            D++ ENEKLK+DN+ LS ELA  KKQCEELV FL   + V P+ I RI+ QG   SS++D
Sbjct  145  DISGENEKLKKDNEKLSGELALAKKQCEELVAFLRDSLNVSPDVIERIIRQGTCVSSNND  204

Query  597  SI-------NKVDNSADLNSSQNKddddddDENGETLKLFGVLLK---------EKKRKR  466
            ++       N +D+  +              +NGE+LKLFGV LK          K RKR
Sbjct  205  AVRFDAIINNDLDDDENAVGECEPQQPPPKGDNGESLKLFGVWLKGQNGKENSIGKCRKR  264

Query  465  DHDDNTDFSAASTKEMK  415
               D     AA+ KE+K
Sbjct  265  GRQDYP--IAATAKELK  279



>ref|XP_010437260.1| PREDICTED: heat stress transcription factor B-1 [Camelina sativa]
Length=287

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 87/163 (53%), Gaps = 21/163 (13%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  144  KNPGSVE----NMVADLSGENEKLKRENNSLSSELAAAKKQRDELVTFLTDHLKVKPEQI  199

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSS--QNKddddddDENGETLKLFGVLLKEKKRK  469
            ++++  G            V  S +  SS  +       D+  GE LKLFGV LK +++K
Sbjct  200  DQMIKGG-------GKFKPVLESDEEESSDCEGCGGGGADEGVGEGLKLFGVWLKGERKK  252

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+N      S      ++D     W        KS KVCN
Sbjct  253  RGRDENNYVVGGSHMTELKNVDFHAPLW--------KSSKVCN  287



>ref|XP_010437261.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=286

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 87/163 (53%), Gaps = 21/163 (13%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  143  KNPGSVE----NMVADLSGENEKLKRENNSLSSELAAAKKQRDELVTFLTDHLKVKPEQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSS--QNKddddddDENGETLKLFGVLLKEKKRK  469
            ++++  G            V  S +  SS  +       D+  GE LKLFGV LK +++K
Sbjct  199  DQMIKGG-------GKFKPVLESDEEESSDCEGCGGGGADEGVGEGLKLFGVWLKGERKK  251

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+N      S      ++D     W        KS KVCN
Sbjct  252  RGRDENNYVVGGSHMTELKNVDFHAPLW--------KSSKVCN  286



>gb|ABV89640.1| heat shock factor 4 [Brassica rapa]
Length=285

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 88/163 (54%), Gaps = 16/163 (10%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            K+PGSV+    +   DL+ ENEKLKR+N  LSSELA  K+Q +ELV FLT+ +KV PEQI
Sbjct  137  KHPGSVE----NMVADLSGENEKLKRENSSLSSELAAAKRQRDELVAFLTEQMKVGPEQI  192

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDEN--GETLKLFGVLLKEKKRK  469
            ++++  G  G     ++ + ++  +     N     + ++   GE LKLFGV +K +++K
Sbjct  193  DQMIKGG--GKKLKPAVEEEESDCEGCGGDNGGAAVEGEKGVAGEGLKLFGVWVKGERKK  250

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+       S      ++D     W        KS KVCN
Sbjct  251  RGRDEKNFVVGGSHMTEIKNVDFHAPLW--------KSSKVCN  285



>ref|XP_009138768.1| PREDICTED: heat stress transcription factor B-1 [Brassica rapa]
 emb|CDY71121.1| BnaAnng36200D [Brassica napus]
Length=286

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 88/163 (54%), Gaps = 16/163 (10%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            K+PGSV+    +   DL+ ENEKLKR+N  LSSELA  K+Q +ELV FLT+ +KV PEQI
Sbjct  138  KHPGSVE----NMVADLSGENEKLKRENSSLSSELAAAKRQRDELVAFLTEQMKVGPEQI  193

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDEN--GETLKLFGVLLKEKKRK  469
            ++++  G  G     ++ + ++  +     N     + ++   GE LKLFGV +K +++K
Sbjct  194  DQMIKGG--GKKLKPAVEEEESDCEGCGGDNGGAAVEGEKGVVGEGLKLFGVWVKGERKK  251

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+       S      ++D     W        KS KVCN
Sbjct  252  RGRDEKNFVVGGSHMTEIKNVDFHAPLW--------KSSKVCN  286



>gb|KFK30320.1| hypothetical protein AALP_AA7G246600 [Arabis alpina]
Length=283

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 30/166 (18%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLK++N  LSSELA  KKQ +ELVTFLT+ +KV PEQI
Sbjct  143  KNPGSVE----NMVADLSGENEKLKKENNSLSSELAAAKKQRDELVTFLTEQMKVGPEQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
             ++++ G               + + NS       D+++  G  LKLFGV +K +++KR 
Sbjct  199  EKMINGGKF------------TTEEFNSDCEGCGGDEEEGVGGELKLFGVWVKGERKKRG  246

Query  462  HDD---NTDFSAASTK--EMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+   N  F    +   EMK ++D     W        KS KVCN
Sbjct  247  RDEIINNKSFVVGGSHMTEMK-NVDFHAPLW--------KSSKVCN  283



>gb|KHN36225.1| Heat shock factor protein HSF24 [Glycine soja]
Length=269

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 80/168 (48%), Gaps = 35/168 (21%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KN GSV+T   +    L+ ENEKLK+DN+ LS ELA+ +KQC+ELV FL   + V P+QI
Sbjct  130  KNQGSVET-NTTPSHQLSSENEKLKKDNETLSCELARARKQCDELVAFLRDRLMVGPDQI  188

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL-------K  484
            +RIM QG  GS +                        +   G+ LKLFGV L       K
Sbjct  189  DRIMRQGSCGSEN---------------------VVGEGGGGDCLKLFGVWLKGDTLTDK  227

Query  483  EKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
                KR  +D   F     KE KP +D      M       KS +VCN
Sbjct  228  RNNNKRGREDQMGFGGPRLKESKPVVDFGAVNVMM------KSNRVCN  269



>ref|XP_006284246.1| hypothetical protein CARUB_v10005408mg [Capsella rubella]
 gb|EOA17144.1| hypothetical protein CARUB_v10005408mg [Capsella rubella]
Length=288

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 84/161 (52%), Gaps = 17/161 (11%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  KKQ +ELVTFLT ++KV PEQI
Sbjct  145  KNPGSVE----NMVADLSGENEKLKRENNSLSSELAAAKKQRDELVTFLTDHLKVKPEQI  200

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
             +++  G       +   + D        + +++        E LKLFGV LK +++KR 
Sbjct  201  EKMIKGGKFKPVESEEGEESDCEGCHGGGEREEEGVG-----EGLKLFGVWLKGERKKRG  255

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+     A S      ++D     W        KS KVCN
Sbjct  256  RDEKNYVVAGSHMTEIKNVDFHAPLW--------KSSKVCN  288



>ref|NP_001241597.1| heat shock factor [Glycine max]
 emb|CAA87077.1| heat shock transcription factor 34 [Glycine max]
 gb|AFQ93674.1| heat shock transcription factor HSFB1 [Glycine max]
Length=282

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 80/168 (48%), Gaps = 35/168 (21%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KN GSV+T   +    L+ ENEKLK+DN+ LS ELA+ +KQC+ELV FL   + V P+QI
Sbjct  143  KNQGSVET-NTTPSHQLSSENEKLKKDNETLSCELARARKQCDELVAFLRDRLMVGPDQI  201

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL-------K  484
            +RIM QG  GS +                        +   G+ LKLFGV L       K
Sbjct  202  DRIMRQGSCGSEN---------------------VVGEGGGGDCLKLFGVWLKGDTLTDK  240

Query  483  EKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
                KR  +D   F     KE KP +D      M       KS +VCN
Sbjct  241  RNNHKRGREDQMGFGGPRLKESKPVVDFGAVNIMM------KSNRVCN  282



>ref|XP_004511933.1| PREDICTED: heat stress transcription factor B-1-like [Cicer arietinum]
Length=285

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 83/165 (50%), Gaps = 26/165 (16%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T    Q  +L+ ENEKL++DN+ LSSELA+ KKQC+ELV FL   + V P+QI
Sbjct  143  KNPGSVETT-IPQSANLSSENEKLRKDNETLSSELARAKKQCDELVGFLKDRLNVGPDQI  201

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK----K  475
            +RI+  G        S   V+N+                   + LKLFGV LKE+    K
Sbjct  202  DRILKDG--------SCEFVENAVGEEVEGGGGGRR------DCLKLFGVWLKEENLTDK  247

Query  474  RKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             KR  +    F     K  K  +D  +   +       KS K+CN
Sbjct  248  NKRAREQQLGFGGPRLKVTKTVVDFSDVNVI-------KSAKICN  285



>emb|CDY42722.1| BnaA03g53750D [Brassica napus]
Length=271

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (54%), Gaps = 17/163 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+    +   DL+ EN+KLKR+N  LSSELA  K+Q +ELV FLT  +KV PEQ
Sbjct  125  SKNPGSVE----NMVADLSGENKKLKRENDSLSSELAAAKRQRDELVAFLTDQLKVGPEQ  180

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDEN-GETLKLFGVLLKEKKRK  469
            I+++    + G     +I    +S + +  +    D  + E  GE LKLFGV +K +++K
Sbjct  181  IDQM----VKGGKFKPNITGDCSSEEESDCEGCGGDGVEKEGVGEGLKLFGVWVKGERKK  236

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+       S +    ++D     W        KS KVCN
Sbjct  237  RGRDEKNFVVGGSHRPDIKNVDFHAPLW--------KSSKVCN  271



>ref|XP_010028256.1| PREDICTED: heat shock factor protein HSF24 [Eucalyptus grandis]
Length=304

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSS  607
            QF DLT ENEKL+RDN+ L+SELAQ KK C+ELV FLT+ +KV P+QI+ I+ +G  G++
Sbjct  170  QFADLTGENEKLRRDNEALNSELAQAKKHCDELVAFLTECLKVAPDQIDHIVRRGCRGAA  229

Query  606  HDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK---KRKRDHDD  454
               +     +  D +   + +    + +  ++ KLFGV L  K    RKR  +D
Sbjct  230  AFAAAGDGADGVDRDDDDDDEKAAAEVDGEKSTKLFGVWLNGKGKEARKRARED  283



>ref|XP_006411927.1| hypothetical protein EUTSA_v10025906mg [Eutrema salsugineum]
 gb|ESQ53380.1| hypothetical protein EUTSA_v10025906mg [Eutrema salsugineum]
Length=287

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 88/161 (55%), Gaps = 16/161 (10%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+    +   DL+ ENEKLKR+N  LSSELA  K+Q +ELV FLT+ +KV PEQI
Sbjct  143  KNPGSVE----NMVADLSGENEKLKRENNSLSSELAAAKRQRDELVAFLTENLKVEPEQI  198

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            +    Q I+G       +++  + + +  +     ++++  GE LKLFGV LK +++KR 
Sbjct  199  D----QMINGGKFKPIASRISLTDEESDCEGCGGAEEEEGVGEGLKLFGVWLKGERKKRG  254

Query  462  HDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
             D+       S      ++D     W        KS KVCN
Sbjct  255  RDEKNFVVGGSHMTEIKNVDFHAPLW--------KSSKVCN  287



>ref|XP_003537320.1| PREDICTED: heat shock factor protein HSF24-like [Glycine max]
Length=285

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 72/147 (49%), Gaps = 28/147 (19%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KN GSV+T   +    L+ ENEKLK+DN+ LS ELA+ +KQC+ELV FL   + V P+QI
Sbjct  145  KNQGSVET-NTTPSHQLSSENEKLKKDNETLSCELARARKQCDELVAFLRDRLMVGPDQI  203

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL-------K  484
            +RIM QG  GS         +N+                     LKLFGV L       K
Sbjct  204  DRIMRQGSCGS---------ENAVGEGGGGG-----------HCLKLFGVWLKGDTLTDK  243

Query  483  EKKRKRDHDDNTDFSAASTKEMKPSID  403
                KR  +D   F     KE KP +D
Sbjct  244  RNNHKRGREDQMGFGGPRLKESKPVVD  270



>ref|XP_003611751.1| Heat shock transcription factor [Medicago truncatula]
Length=432

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 73/140 (52%), Gaps = 23/140 (16%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T    Q  +L+ ENEKLK+DN+ L+ ELA+ KKQCEELV FL   + V P+QI
Sbjct  248  KNPGSVETTTLPQCVNLSSENEKLKKDNETLNCELARAKKQCEELVAFLKDNLNVGPDQI  307

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-----  478
            +RIM Q        +    V N+   N    +          + LKLFGV L+E+     
Sbjct  308  DRIMKQ------QGNCCESVQNAVGENEESGR----------DCLKLFGVWLREENYTNE  351

Query  477  --KRKRDHDDNTDFSAASTK  424
               +KR  +D   F     K
Sbjct  352  RNNKKRGCEDQLSFGGPRAK  371



>ref|XP_004509144.1| PREDICTED: heat shock factor protein HSF24-like [Cicer arietinum]
Length=267

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 9/107 (8%)
 Frame = -1

Query  789  SQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGS  610
            +Q  DL+ ENEKLK+DN+ L  ELA+ KKQC+ELV FL     V P+QINRI+ +G SGS
Sbjct  138  TQCTDLSRENEKLKKDNEKLGCELARAKKQCDELVGFLRDTFNVGPDQINRIIREGTSGS  197

Query  609  SHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRK  469
            SHD      D+ A       + +          LKLFGV LK ++ K
Sbjct  198  SHDTVRFDDDDIAVGECECEEGEK---------LKLFGVWLKSEEGK  235



>tpg|DAA61768.1| TPA: heat shock factor protein 4 [Zea mays]
 gb|AIB05245.1| HSF transcription factor, partial [Zea mays]
Length=298

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 81/143 (57%), Gaps = 12/143 (8%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            DL  ENE+LK+DN  LS+ELAQ ++ CEEL+ FL++++ V    +  +M + +   + DD
Sbjct  164  DLASENEQLKKDNHTLSAELAQARRHCEELLGFLSRFLDVRQLDLRLLMQEDVRAGASDD  223

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEM  418
               +    A   +SQ    +    E G+++KLFGVLLK+  RKR   +    +AAS + +
Sbjct  224  GAQR---RAHAVASQ---LERGGGEEGKSVKLFGVLLKDAARKRGRCEE---AAASERPI  274

Query  417  KPSIDCKNAPWMKI-SPVPGKSG  352
            K  +     PW+ + S  PG+ G
Sbjct  275  K--MIRVGEPWVGVPSSGPGRCG  295



>ref|XP_009138469.1| PREDICTED: heat stress transcription factor B-1-like [Brassica 
rapa]
Length=271

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 17/163 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+    +   DL+ EN+KLKR+N  LSSELA  K+Q +ELV FLT  +KV PEQ
Sbjct  125  SKNPGSVE----NMVADLSGENKKLKRENDSLSSELAAAKRQRDELVAFLTDQLKVGPEQ  180

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDEN-GETLKLFGVLLKEKKRK  469
            I+++    + G     +I    +S + +  +    D  + E  GE LKLFGV +K +++K
Sbjct  181  IDQM----VKGGKFKPNITGDCSSEEESDCEGCGGDGVEKEGVGEGLKLFGVWVKGERKK  236

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+       S +    ++D     W        K  KVCN
Sbjct  237  RGRDEKNFVVGGSHRTDIKNVDFHAPLW--------KRSKVCN  271



>tpg|DAA61767.1| TPA: hypothetical protein ZEAMMB73_394338 [Zea mays]
Length=321

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 81/143 (57%), Gaps = 12/143 (8%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            DL  ENE+LK+DN  LS+ELAQ ++ CEEL+ FL++++ V    +  +M + +   + DD
Sbjct  187  DLASENEQLKKDNHTLSAELAQARRHCEELLGFLSRFLDVRQLDLRLLMQEDVRAGASDD  246

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEM  418
               +    A   +SQ    +    E G+++KLFGVLLK+  RKR   +    +AAS + +
Sbjct  247  GAQR---RAHAVASQ---LERGGGEEGKSVKLFGVLLKDAARKRGRCEE---AAASERPI  297

Query  417  KPSIDCKNAPWMKI-SPVPGKSG  352
            K  +     PW+ + S  PG+ G
Sbjct  298  K--MIRVGEPWVGVPSSGPGRCG  318



>ref|XP_010666616.1| PREDICTED: heat shock factor protein HSF24 [Beta vulgaris subsp. 
vulgaris]
Length=270

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 20/126 (16%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGI----  619
            +  DL+ ENEKL+RDN+MLSSELAQTKKQCE+L+ FL+ ++KV  ++IN+I+ + I    
Sbjct  133  EIADLSGENEKLRRDNEMLSSELAQTKKQCEDLMGFLSAHLKVGRDEINQIIREEIVDNL  192

Query  618  -SGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE-------KKRKRD  463
              G   D  +++ D+  D+N   +       D+  E LKLFGV LKE       KKR R 
Sbjct  193  PRGPPEDGLVSE-DDFNDVNEKND-------DDEKEGLKLFGVWLKEVGGIEEGKKRGRC  244

Query  462  HDDNTD  445
            +D   D
Sbjct  245  YDFQGD  250



>ref|XP_008670235.1| PREDICTED: heat stress transcription factor B-1-like [Zea mays]
 tpg|DAA40235.1| TPA: hypothetical protein ZEAMMB73_110006 [Zea mays]
 gb|AIB05244.1| HSF transcription factor, partial [Zea mays]
Length=298

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 80/143 (56%), Gaps = 15/143 (10%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            DLT ENE+LK+DN+ LS+ELAQ ++ CEEL+ FL++++ V    +  +M + +   + DD
Sbjct  167  DLTSENEQLKKDNRTLSTELAQARRHCEELLGFLSRFLDVRQLDLGLLMQEDVRAGAGDD  226

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEM  418
            +  +    + L             E G+++KLFGVLL +  RKR   +    +AAS + +
Sbjct  227  AAPRRAMVSQLERG---------GEEGKSVKLFGVLLTDAARKRARCEE---AAASERPI  274

Query  417  KPSIDCKNAPWMKI-SPVPGKSG  352
            K  +     PW+ + S  PG+ G
Sbjct  275  K--MIRIGEPWIGVPSSGPGRCG  295



>ref|XP_006826240.1| PREDICTED: heat shock factor protein HSF24 [Amborella trichopoda]
 gb|ERM93477.1| hypothetical protein AMTR_s00132p00118400 [Amborella trichopoda]
Length=278

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 87/155 (56%), Gaps = 25/155 (16%)
 Frame = -1

Query  792  KSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISG  613
            ++ F DL+DENEKLKRDN  L+SEL QTKKQC +L+ FL++ + V+PEQI +IM +G   
Sbjct  145  ETSFSDLSDENEKLKRDNFHLASELLQTKKQCADLIAFLSKCINVLPEQITKIMERG---  201

Query  612  SSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLK---EKKRKRDH-DDNTD  445
                       ++ D  S   +  DDDD+ + ++ KLFGV L+   EK +KR    +  +
Sbjct  202  -----------SNVDCGSYVKEGRDDDDENDDQSPKLFGVRLRVKDEKNKKRGFMGEGVN  250

Query  444  FSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
                  K++         PWM+IS   G   KVC+
Sbjct  251  GPPLKVKKLD-----LETPWMRISSPEG--SKVCH  278



>gb|KCW54959.1| hypothetical protein EUGRSUZ_I00929 [Eucalyptus grandis]
Length=432

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSS  607
            QF DLT ENEKL+RDN+ L+SELAQ KK C+ELV FLT+ +KV P+QI+ I+ +G  G++
Sbjct  298  QFADLTGENEKLRRDNEALNSELAQAKKHCDELVAFLTECLKVAPDQIDHIVRRGCRGAA  357

Query  606  HDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK---KRKRDHDD  454
               +     +  D +   + +    + +  ++ KLFGV L  K    RKR  +D
Sbjct  358  AFAAAGDGADGVDRDDDDDDEKAAAEVDGEKSTKLFGVWLNGKGKEARKRARED  411



>ref|NP_001150318.1| heat shock factor protein 4 [Zea mays]
 gb|ACG38635.1| heat shock factor protein 4 [Zea mays]
Length=299

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 80/143 (56%), Gaps = 12/143 (8%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            DL  ENE+LK+DN  LS ELAQ ++ CEEL+ FL++++ V    +  +M + +   + DD
Sbjct  165  DLASENEQLKKDNHTLSVELAQARRHCEELLGFLSRFLDVRQLDLRLLMQEDVRAGASDD  224

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEM  418
               +    A   +SQ    +    E G+++KLFGVLLK+  RKR   +    +AAS + +
Sbjct  225  GAQR---RAHAVASQ---LERGGGEEGKSVKLFGVLLKDAARKRGRCEE---AAASERPI  275

Query  417  KPSIDCKNAPWMKI-SPVPGKSG  352
            K  +     PW+ + S  PG+ G
Sbjct  276  K--MIRVGEPWVGVPSSGPGRCG  296



>ref|XP_004957012.1| PREDICTED: heat stress transcription factor B-1-like [Setaria 
italica]
Length=309

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 83/147 (56%), Gaps = 21/147 (14%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGI----SGS  610
            DLT ENE+LK+DN+ L++ELAQ ++QCEEL+ FL++++ V    +  +M + +    +G 
Sbjct  176  DLTSENEQLKKDNRTLATELAQARRQCEELLGFLSRFLDVRQLDLGMLMQEDVVRAAAGD  235

Query  609  SHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAAS  430
            +H    + V +  +              E G+++KLFGVLLK+  RKR   +    +AAS
Sbjct  236  AHQQCRSAVADQLECGG-----------EEGKSVKLFGVLLKDAARKRGRCEE---AAAS  281

Query  429  TKEMKPSIDCKNAPWMKI-SPVPGKSG  352
             + +K  +     PW+ + S  PG+ G
Sbjct  282  ERPIK--MIRIGEPWVGVPSSGPGRFG  306



>ref|XP_007156806.1| hypothetical protein PHAVU_002G019100g [Phaseolus vulgaris]
 gb|ESW28800.1| hypothetical protein PHAVU_002G019100g [Phaseolus vulgaris]
Length=284

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 74/149 (50%), Gaps = 32/149 (21%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KN G V+T   +   +L+ EN+KLK+DN+ LS ELA+ +KQC+ELV FL   + V P+QI
Sbjct  144  KNTGLVET-NTTVSHELSSENQKLKKDNETLSCELARARKQCDELVAFLKNRLMVGPDQI  202

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENG-ETLKLFGVLLKE-----  481
            +RIM QG  GS                           +E G E LKLFGV LKE     
Sbjct  203  DRIMRQGSCGSE----------------------KAVGEEGGEECLKLFGVWLKEDTLAD  240

Query  480  ---KKRKRDHDDNTDFSAASTKEMKPSID  403
                  KR  ++   F     KE KP +D
Sbjct  241  KRNNHHKRVREEQMGFGGPRLKESKPVVD  269



>emb|CDX69274.1| BnaC01g01790D [Brassica napus]
Length=284

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 86/162 (53%), Gaps = 16/162 (10%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            K+PGSV+    +   DL+ ENEKLKR+N  LSSELA  K+Q +ELV FLT+ +KV PEQI
Sbjct  138  KHPGSVE----NMVADLSGENEKLKRENSSLSSELAAAKRQRDELVAFLTEQMKVGPEQI  193

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDE-NGETLKLFGVLLKEKKRKR  466
            + +M +G  G     ++ + ++  +           ++    GE LKLFGV +K +++KR
Sbjct  194  D-LMIKG--GKKLKPAVEEEESDCEGCGGDGGAAVGEEKGVVGEGLKLFGVWVKGERKKR  250

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
              D+       S      ++D     W        KS KVCN
Sbjct  251  GRDEKNFLVGGSHMTEVKNVDFHAPLW--------KSSKVCN  284



>emb|CDY67770.1| BnaCnng56320D [Brassica napus]
Length=272

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 16/163 (10%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            SKNPGSV+    +   DL+ ENEKLKR+N  LSSELA  K+  +ELVTFLT  +KV PEQ
Sbjct  125  SKNPGSVE----NMVADLSGENEKLKRENDSLSSELAAAKRLRDELVTFLTDQLKVGPEQ  180

Query  645  INRIMSQGISGSSHDDSINKVDNSADL-NSSQNKddddddDENGETLKLFGVLLKEKKRK  469
            I+    Q + G     ++ +  +S ++ +      D ++ +  GE LKLFGV +K +++K
Sbjct  181  ID----QMVKGGKFKPTVTEYCSSDEVSDCEGCGGDGEEKEGAGEGLKLFGVWVKGERKK  236

Query  468  RDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            R  D+       S +    + D KN  +   +P+  KS KVCN
Sbjct  237  RGRDEKNFVVGGSHR----TTDIKNVDFH--APL-WKSSKVCN  272



>ref|XP_010547515.1| PREDICTED: heat shock factor protein HSF24-like [Tarenaya hassleriana]
Length=242

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 22/117 (19%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNP SV T    +  DL  ENEKL++ N++LSSELA  KKQC+EL  FL++Y++V  +QI
Sbjct  143  KNPESVST----KMADLYGENEKLRQSNEILSSELALAKKQCDELAAFLSEYMEVGLDQI  198

Query  642  NRIMSQGISGS---SHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE  481
            ++I+ + I+G     +DD     DN   L               G  LK+FGV LKE
Sbjct  199  DQILRRRIAGDRGVGNDDDQKLSDNDEGL---------------GGELKIFGVRLKE  240



>ref|XP_010943066.1| PREDICTED: heat stress transcription factor B-1-like [Elaeis 
guineensis]
Length=324

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (54%), Gaps = 29/163 (18%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQ-GISGS  610
            Q  DLT+ENEKLK+DN+MLSSELAQ K+ C+EL+ FL++++ V    I  +M + G++ +
Sbjct  177  QLLDLTNENEKLKKDNKMLSSELAQAKQHCKELLGFLSKFMDVGELNIAPLMQENGLTEA  236

Query  609  S--HDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE----------KKRKR  466
            S   D++  K D   ++ + +            E LKLFGVLLK           ++++ 
Sbjct  237  SIWRDETKKKKDVEEEMGNKE------------EGLKLFGVLLKRFEGEESKKRRREKRG  284

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKIS-PVPGKSGKVCN  340
              D+  +   A  K MK       APWM  S PV   S KVCN
Sbjct  285  RCDEGGEGCGAGEKPMKMGFV---APWMGTSTPVQKGSSKVCN  324



>ref|XP_010531239.1| PREDICTED: heat stress transcription factor B-1-like [Tarenaya 
hassleriana]
Length=249

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 73/129 (57%), Gaps = 23/129 (18%)
 Frame = -1

Query  822  KNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQI  643
            KNPGSV+T   +   DL++ENEKL+R+N+ LSSELA  K+Q +ELV FL++++ V P+ I
Sbjct  128  KNPGSVET-AANMVADLSEENEKLRRENETLSSELAAAKRQRDELVAFLSEHLNVGPDNI  186

Query  642  NRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRD  463
            + ++     G                     +   ++D  +G  +KLFGV LK ++RKR 
Sbjct  187  DGMVEGATRGK--------------------RPAGEEDSGDGGGMKLFGVWLKGERRKRG  226

Query  462  HDD--NTDF  442
             +   N DF
Sbjct  227  REGIKNVDF  235



>ref|XP_003638742.1| Heat stress transcription factor A3 [Medicago truncatula]
Length=256

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 21/119 (18%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            S + GSVD        DL+ EN++LK DN+ L+ EL   KK+CEEL+ +L   + +  ++
Sbjct  127  STSTGSVDRS------DLSIENKRLKMDNEKLTVELTLVKKKCEELLAYLQSNLNIGADE  180

Query  645  INRIMSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRK  469
            INRI+ +G  GSSHD      DN  D          +   E G+ LKLFGV LK ++ K
Sbjct  181  INRILGKGTDGSSHD-----TDNDDD----------NMVRECGKGLKLFGVWLKGEEGK  224



>ref|XP_002460330.1| hypothetical protein SORBIDRAFT_02g026590 [Sorghum bicolor]
 gb|EER96851.1| hypothetical protein SORBIDRAFT_02g026590 [Sorghum bicolor]
Length=315

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 73/149 (49%), Gaps = 19/149 (13%)
 Frame = -1

Query  774  LTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDDS  595
            LT ENE+LK+DN  LS+ELAQ ++ CEEL+ FL++++ V      R +  G+     +D 
Sbjct  175  LTSENEQLKKDNHTLSTELAQARRHCEELLGFLSRFLDV------RQLDLGLLMQGEEDV  228

Query  594  INKVDNSADLNSSQNKddddddDEN------GETLKLFGVLLKE-KKRKRDHDDNTDFSA  436
                        +Q +   +   E       G+++KLFGVLLK+   RKR   +    S 
Sbjct  229  RAAGAAGDGALQAQRRAVVNHQLERGRGGEEGKSVKLFGVLLKDAAARKRGRCEEAVASE  288

Query  435  ASTKEMKPSIDCKNAPWMKI-SPVPGKSG  352
               K ++        PW+ + S  PG+ G
Sbjct  289  RPIKMIRV-----GEPWVGVPSSGPGRCG  312



>dbj|BAJ97434.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 74/145 (51%), Gaps = 22/145 (15%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHD  601
            PDL+ ENE+L++DN  L++ELA  ++ CEEL+ FL++++ V    +  +M + + G++  
Sbjct  181  PDLSSENEQLRKDNHALAAELAMARRHCEELLGFLSRFLDVRQLDLRLLMDEDMQGAAGG  240

Query  600  DSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-KRKRDHDDNTDFSAASTK  424
                    SAD      K            +KLFGV+LK+   RKR   D    +AA  +
Sbjct  241  AR----SGSADQEQCCEKK-----------VKLFGVILKDASARKRGRCDE---AAAGER  282

Query  423  EMKPSIDCKNAPWMKI-SPVPGKSG  352
             +K  +     PW+ + S  P + G
Sbjct  283  SVK--MTRIGEPWVGVPSSWPARCG  305



>ref|XP_008808108.1| PREDICTED: heat stress transcription factor B-1-like [Phoenix 
dactylifera]
Length=319

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 83/160 (52%), Gaps = 29/160 (18%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQ-GISGS--S  607
            DL +ENEK+K+DN++L  ELA++++ C +L  FL++++ V    I+ +M + G++ +   
Sbjct  175  DLINENEKIKKDNKILRRELAKSRQHCRDLFGFLSKFIHVDELDISLLMREKGLTEARIC  234

Query  606  HDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL-----KEKKRKRDH-----D  457
             D++  K D   ++   +              LKLFGVLL     KE+K+ R       D
Sbjct  235  RDETTKKKDVEEEVGKKEE------------GLKLFGVLLKGFEGKERKKSRREKRGRCD  282

Query  456  DNTDFSAASTKEMKPSIDCKNAPWMKIS-PVPGKSGKVCN  340
               +   A+ + MK       APWM +S PV   S KVC+
Sbjct  283  GVGEGYGAAERPMKMGF---VAPWMGLSTPVRQGSSKVCD  319



>ref|XP_009410099.1| PREDICTED: heat stress transcription factor B-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410100.1| PREDICTED: heat stress transcription factor B-1-like [Musa acuminata 
subsp. malaccensis]
Length=302

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 80/164 (49%), Gaps = 22/164 (13%)
 Frame = -1

Query  798  PGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGI  619
            P      +LT ENEKL+ DNQ+LS+ELAQ K+Q  EL+  L+ +V V    ++ +M    
Sbjct  150  PPSEHLLELTHENEKLRMDNQILSTELAQAKRQYRELLASLSNFVDVSQPNLSVLM----  205

Query  618  SGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLL---------KEKKRKR  466
                 + S   V N ++  + + + +++  D   E LKLFGVLL         K ++ KR
Sbjct  206  ----QEKSALSVGNGSETETKKKEAEEETMDNEEEGLKLFGVLLKGLGGEGSDKSRRLKR  261

Query  465  DH-DDNTDFSAASTKEMKPSIDCKNAPWMKI-SPVPGKSGKVCN  340
               D+  D  +   + MK        PW  + S V   S +VCN
Sbjct  262  GRCDETADGCSVGERPMKMGFGW---PWWGMSSTVQHGSSRVCN  302



>ref|XP_008797267.1| PREDICTED: heat stress transcription factor B-1-like [Phoenix 
dactylifera]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 82/163 (50%), Gaps = 25/163 (15%)
 Frame = -1

Query  792  KSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQ-GIS  616
            + Q  DLT+ENEKLK++N +LS+E+AQ K++C EL+  L+ +V V    I  +M + G+ 
Sbjct  171  QQQLLDLTNENEKLKKENNILSNEVAQAKQRCGELLGVLSTFVDVGKLDIGLLMQEKGLM  230

Query  615  GSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLK------EKKRKRDH--  460
                + +I + +        +     +      E LKLFGVLLK       KK +R+   
Sbjct  231  ----EAAIWREEPMKKKGVEEEVGKKE------EGLKLFGVLLKGFEGEESKKTRREKRG  280

Query  459  --DDNTDFSAASTKEMKPSIDCKNAPWMKIS-PVPGKSGKVCN  340
              D+  +   A  + MK   +   APWM  S PV   S K+ N
Sbjct  281  RCDEGGEMCGAGERPMKMGFE---APWMGTSTPVQQGSRKIYN  320



>ref|XP_009381466.1| PREDICTED: heat stress transcription factor B-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381467.1| PREDICTED: heat stress transcription factor B-1-like [Musa acuminata 
subsp. malaccensis]
Length=304

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 80/164 (49%), Gaps = 23/164 (14%)
 Frame = -1

Query  798  PGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGI  619
            P      DLT+EN KL+ DNQ+L++ELAQ  ++  +L+ FL+ YV V   ++N       
Sbjct  153  PPSEHLLDLTNENVKLRSDNQILNAELAQAMRRYRQLLGFLSGYVDV--SRLN-------  203

Query  618  SGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE---------KKRKR  466
            SG    ++      +     ++ ++ ++      + LKLFGVLLK          +++KR
Sbjct  204  SGHPMQEAAALTAGAGHETEAKKEEAEEGKLGEEQGLKLFGVLLKSIEGEESGKNRRQKR  263

Query  465  DH-DDNTDFSAASTKEMKPSIDCKNAPWMKIS-PVPGKSGKVCN  340
               +++ D  +   + +K        PWM +S  VP  S  VCN
Sbjct  264  GRCEESIDGCSVGERPIKMGF---GWPWMGMSTTVPHGSSNVCN  304



>ref|XP_003602208.1| Heat shock factor [Medicago truncatula]
 gb|AES72459.1| heat shock factor protein HSF24, putative [Medicago truncatula]
Length=93

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  795  GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPE-QINRIMSQGI  619
            G+   PDL+ EN++LK+DN  L+ ELA  KK C++LV FL   V V  + QINRI+ +G 
Sbjct  23   GQMDCPDLSSENKRLKKDNDKLTGELALAKKWCDKLVAFLQDIVNVGSDHQINRIIDKGQ  82

Query  618  SG  613
             G
Sbjct  83   VG  84



>gb|AFG54850.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
Length=143

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -1

Query  795  GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGIS  616
            G++    L  ENEKL++DN +L SELAQ KKQC +L+ FL++ V + P+ ++ I+     
Sbjct  1    GQNSTSGLHGENEKLRKDNLLLMSELAQMKKQCNDLLLFLSKCVNITPDNLSNILVAASQ  60

Query  615  GSSHDDSI  592
             +  D+++
Sbjct  61   TNCRDENL  68



>gb|AFG54840.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54841.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54842.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54843.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54844.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54845.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54846.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54847.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54848.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54849.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
 gb|AFG54851.1| hypothetical protein 2_1014_01, partial [Pinus taeda]
Length=143

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -1

Query  795  GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGIS  616
            G++    L  ENEKL++DN +L SELAQ KKQC +L+ FL++ V + P+ ++ I+     
Sbjct  1    GQNSTSGLHGENEKLRKDNLLLMSELAQMKKQCNDLLLFLSKCVNITPDNLSNILVAASQ  60

Query  615  GSSHDDSI  592
             +  D+++
Sbjct  61   TNCRDENL  68



>gb|AFB33185.1| hypothetical protein 2_1014_01, partial [Pinus mugo]
Length=143

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  795  GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGIS  616
            G++    L  ENEKL++DN +L SELAQ KKQC +L+ FL++ V + P+ +  I+     
Sbjct  1    GQNSTSGLHGENEKLRKDNVLLMSELAQMKKQCNDLLLFLSKCVNITPDNLKNILIAASQ  60

Query  615  GSSHDDSI  592
             +  D+++
Sbjct  61   TNCRDENL  68



>gb|AFB33182.1| hypothetical protein 2_1014_01, partial [Pinus mugo]
 gb|AFB33183.1| hypothetical protein 2_1014_01, partial [Pinus mugo]
 gb|AFB33184.1| hypothetical protein 2_1014_01, partial [Pinus mugo]
Length=143

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  795  GKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGIS  616
            G++    L  ENEKL++DN +L SELAQ KKQC +L+ FL++ V + P+ +  I+     
Sbjct  1    GQNSTSGLHGENEKLRKDNVLLMSELAQMKKQCNDLLLFLSKCVNITPDNLKNILIAASQ  60

Query  615  GSSHDDSI  592
             +  D+++
Sbjct  61   TNCRDENL  68



>ref|XP_003578229.1| PREDICTED: heat stress transcription factor B-1-like [Brachypodium 
distachyon]
Length=302

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 73/140 (52%), Gaps = 20/140 (14%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHD  601
            PDL  +N++L++ N  L+ ELA  +++CEEL+ FL++++ V    +  +M        HD
Sbjct  176  PDLASDNQRLRKANHTLALELALARRRCEELLGFLSRFLDVRQLDLRLLM--------HD  227

Query  600  DSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-KRKRDHDDNTDFSAASTK  424
            + +  +  +      Q +    ++    +T+KLFGVLLK+   RKR   D     AA+++
Sbjct  228  EDM--MQGAVARERCQERQAGCEE----KTVKLFGVLLKDAPARKRARCDE----AAASE  277

Query  423  EMKPSIDCKNAPWMKISPVP  364
                 +     PW+ + PVP
Sbjct  278  RASIKMIRMGEPWVGV-PVP  296



>gb|EAZ09371.1| hypothetical protein OsI_31644 [Oryza sativa Indica Group]
Length=264

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 74/149 (50%), Gaps = 28/149 (19%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            D+T ENE+L++DNQ L++ELA+ ++ CEEL+ FL++++ V    +  +M +         
Sbjct  134  DITSENEQLRKDNQTLTTELARARRHCEELLAFLSRFLDVRQLDLRLLMQE---------  184

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE------KKRKRDHDDNTDFSA  436
                 D  A       +  + +     + +KLFGVLL +      +KR R  +     +A
Sbjct  185  -----DMRAAAGGVGGEQREQEHAREEKCVKLFGVLLDDTHGAATRKRARCEE-----AA  234

Query  435  ASTKEMKPSIDCKNAPWMKI-SPVPGKSG  352
            AS + +K  +     PW+ + S  P + G
Sbjct  235  ASERPIK--MIRIGEPWVSVPSSGPARCG  261



>gb|EEE69850.1| hypothetical protein OsJ_29627 [Oryza sativa Japonica Group]
Length=222

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 28/149 (19%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            D+T ENE+L++DNQ L+ ELA+ ++ CEEL+ FL++++ V    +  +M +         
Sbjct  92   DITSENEQLRKDNQTLTMELARARRHCEELLGFLSRFLDVRQLDLRLLMQE---------  142

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE------KKRKRDHDDNTDFSA  436
                 D  A       +    +     + +KLFGVLL +      +KR R  +     +A
Sbjct  143  -----DMRAAAGGVGGEQRVQEHAREEKCVKLFGVLLDDTHGAATRKRARCEE-----AA  192

Query  435  ASTKEMKPSIDCKNAPWMKI-SPVPGKSG  352
            AS + +K  +     PW+ + S  P + G
Sbjct  193  ASERPIK--MIRIGEPWVSVPSSGPARCG  219



>gb|EMT31202.1| Heat stress transcription factor B-1 [Aegilops tauschii]
Length=298

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 75/145 (52%), Gaps = 24/145 (17%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHD  601
            PDL+ ENE+L++DN  L++ELA  ++ CEEL+ FL++++ V    +  +M + + G++  
Sbjct  173  PDLSSENEQLRKDNHALAAELALARRHCEELLGFLSRFLDVRQLDLRLLMDEDMQGAAGG  232

Query  600  DSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-KRKRDHDDNTDFSAASTK  424
                    SAD      K            +KLFGV+LK+   RKR   D    +AAS +
Sbjct  233  ------ARSADQEHCCEKK-----------VKLFGVVLKDASARKRGRCDE---AAASER  272

Query  423  EMKPSIDCKNAPWMKI-SPVPGKSG  352
             MK  +     PW+ + S  P + G
Sbjct  273  SMK--MTRIGEPWVGVPSSCPARCG  295



>ref|XP_010939421.1| PREDICTED: heat stress transcription factor B-1-like [Elaeis 
guineensis]
Length=317

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 84/163 (52%), Gaps = 29/163 (18%)
 Frame = -1

Query  786  QFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSS  607
            Q  + T+EN+KLK+DN+ L +ELAQ KK+C EL+  L++++ V    I  +M +      
Sbjct  170  QLFNWTNENDKLKKDNKRLGNELAQAKKRCRELLGVLSKFMDVGALDIGLLMRE------  223

Query  606  HDDSINKVDNSADLNSSQNKddddddDENGETL---KLFGVLLK----------EKKRKR  466
                  K    A L   + K++   ++E G+     +LFGVLLK          +++++R
Sbjct  224  ------KGLMEATLWREETKNEKIVEEEVGKKEEGPRLFGVLLKGFEGEESKKSKREKRR  277

Query  465  DHDDNTDFSAASTKEMKPSIDCKNAPWMKIS-PVPGKSGKVCN  340
              ++  +   A  + MK       APWM++S PV   SGKV N
Sbjct  278  RCEEGGEVCGAGERPMKMGF---GAPWMRLSTPVQQGSGKVYN  317



>ref|XP_006661309.1| PREDICTED: heat stress transcription factor B-1-like [Oryza brachyantha]
Length=349

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 14/97 (14%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            D+T ENE+L++DN+ L++ELA+ ++QCEEL+ FL++++ V    +  +M +         
Sbjct  217  DITSENEQLRKDNRTLTTELARARRQCEELLGFLSRFLDVRQLDLRLLMQE---------  267

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLL  487
                 D  A       + + +   ++ + +KLFGVLL
Sbjct  268  -----DMRAAAAGGGEQPEQEHSRDDDKCVKLFGVLL  299



>ref|XP_010548862.1| PREDICTED: heat stress transcription factor B-1-like [Tarenaya 
hassleriana]
Length=161

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  810  SVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKV  658
            S+ +P  +   DL+DENEKL+R+N+ LSSEL   K+Q  ELV F+T+ +KV
Sbjct  100  SMSSPAVNMVADLSDENEKLRRENETLSSELVAAKRQRGELVAFVTENLKV  150



>ref|NP_001063364.1| Os09g0456800 [Oryza sativa Japonica Group]
 sp|Q67TP9.1|HSFB1_ORYSJ RecName: Full=Heat stress transcription factor B-1; AltName: 
Full=Heat stress transcription factor 23; Short=OsHsf-23 [Oryza 
sativa Japonica Group]
 dbj|BAD38472.1| putative heat shock factor [Oryza sativa Japonica Group]
 dbj|BAF25278.1| Os09g0456800 [Oryza sativa Japonica Group]
 dbj|BAG87923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60241.1| HSF-BDB transcription factor [Oryza sativa Japonica Group]
Length=302

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 28/149 (19%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            D+T ENE+L++DNQ L+ ELA+ ++ CEEL+ FL++++ V    +  +M +         
Sbjct  172  DITSENEQLRKDNQTLTMELARARRHCEELLGFLSRFLDVRQLDLRLLMQE---------  222

Query  597  SINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKE------KKRKRDHDDNTDFSA  436
                 D  A       +    +     + +KLFGVLL +      +KR R  +     +A
Sbjct  223  -----DMRAAAGGVGGEQRVQEHAREEKCVKLFGVLLDDTHGAATRKRARCEE-----AA  272

Query  435  ASTKEMKPSIDCKNAPWMKI-SPVPGKSG  352
            AS + +K  +     PW+ + S  P + G
Sbjct  273  ASERPIK--MIRIGEPWVSVPSSGPARCG  299



>gb|AHZ44770.1| heat shock factor B1b [Triticum aestivum]
Length=298

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 30/148 (20%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMS---QGISGS  610
            PDL+ ENE+L++DN  L++ELA  ++ CEEL+ FL++++ V    +  +M    QG +G 
Sbjct  173  PDLSSENEQLRKDNHALAAELALARRHCEELLGFLSRFLDVRQLDLRLLMDGDMQGAAGG  232

Query  609  SHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEK-KRKRDHDDNTDFSAA  433
            +          SAD      K            +KLFGV+LK+   RKR   D    +AA
Sbjct  233  A---------RSADQEHCCEKK-----------VKLFGVILKDASARKRGRCDE---AAA  269

Query  432  STKEMKPSIDCKNAPWMKI-SPVPGKSG  352
            S + MK  +     PW+ + S  P + G
Sbjct  270  SERSMK--MTRIGEPWVGVPSSCPARCG  295



>ref|XP_010919270.1| PREDICTED: heat stress transcription factor B-2c-like [Elaeis 
guineensis]
Length=326

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 14/165 (8%)
 Frame = -1

Query  813  GSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRI  634
            G    PG S   +L +ENE+L+R+N  LS EL Q K  C  +   +++Y     +Q    
Sbjct  168  GRAPPPGCSGAAELMEENERLRRENMQLSHELGQMKNLCNNIFLLMSKYASS--QQQGCA  225

Query  633  MSQGISGSSHDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDD  454
             +   SG    +    +D    + S + +     + E G + +LFGV ++ K+   D  +
Sbjct  226  TASAASGGPPLEVAPPLDLMPLMRSPEAE---RVNAEEGPSTRLFGVPIRLKRSLCDDPE  282

Query  453  NTDFSAASTK--EMKPSIDCKNAP-----WMKISPVPGKSGKVCN  340
              D S    K   + P  D +++      W+   P P +  +VCN
Sbjct  283  EADTSGPEVKPEPLDPGADPQDSSTDHRRWLLCCPPPNQ--RVCN  325



>ref|XP_007146140.1| hypothetical protein PHAVU_006G015700g [Phaseolus vulgaris]
 gb|ESW18134.1| hypothetical protein PHAVU_006G015700g [Phaseolus vulgaris]
Length=269

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = -1

Query  774  LTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDDS  595
            L+++N++L+R N ML SEL+  K    +++ F+  +VK  P    +  S  I      DS
Sbjct  160  LSEDNQRLRRKNFMLLSELSHMKSLYNDIIYFIQNHVKAPP--FEQRTSSAIQKLVEFDS  217

Query  594  INKVDNSADLNSSQ----NKddddddDENGETLKLFGVLLKEKKRKRDHDDNTD  445
            +N+  N+  L +S+    +K      +E+  ++KLFGVLL    RKR H DN +
Sbjct  218  LNEPINNISLRTSKSSFVDKSFFTSTEESDSSVKLFGVLL--SGRKRLHPDNIN  269



>gb|KJB52055.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=304

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 67/134 (50%), Gaps = 9/134 (7%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHD  601
            P+L +ENE+L+R+N  LS EL Q K  C  ++T +T +     E  + I+++G       
Sbjct  156  PELLEENERLRRENMQLSQELTQLKGLCNNILTLMTNHASGQLES-HSILAEG-------  207

Query  600  DSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKK-RKRDHDDNTDFSAASTK  424
             +++ +       S+++    +  +E   T KLFGV +  K+ RK   D+  +      +
Sbjct  208  KALDLLSARDSARSTEDSGSKEVAEEEDVTPKLFGVSIGVKRLRKEGEDEMQNSFQVRQQ  267

Query  423  EMKPSIDCKNAPWM  382
            + +P+   K  PWM
Sbjct  268  DTEPASKMKEEPWM  281



>gb|KJB52056.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=311

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 67/134 (50%), Gaps = 9/134 (7%)
 Frame = -1

Query  780  PDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHD  601
            P+L +ENE+L+R+N  LS EL Q K  C  ++T +T +     E  + I+++G       
Sbjct  163  PELLEENERLRRENMQLSQELTQLKGLCNNILTLMTNHASGQLES-HSILAEG-------  214

Query  600  DSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKK-RKRDHDDNTDFSAASTK  424
             +++ +       S+++    +  +E   T KLFGV +  K+ RK   D+  +      +
Sbjct  215  KALDLLSARDSARSTEDSGSKEVAEEEDVTPKLFGVSIGVKRLRKEGEDEMQNSFQVRQQ  274

Query  423  EMKPSIDCKNAPWM  382
            + +P+   K  PWM
Sbjct  275  DTEPASKMKEEPWM  288



>ref|XP_009119797.1| PREDICTED: heat stress transcription factor B-4-like [Brassica 
rapa]
Length=329

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 9/130 (7%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            S  P  V T   +Q   LT++NE+L+R N +L SELA  KK   +++ F+  +VK V   
Sbjct  174  SPRPRVVPTTADAQVAVLTEDNERLRRTNTVLMSELAHMKKLYNDIIYFVQNHVKPVAPS  233

Query  645  INRIMSQGISGSSHDDSINKVDNSADLN----SSQNKddddddDENGETL----KLFGVL  490
             N  + +          I+  +N+   N    +SQ+     +DD N E++    KLFGV 
Sbjct  234  -NSFLQKQQQPPPPPPPIDYYNNATVPNHSPPTSQSSITLLEDDTNPESITRKTKLFGVS  292

Query  489  LKEKKRKRDH  460
            L   K++  H
Sbjct  293  LASSKKRSHH  302



>emb|CDY06765.1| BnaA10g05440D [Brassica napus]
Length=329

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 9/130 (7%)
 Frame = -1

Query  825  SKNPGSVDTPGKSQFPDLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQ  646
            S  P  V T   +Q   LT++NE+L+R N +L SELA  KK   +++ F+  +VK V   
Sbjct  174  SPRPRVVPTTADAQVAVLTEDNERLRRTNTVLMSELAHMKKLYNDIIYFVQNHVKPVAPS  233

Query  645  INRIMSQGISGSSHDDSINKVDNSADLN----SSQNKddddddDENGETL----KLFGVL  490
             N  + +          I+  +N+   N    +SQ+     +DD N E++    KLFGV 
Sbjct  234  -NSFLQKQQQPPPPPPPIDYYNNATVPNHSPPTSQSSITLLEDDTNPESITRKTKLFGVS  292

Query  489  LKEKKRKRDH  460
            L   K++  H
Sbjct  293  LASSKKRSHH  302



>ref|XP_007015249.1| Heat shock transcription factor B4 [Theobroma cacao]
 gb|EOY32868.1| Heat shock transcription factor B4 [Theobroma cacao]
Length=279

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = -1

Query  774  LTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGIS----GSS  607
            LT +N++L+R N ML SEL   K    +++ F+  +VK VP Q  +  + G      G S
Sbjct  158  LTQDNQRLRRKNYMLVSELTHMKNLYNDIIYFIQNHVKPVPYQ-QKAYNLGTKIREFGPS  216

Query  606  HDDSINKVDNSADLNSSQNKddddddDENGETLKLFGVLLKEKKR  472
              D I+  + +A  +S   K      +E   T+KLFGV L  +KR
Sbjct  217  FQDPIHSGNENAT-SSVLGKSSMTLTEEPNNTVKLFGVPLSGRKR  260



>gb|EMT20815.1| Heat stress transcription factor B-2b [Aegilops tauschii]
Length=375

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 69/138 (50%), Gaps = 10/138 (7%)
 Frame = -1

Query  777  DLTDENEKLKRDNQMLSSELAQTKKQCEELVTFLTQYVKVVPEQINRIMSQGISGSSHDD  598
            DL +ENE+L+R+N  L+ EL Q KK C  +   +++Y     +Q +       SG S + 
Sbjct  199  DLGEENERLRRENSRLTRELGQMKKLCNNIFVLMSKYTHG--QQADAADVGNCSGESAET  256

Query  597  SINKVDNSADL-----NSSQNKddddddDENGETLKLFGVLLKEKKRKRDHDDNTDFSAA  433
            +   +    +L     N+    D   +D+E   + +LFGV +  K+ + D +D T   AA
Sbjct  257  TALPLPPVLELLPSCPNAPTAADLGAEDEEEKMSARLFGVCIGRKRMRHDGEDLTSRGAA  316

Query  432  STKEMKP-SIDCKNAPWM  382
            +  E+KP  +D +  P M
Sbjct  317  A--EVKPEPMDAQQPPGM  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1765995469312