BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4092

Length=829
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792652.1|  PREDICTED: uncharacterized protein LOC104239662    337   5e-108   Nicotiana sylvestris
ref|XP_009780392.1|  PREDICTED: uncharacterized protein LOC104229438    336   1e-107   Nicotiana sylvestris
ref|XP_009598854.1|  PREDICTED: uncharacterized protein LOC104094596    335   3e-107   Nicotiana tomentosiformis
ref|XP_009627853.1|  PREDICTED: uncharacterized protein LOC104118334    332   3e-106   Nicotiana tomentosiformis
emb|CDO99801.1|  unnamed protein product                                332   4e-106   Coffea canephora [robusta coffee]
gb|EYU39645.1|  hypothetical protein MIMGU_mgv1a0070051mg               323   6e-105   Erythranthe guttata [common monkey flower]
ref|XP_006361693.1|  PREDICTED: uncharacterized protein LOC102605820    328   1e-104   Solanum tuberosum [potatoes]
ref|XP_004250040.1|  PREDICTED: uncharacterized protein LOC101265191    328   2e-104   Solanum lycopersicum
ref|XP_010534423.1|  PREDICTED: uncharacterized protein LOC104809977    327   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_004240185.2|  PREDICTED: uncharacterized protein LOC101262315    325   6e-104   
ref|XP_011094505.1|  PREDICTED: uncharacterized protein LOC105174183    327   8e-104   Sesamum indicum [beniseed]
gb|KJB73494.1|  hypothetical protein B456_011G235000                    327   9e-104   Gossypium raimondii
ref|XP_006345994.1|  PREDICTED: uncharacterized protein LOC102592436    324   4e-103   Solanum tuberosum [potatoes]
ref|XP_011084395.1|  PREDICTED: uncharacterized protein LOC105166653    324   4e-103   Sesamum indicum [beniseed]
gb|EPS72672.1|  hypothetical protein M569_02085                         322   2e-102   Genlisea aurea
ref|XP_007010014.1|  Major facilitator superfamily protein              322   1e-101   
ref|XP_012080987.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    320   1e-101   Jatropha curcas
ref|XP_010103517.1|  putative transporter MCH1                          318   8e-101   Morus notabilis
gb|KFK36814.1|  hypothetical protein AALP_AA4G174900                    318   8e-101   Arabis alpina [alpine rockcress]
ref|XP_006436518.1|  hypothetical protein CICLE_v10030988mg             318   1e-100   Citrus clementina [clementine]
ref|XP_002862889.1|  nodulin family protein                             315   4e-100   
ref|XP_002881636.1|  predicted protein                                  315   7e-100   
emb|CDY07663.1|  BnaA03g18480D                                          315   8e-100   Brassica napus [oilseed rape]
ref|XP_010067353.1|  PREDICTED: uncharacterized protein LOC104454...    316   1e-99    Eucalyptus grandis [rose gum]
ref|XP_009133348.1|  PREDICTED: uncharacterized protein LOC103857852    315   1e-99    Brassica rapa
ref|XP_012080986.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    313   5e-99    Jatropha curcas
ref|NP_181454.1|  major facilitator protein                             314   6e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012080985.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    314   6e-99    Jatropha curcas
ref|XP_010557206.1|  PREDICTED: uncharacterized protein LOC104826258    313   8e-99    Tarenaya hassleriana [spider flower]
emb|CDY44632.1|  BnaC04g06300D                                          312   1e-98    Brassica napus [oilseed rape]
ref|XP_003637404.1|  Nitrate and chloride transporter                   313   1e-98    
gb|KEH44269.1|  MFS transporter                                         313   1e-98    Medicago truncatula
gb|KCW65304.1|  hypothetical protein EUGRSUZ_G02762                     307   2e-98    Eucalyptus grandis [rose gum]
ref|XP_002272074.2|  PREDICTED: uncharacterized protein LOC100266758    312   3e-98    Vitis vinifera
ref|XP_010068849.1|  PREDICTED: uncharacterized protein LOC104455823    307   3e-98    Eucalyptus grandis [rose gum]
ref|XP_010691115.1|  PREDICTED: uncharacterized protein LOC104904...    311   5e-98    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX74863.1|  BnaA05g06090D                                          311   5e-98    
ref|XP_012080984.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    311   5e-98    Jatropha curcas
gb|KJB60522.1|  hypothetical protein B456_009G310000                    311   6e-98    Gossypium raimondii
ref|XP_009143336.1|  PREDICTED: uncharacterized protein LOC103867059    310   7e-98    Brassica rapa
ref|XP_010691116.1|  PREDICTED: uncharacterized protein LOC104904...    311   8e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH44271.1|  MFS transporter                                         310   1e-97    Medicago truncatula
ref|XP_010068847.1|  PREDICTED: uncharacterized protein LOC104455819    308   1e-96    Eucalyptus grandis [rose gum]
gb|KCW65302.1|  hypothetical protein EUGRSUZ_G02759                     308   2e-96    Eucalyptus grandis [rose gum]
ref|XP_004497124.1|  PREDICTED: uncharacterized protein LOC101508657    307   2e-96    Cicer arietinum [garbanzo]
gb|KEH44270.1|  MFS transporter                                         307   2e-96    Medicago truncatula
gb|KCW65468.1|  hypothetical protein EUGRSUZ_G02878                     307   3e-96    Eucalyptus grandis [rose gum]
emb|CAN66928.1|  hypothetical protein VITISV_011832                     306   3e-96    Vitis vinifera
ref|XP_010068870.1|  PREDICTED: uncharacterized protein LOC104455846    307   3e-96    Eucalyptus grandis [rose gum]
ref|XP_002519465.1|  conserved hypothetical protein                     306   6e-96    Ricinus communis
ref|XP_011094591.1|  PREDICTED: uncharacterized protein LOC105174255    305   6e-96    Sesamum indicum [beniseed]
ref|XP_010243234.1|  PREDICTED: uncharacterized protein LOC104587357    306   1e-95    Nelumbo nucifera [Indian lotus]
gb|KGN52236.1|  hypothetical protein Csa_5G622530                       299   5e-95    Cucumis sativus [cucumbers]
emb|CDY24976.1|  BnaC03g21960D                                          303   5e-95    Brassica napus [oilseed rape]
ref|XP_010505589.1|  PREDICTED: uncharacterized protein LOC104782373    303   7e-95    Camelina sativa [gold-of-pleasure]
gb|KCW65466.1|  hypothetical protein EUGRSUZ_G02876                     302   7e-95    Eucalyptus grandis [rose gum]
ref|XP_010067354.1|  PREDICTED: uncharacterized protein LOC104454...    302   2e-94    
ref|XP_007027453.1|  Major facilitator superfamily protein              302   2e-94    
ref|XP_007142882.1|  hypothetical protein PHAVU_007G024900g             302   2e-94    Phaseolus vulgaris [French bean]
ref|XP_004497125.1|  PREDICTED: uncharacterized protein LOC101508976    301   2e-94    Cicer arietinum [garbanzo]
ref|XP_010067352.1|  PREDICTED: uncharacterized protein LOC104454...    302   3e-94    Eucalyptus grandis [rose gum]
ref|XP_008366664.1|  PREDICTED: uncharacterized protein LOC103430307    290   3e-94    
gb|KEH44272.1|  MFS transporter                                         301   4e-94    Medicago truncatula
ref|XP_010658347.1|  PREDICTED: uncharacterized protein LOC100256...    299   2e-93    Vitis vinifera
emb|CBI31406.3|  unnamed protein product                                299   2e-93    Vitis vinifera
ref|XP_002267992.3|  PREDICTED: uncharacterized protein LOC100256...    299   2e-93    Vitis vinifera
ref|XP_004142503.1|  PREDICTED: uncharacterized protein LOC101205503    299   2e-93    Cucumis sativus [cucumbers]
ref|XP_010509060.1|  PREDICTED: uncharacterized protein LOC104785526    299   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_008446818.1|  PREDICTED: uncharacterized protein LOC103489434    299   2e-93    Cucumis melo [Oriental melon]
ref|XP_010658344.1|  PREDICTED: uncharacterized membrane protein ...    299   3e-93    Vitis vinifera
ref|XP_007142881.1|  hypothetical protein PHAVU_007G024800g             299   6e-93    Phaseolus vulgaris [French bean]
ref|XP_006293868.1|  hypothetical protein CARUB_v10022856mg             298   7e-93    Capsella rubella
dbj|BAO45884.1|  nitrate and chloride transporter                       298   8e-93    Acacia mangium
ref|XP_004142499.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    297   1e-92    Cucumis sativus [cucumbers]
ref|XP_010435975.1|  PREDICTED: uncharacterized protein LOC104719709    297   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_008446819.1|  PREDICTED: uncharacterized protein LOC103489435    297   1e-92    Cucumis melo [Oriental melon]
ref|XP_010517258.1|  PREDICTED: uncharacterized protein LOC104792736    297   1e-92    Camelina sativa [gold-of-pleasure]
emb|CDX93282.1|  BnaC04g46140D                                          296   2e-92    
gb|KHN02305.1|  Putative transporter MCH1                               295   2e-92    Glycine soja [wild soybean]
ref|XP_011031645.1|  PREDICTED: uncharacterized protein LOC105130706    296   3e-92    Populus euphratica
ref|XP_002265621.3|  PREDICTED: uncharacterized protein LOC100245195    288   3e-92    
ref|XP_012082447.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    296   4e-92    Jatropha curcas
ref|XP_006428454.1|  hypothetical protein CICLE_v10013568mg             296   4e-92    Citrus clementina [clementine]
gb|KHN11443.1|  Putative transporter MCH1                               295   6e-92    Glycine soja [wild soybean]
ref|XP_009141793.1|  PREDICTED: uncharacterized protein LOC103865707    295   6e-92    Brassica rapa
ref|XP_003554397.1|  PREDICTED: uncharacterized protein LOC100818752    295   6e-92    Glycine max [soybeans]
ref|XP_003555225.2|  PREDICTED: uncharacterized protein LOC100819121    295   7e-92    
ref|XP_006379525.1|  nodulin family protein                             295   8e-92    
ref|XP_011094731.1|  PREDICTED: uncharacterized protein LOC105174351    294   1e-91    Sesamum indicum [beniseed]
ref|XP_010267223.1|  PREDICTED: uncharacterized protein LOC104604543    295   4e-91    Nelumbo nucifera [Indian lotus]
emb|CDP15282.1|  unnamed protein product                                293   5e-91    Coffea canephora [robusta coffee]
ref|XP_006491715.1|  PREDICTED: uncharacterized membrane protein ...    293   5e-91    Citrus sinensis [apfelsine]
ref|XP_010450661.1|  PREDICTED: uncharacterized protein LOC104732777    292   7e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008362281.1|  PREDICTED: uncharacterized protein LOC103425934    292   1e-90    
gb|KHN05589.1|  Putative transporter MCH1                               292   1e-90    Glycine soja [wild soybean]
gb|KJB36485.1|  hypothetical protein B456_006G161500                    292   1e-90    Gossypium raimondii
ref|XP_010098802.1|  putative transporter MCH1                          288   2e-90    
ref|NP_001236811.1|  nitrate and chloride transporter                   291   2e-90    
emb|CBI30156.3|  unnamed protein product                                291   2e-90    Vitis vinifera
ref|XP_009417128.1|  PREDICTED: uncharacterized membrane protein ...    292   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268663.2|  PREDICTED: uncharacterized protein LOC100248651    291   4e-90    Vitis vinifera
ref|XP_006354409.1|  PREDICTED: uncharacterized membrane protein ...    290   5e-90    
ref|XP_006411146.1|  hypothetical protein EUTSA_v10016410mg             290   5e-90    Eutrema salsugineum [saltwater cress]
ref|XP_010509061.1|  PREDICTED: uncharacterized protein LOC104785527    290   6e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008387534.1|  PREDICTED: uncharacterized protein LOC103449994    290   7e-90    
ref|XP_007220549.1|  hypothetical protein PRUPE_ppa003180mg             290   7e-90    Prunus persica
ref|XP_009765800.1|  PREDICTED: uncharacterized membrane protein ...    290   8e-90    Nicotiana sylvestris
gb|KHN18681.1|  Putative transporter MCH1                               289   8e-90    Glycine soja [wild soybean]
ref|XP_008233256.1|  PREDICTED: uncharacterized protein LOC103332309    290   9e-90    Prunus mume [ume]
ref|XP_004307342.1|  PREDICTED: uncharacterized protein LOC101306672    289   1e-89    Fragaria vesca subsp. vesca
ref|XP_006285261.1|  hypothetical protein CARUB_v10006632mg             283   2e-89    
ref|XP_010325963.1|  PREDICTED: uncharacterized protein LOC101257997    290   2e-89    Solanum lycopersicum
ref|XP_003521414.2|  PREDICTED: uncharacterized protein LOC100797779    290   2e-89    Glycine max [soybeans]
ref|XP_003553561.1|  PREDICTED: uncharacterized protein LOC100798313    288   3e-89    Glycine max [soybeans]
emb|CDP15281.1|  unnamed protein product                                287   4e-89    Coffea canephora [robusta coffee]
ref|XP_007162787.1|  hypothetical protein PHAVU_001G180500g             287   5e-89    Phaseolus vulgaris [French bean]
ref|XP_009413295.1|  PREDICTED: uncharacterized protein LOC103994629    288   6e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142880.1|  hypothetical protein PHAVU_007G024700g             286   1e-88    Phaseolus vulgaris [French bean]
ref|XP_004142500.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    286   2e-88    Cucumis sativus [cucumbers]
ref|XP_009762916.1|  PREDICTED: uncharacterized protein LOC104214891    285   2e-88    Nicotiana sylvestris
ref|XP_010670396.1|  PREDICTED: uncharacterized protein LOC104887465    284   3e-88    
gb|KHN05591.1|  hypothetical protein glysoja_035791                     285   3e-88    Glycine soja [wild soybean]
ref|XP_003555226.2|  PREDICTED: uncharacterized protein LOC100819661    285   4e-88    
gb|KEH24041.1|  MFS transporter                                         286   4e-88    Medicago truncatula
ref|XP_004249478.1|  PREDICTED: uncharacterized protein LOC101244136    285   4e-88    Solanum lycopersicum
ref|XP_011018791.1|  PREDICTED: uncharacterized protein LOC105121728    285   5e-88    Populus euphratica
ref|XP_007144375.1|  hypothetical protein PHAVU_007G151000g             285   5e-88    Phaseolus vulgaris [French bean]
ref|XP_003555885.1|  PREDICTED: uncharacterized protein LOC100808975    285   5e-88    Glycine max [soybeans]
ref|XP_003536696.1|  PREDICTED: uncharacterized protein LOC100776865    285   5e-88    Glycine max [soybeans]
ref|XP_003590250.1|  Nodule-specific protein Nlj70                      285   5e-88    Medicago truncatula
gb|KHN11444.1|  hypothetical protein glysoja_015339                     285   6e-88    Glycine soja [wild soybean]
ref|XP_003535733.2|  PREDICTED: uncharacterized protein LOC100787176    286   6e-88    Glycine max [soybeans]
ref|XP_006381386.1|  hypothetical protein POPTR_0006s12430g             285   7e-88    
ref|XP_010691114.1|  PREDICTED: uncharacterized protein LOC104904539    284   9e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011469615.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    284   1e-87    Fragaria vesca subsp. vesca
ref|XP_002519464.1|  conserved hypothetical protein                     284   1e-87    Ricinus communis
ref|XP_010673913.1|  PREDICTED: uncharacterized protein LOC104890215    284   2e-87    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN11442.1|  Putative transporter MCH1                               283   2e-87    Glycine soja [wild soybean]
ref|XP_009368999.1|  PREDICTED: uncharacterized protein LOC103958461    283   3e-87    Pyrus x bretschneideri [bai li]
ref|NP_001051581.1|  Os03g0800000                                       277   4e-87    
ref|XP_007027450.1|  Major facilitator superfamily protein, putative    281   5e-87    
ref|XP_009630642.1|  PREDICTED: uncharacterized membrane protein ...    283   6e-87    
ref|XP_008241388.1|  PREDICTED: uncharacterized protein LOC103339814    283   7e-87    Prunus mume [ume]
ref|XP_010933270.1|  PREDICTED: uncharacterized membrane protein ...    283   8e-87    Elaeis guineensis
ref|XP_003590365.1|  Nodule-specific protein Nlj70                      282   8e-87    Medicago truncatula
ref|XP_009377045.1|  PREDICTED: uncharacterized protein LOC103965696    282   1e-86    Pyrus x bretschneideri [bai li]
ref|XP_008456537.1|  PREDICTED: uncharacterized protein LOC103496460    282   1e-86    Cucumis melo [Oriental melon]
gb|EYU29889.1|  hypothetical protein MIMGU_mgv1a003835mg                280   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_004150375.2|  PREDICTED: uncharacterized protein LOC101208506    281   2e-86    Cucumis sativus [cucumbers]
ref|XP_011651970.1|  PREDICTED: uncharacterized protein LOC101216551    280   2e-86    Cucumis sativus [cucumbers]
gb|KHN39024.1|  Putative transporter MCH1                               280   2e-86    Glycine soja [wild soybean]
ref|XP_003537006.1|  PREDICTED: uncharacterized protein LOC100782396    280   3e-86    Glycine max [soybeans]
ref|XP_008379735.1|  PREDICTED: uncharacterized protein LOC103442697    281   4e-86    
ref|XP_007204603.1|  hypothetical protein PRUPE_ppa002810mg             281   6e-86    Prunus persica
gb|EPS59101.1|  hypothetical protein M569_15705                         278   1e-85    Genlisea aurea
gb|AFK46076.1|  unknown                                                 271   1e-85    Lotus japonicus
ref|XP_007221112.1|  hypothetical protein PRUPE_ppa017904mg             278   1e-85    
ref|XP_007145510.1|  hypothetical protein PHAVU_007G244600g             278   2e-85    Phaseolus vulgaris [French bean]
ref|XP_010050695.1|  PREDICTED: uncharacterized protein LOC104439313    280   2e-85    Eucalyptus grandis [rose gum]
ref|XP_006651692.1|  PREDICTED: uncharacterized protein LOC102719372    280   2e-85    Oryza brachyantha
ref|XP_010050685.1|  PREDICTED: uncharacterized protein LOC104439301    279   2e-85    Eucalyptus grandis [rose gum]
gb|EAZ28933.1|  hypothetical protein OsJ_12977                          276   9e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003541428.1|  PREDICTED: uncharacterized protein LOC100814000    276   9e-85    Glycine max [soybeans]
emb|CBI31408.3|  unnamed protein product                                283   9e-85    Vitis vinifera
gb|KCW65303.1|  hypothetical protein EUGRSUZ_G02761                     270   1e-84    Eucalyptus grandis [rose gum]
ref|XP_010050677.1|  PREDICTED: uncharacterized protein LOC104439293    277   1e-84    Eucalyptus grandis [rose gum]
gb|AAO37543.1|  putative nodule-specific protein                        277   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304474.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    275   4e-84    Fragaria vesca subsp. vesca
gb|KHN48244.1|  Putative transporter MCH1                               275   4e-84    Glycine soja [wild soybean]
ref|XP_004494077.1|  PREDICTED: uncharacterized protein LOC101506073    275   5e-84    Cicer arietinum [garbanzo]
ref|XP_006339087.1|  PREDICTED: uncharacterized protein LOC102587756    274   7e-84    Solanum tuberosum [potatoes]
ref|XP_006339088.1|  PREDICTED: uncharacterized protein LOC102588077    273   8e-84    
gb|KHN23223.1|  hypothetical protein glysoja_047351                     273   9e-84    Glycine soja [wild soybean]
ref|XP_010677449.1|  PREDICTED: uncharacterized protein LOC104893078    274   9e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794008.1|  PREDICTED: uncharacterized membrane protein ...    275   1e-83    Phoenix dactylifera
ref|XP_003518996.1|  PREDICTED: uncharacterized protein LOC100789645    273   2e-83    Glycine max [soybeans]
ref|XP_010510684.1|  PREDICTED: uncharacterized protein LOC104786...    272   2e-83    Camelina sativa [gold-of-pleasure]
gb|KJB36486.1|  hypothetical protein B456_006G161600                    273   3e-83    Gossypium raimondii
ref|XP_010414589.1|  PREDICTED: uncharacterized protein LOC104700...    272   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_004249479.1|  PREDICTED: uncharacterized protein LOC101244433    271   4e-83    Solanum lycopersicum
gb|AAC39500.1|  nodule-specific protein Nlj70                           271   7e-83    Lotus japonicus
ref|XP_010470138.1|  PREDICTED: uncharacterized protein LOC104750092    271   7e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010098800.1|  hypothetical protein L484_022565                   272   8e-83    
emb|CDY30506.1|  BnaA04g16270D                                          271   9e-83    Brassica napus [oilseed rape]
tpg|DAA51974.1|  TPA: hypothetical protein ZEAMMB73_438867              266   1e-82    
ref|XP_009606524.1|  PREDICTED: uncharacterized protein LOC104100872    270   1e-82    Nicotiana tomentosiformis
ref|XP_009140846.1|  PREDICTED: uncharacterized protein LOC103864824    271   1e-82    Brassica rapa
ref|XP_004981407.1|  PREDICTED: uncharacterized protein LOC101759573    271   1e-82    Setaria italica
ref|XP_006354407.1|  PREDICTED: uncharacterized protein LOC102589907    270   1e-82    Solanum tuberosum [potatoes]
ref|XP_006664561.1|  PREDICTED: uncharacterized protein LOC102703921    270   3e-82    Oryza brachyantha
gb|KFK32342.1|  hypothetical protein AALP_AA6G229300                    270   3e-82    Arabis alpina [alpine rockcress]
ref|XP_002880951.1|  nodulin family protein                             269   4e-82    Arabidopsis lyrata subsp. lyrata
gb|EMS57879.1|  putative transporter MCH1                               266   4e-82    Triticum urartu
ref|XP_008779532.1|  PREDICTED: probable transporter MCH1               262   5e-82    
ref|XP_003559292.1|  PREDICTED: uncharacterized protein LOC100830563    270   7e-82    Brachypodium distachyon [annual false brome]
dbj|BAJ89452.1|  predicted protein                                      270   7e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86744.1|  predicted protein                                      268   8e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006295838.1|  hypothetical protein CARUB_v10024965mg             268   9e-82    
ref|NP_001066777.2|  Os12g0484600                                       268   1e-81    
gb|EAY83124.1|  hypothetical protein OsI_38340                          268   1e-81    Oryza sativa Indica Group [Indian rice]
dbj|BAJ93275.1|  predicted protein                                      268   2e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX71381.1|  BnaC04g16160D                                          268   2e-81    
ref|NP_180379.1|  major facilitator protein                             268   2e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CAN63260.1|  hypothetical protein VITISV_029213                     268   2e-81    Vitis vinifera
ref|XP_009783152.1|  PREDICTED: uncharacterized protein LOC104231797    267   2e-81    Nicotiana sylvestris
emb|CDY04538.1|  BnaA07g13640D                                          267   2e-81    
ref|XP_002464077.1|  hypothetical protein SORBIDRAFT_01g011890          269   2e-81    Sorghum bicolor [broomcorn]
gb|EMT24580.1|  hypothetical protein F775_21272                         268   4e-81    
ref|XP_006838710.1|  PREDICTED: uncharacterized protein LOC18429361     267   4e-81    
ref|XP_009103645.1|  PREDICTED: uncharacterized membrane protein ...    266   4e-81    Brassica rapa
ref|XP_011655862.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    267   4e-81    Cucumis sativus [cucumbers]
ref|XP_011469614.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    266   7e-81    Fragaria vesca subsp. vesca
dbj|BAJ86921.1|  predicted protein                                      266   9e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14418.1|  unnamed protein product                                265   1e-80    Coffea canephora [robusta coffee]
ref|XP_008385512.1|  PREDICTED: uncharacterized protein LOC103448055    265   1e-80    Malus domestica [apple tree]
ref|XP_006409833.1|  hypothetical protein EUTSA_v10016458mg             265   1e-80    
ref|XP_009345750.1|  PREDICTED: uncharacterized protein LOC103937531    265   2e-80    Pyrus x bretschneideri [bai li]
ref|XP_010689140.1|  PREDICTED: uncharacterized protein LOC104902902    266   2e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003576191.1|  PREDICTED: uncharacterized protein LOC100839547    266   2e-80    Brachypodium distachyon [annual false brome]
ref|XP_009335989.1|  PREDICTED: uncharacterized protein LOC103928636    265   2e-80    Pyrus x bretschneideri [bai li]
gb|EMT08425.1|  hypothetical protein F775_07944                         266   2e-80    
ref|XP_008665606.1|  PREDICTED: uncharacterized protein LOC103644190    266   2e-80    
ref|XP_008665607.1|  PREDICTED: uncharacterized protein LOC103644191    266   3e-80    Zea mays [maize]
ref|XP_012082602.1|  PREDICTED: uncharacterized protein LOC105642394    264   4e-80    
gb|KDP29178.1|  hypothetical protein JCGZ_16567                         264   5e-80    Jatropha curcas
gb|AAP68384.1|  hypothetical protein                                    265   5e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EMS61490.1|  hypothetical protein TRIUR3_01875                       258   5e-80    Triticum urartu
ref|XP_004986309.1|  PREDICTED: uncharacterized membrane protein ...    265   9e-80    Setaria italica
gb|ABF98224.1|  nodulin family protein, putative                        265   9e-80    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141252.1|  uncharacterized protein LOC100273339               256   2e-79    
ref|XP_009356931.1|  PREDICTED: uncharacterized protein LOC103947712    261   3e-79    Pyrus x bretschneideri [bai li]
gb|EAY91415.1|  hypothetical protein OsI_13040                          262   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_003559578.1|  PREDICTED: uncharacterized protein LOC100828435    262   4e-79    Brachypodium distachyon [annual false brome]
ref|XP_008226501.1|  PREDICTED: uncharacterized protein LOC103326070    261   5e-79    Prunus mume [ume]
ref|XP_002301218.2|  hypothetical protein POPTR_0002s13500g             259   6e-79    
gb|EAZ03041.1|  hypothetical protein OsI_25182                          261   1e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006384953.1|  nodulin family protein                             259   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_007208506.1|  hypothetical protein PRUPE_ppa026488mg             259   2e-78    Prunus persica
ref|XP_002466277.1|  hypothetical protein SORBIDRAFT_01g004940          261   2e-78    Sorghum bicolor [broomcorn]
emb|CDP14419.1|  unnamed protein product                                258   4e-78    Coffea canephora [robusta coffee]
ref|XP_003557448.1|  PREDICTED: uncharacterized protein LOC100822987    260   5e-78    
ref|XP_008379570.1|  PREDICTED: uncharacterized protein LOC103442545    259   5e-78    
ref|XP_010111839.1|  hypothetical protein L484_020631                   258   6e-78    Morus notabilis
gb|EYU36146.1|  hypothetical protein MIMGU_mgv1a018039mg                258   8e-78    Erythranthe guttata [common monkey flower]
ref|XP_010045310.1|  PREDICTED: uncharacterized protein LOC104434056    258   1e-77    Eucalyptus grandis [rose gum]
ref|XP_011459986.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    256   1e-77    Fragaria vesca subsp. vesca
gb|EPS69782.1|  hypothetical protein M569_04980                         257   1e-77    Genlisea aurea
ref|XP_009368937.1|  PREDICTED: uncharacterized protein LOC103958409    258   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_011089961.1|  PREDICTED: uncharacterized protein LOC105170755    257   2e-77    Sesamum indicum [beniseed]
ref|XP_004288935.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    257   2e-77    Fragaria vesca subsp. vesca
ref|XP_008355198.1|  PREDICTED: uncharacterized protein LOC103418866    256   2e-77    
ref|XP_011028256.1|  PREDICTED: uncharacterized protein LOC105128342    256   2e-77    Populus euphratica
ref|XP_009397027.1|  PREDICTED: uncharacterized protein LOC103981971    257   3e-77    
ref|XP_004977870.1|  PREDICTED: uncharacterized protein LOC101756569    257   3e-77    Setaria italica
ref|XP_006424462.1|  hypothetical protein CICLE_v10028100mg             256   4e-77    Citrus clementina [clementine]
gb|KDO60260.1|  hypothetical protein CISIN_1g037996mg                   255   6e-77    Citrus sinensis [apfelsine]
gb|KHN32812.1|  hypothetical protein glysoja_024171                     256   7e-77    Glycine soja [wild soybean]
ref|XP_002313536.1|  nodulin family protein                             255   8e-77    Populus trichocarpa [western balsam poplar]
dbj|BAC83908.1|  putative nodule-specific protein                       256   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962674.1|  PREDICTED: uncharacterized protein LOC101763766    256   9e-77    Setaria italica
ref|XP_004230920.1|  PREDICTED: uncharacterized protein LOC101255930    254   1e-76    Solanum lycopersicum
ref|XP_006599452.1|  PREDICTED: uncharacterized protein LOC102661181    255   1e-76    Glycine max [soybeans]
ref|XP_011032303.1|  PREDICTED: uncharacterized protein LOC105131167    254   2e-76    Populus euphratica
ref|XP_006488014.1|  PREDICTED: uncharacterized protein LOC102630186    254   2e-76    Citrus sinensis [apfelsine]
ref|XP_004147280.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    254   3e-76    Cucumis sativus [cucumbers]
tpg|DAA50695.1|  TPA: hypothetical protein ZEAMMB73_557403              257   4e-76    
gb|EMT05699.1|  hypothetical protein F775_14489                         249   5e-76    
ref|XP_002449966.1|  hypothetical protein SORBIDRAFT_05g026300          254   1e-75    Sorghum bicolor [broomcorn]
tpg|DAA54890.1|  TPA: hypothetical protein ZEAMMB73_736019              253   1e-75    
ref|XP_002523712.1|  conserved hypothetical protein                     252   1e-75    
ref|XP_009627404.1|  PREDICTED: uncharacterized protein LOC104117959    252   2e-75    Nicotiana tomentosiformis
ref|XP_002442137.1|  hypothetical protein SORBIDRAFT_08g014860          252   2e-75    
gb|EMS46684.1|  hypothetical protein TRIUR3_34627                       249   2e-75    Triticum urartu
ref|XP_002534014.1|  conserved hypothetical protein                     250   4e-75    
emb|CBI31405.3|  unnamed protein product                                250   6e-75    Vitis vinifera
gb|KDO47545.1|  hypothetical protein CISIN_1g040453mg                   249   7e-75    Citrus sinensis [apfelsine]
ref|XP_008233255.1|  PREDICTED: uncharacterized protein LOC103332307    250   1e-74    Prunus mume [ume]
ref|XP_010321905.1|  PREDICTED: uncharacterized protein LOC101251293    249   2e-74    Solanum lycopersicum
ref|XP_007016870.1|  Major facilitator superfamily protein              251   2e-74    
ref|XP_008462497.1|  PREDICTED: uncharacterized protein LOC103500834    249   2e-74    
ref|XP_008465591.1|  PREDICTED: uncharacterized protein LOC103503227    249   2e-74    
dbj|BAK06441.1|  predicted protein                                      247   3e-74    
ref|XP_007219108.1|  hypothetical protein PRUPE_ppa015620mg             249   3e-74    
emb|CDM84956.1|  unnamed protein product                                249   3e-74    
gb|KDP43975.1|  hypothetical protein JCGZ_05442                         247   5e-74    
ref|XP_009766499.1|  PREDICTED: uncharacterized protein LOC104217867    247   8e-74    
ref|XP_012064708.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    247   1e-73    
ref|XP_008226513.1|  PREDICTED: uncharacterized protein LOC103326077    246   2e-73    
gb|KJB26230.1|  hypothetical protein B456_004G231700                    246   2e-73    
dbj|BAJ90449.1|  predicted protein                                      248   2e-73    
ref|XP_011089957.1|  PREDICTED: uncharacterized protein LOC105170752    246   3e-73    
ref|XP_007206680.1|  hypothetical protein PRUPE_ppa022835mg             245   4e-73    
ref|XP_010557355.1|  PREDICTED: uncharacterized protein LOC104826384    245   9e-73    
ref|XP_009621414.1|  PREDICTED: uncharacterized protein LOC104113038    243   2e-72    
gb|EPS63290.1|  hypothetical protein M569_11492                         243   3e-72    
gb|EMT12733.1|  Putative transporter MCH1                               237   3e-72    
ref|NP_001152028.1|  nitrate and chloride transporter                   244   3e-72    
ref|XP_008385510.1|  PREDICTED: uncharacterized protein LOC103448053    243   4e-72    
ref|XP_008369817.1|  PREDICTED: uncharacterized protein LOC103433347    243   6e-72    
tpg|DAA42500.1|  TPA: nitrate and chloride transporter                  243   1e-71    
emb|CDP07039.1|  unnamed protein product                                242   1e-71    
ref|XP_006428271.1|  hypothetical protein CICLE_v10013309mg             241   1e-71    
ref|XP_009356979.1|  PREDICTED: uncharacterized protein LOC103947752    241   2e-71    
gb|KDO39314.1|  hypothetical protein CISIN_1g047229mg                   241   3e-71    
ref|XP_009356932.1|  PREDICTED: uncharacterized protein LOC103947713    240   5e-71    
ref|XP_009333629.1|  PREDICTED: uncharacterized protein LOC103926552    241   1e-70    
ref|XP_008385511.1|  PREDICTED: uncharacterized protein LOC103448054    239   1e-70    
ref|XP_004963329.1|  PREDICTED: uncharacterized protein LOC101753233    238   5e-70    
ref|XP_008811023.1|  PREDICTED: uncharacterized protein LOC103722299    237   6e-70    
ref|XP_009338584.1|  PREDICTED: uncharacterized protein LOC103930905    240   6e-70    
ref|XP_004979965.1|  PREDICTED: uncharacterized protein LOC101755644    238   7e-70    
ref|XP_004146405.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    236   8e-70    
ref|XP_007207792.1|  hypothetical protein PRUPE_ppa025606mg             226   1e-69    
gb|EEC69742.1|  hypothetical protein OsI_39271                          234   7e-69    
ref|XP_010651774.1|  PREDICTED: uncharacterized protein LOC100244770    236   9e-69    
ref|XP_007208449.1|  hypothetical protein PRUPE_ppa003535mg             234   1e-68    
ref|XP_006436519.1|  hypothetical protein CICLE_v10031022mg             234   1e-68    
ref|XP_008227863.1|  PREDICTED: uncharacterized membrane protein ...    234   1e-68    
ref|XP_010933280.1|  PREDICTED: uncharacterized membrane protein ...    233   2e-68    
ref|XP_004143363.2|  PREDICTED: uncharacterized protein LOC101203981    234   2e-68    
emb|CAN61265.1|  hypothetical protein VITISV_013572                     231   2e-68    
gb|KCW65295.1|  hypothetical protein EUGRSUZ_G02749                     224   2e-68    
ref|XP_009612261.1|  PREDICTED: uncharacterized protein LOC104105...    233   3e-68    
ref|XP_010236602.1|  PREDICTED: uncharacterized protein LOC100836162    233   3e-68    
ref|XP_009612260.1|  PREDICTED: uncharacterized protein LOC104105...    233   3e-68    
ref|XP_008442718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   4e-68    
gb|EEE53674.1|  hypothetical protein OsJ_37007                          231   4e-68    
ref|NP_001067374.2|  Os12g0637800                                       232   8e-68    
ref|XP_009786215.1|  PREDICTED: uncharacterized protein LOC104234332    232   9e-68    
gb|EAY84040.1|  hypothetical protein OsI_39270                          231   2e-67    
emb|CAN82898.1|  hypothetical protein VITISV_026994                     231   3e-67    
ref|XP_002273103.2|  PREDICTED: uncharacterized protein LOC100249900    231   3e-67    
gb|KJB56226.1|  hypothetical protein B456_009G111200                    230   4e-67    
ref|XP_002461592.1|  hypothetical protein SORBIDRAFT_02g005120          231   4e-67    
ref|XP_010068844.1|  PREDICTED: uncharacterized protein LOC104455813    224   5e-67    
ref|XP_002519466.1|  conserved hypothetical protein                     229   9e-67    
ref|XP_010267225.1|  PREDICTED: uncharacterized protein LOC104604545    228   2e-66    
gb|EAZ21349.1|  hypothetical protein OsJ_37006                          228   5e-66    
ref|XP_007010021.1|  Major facilitator superfamily protein              227   6e-66    
ref|XP_011084394.1|  PREDICTED: uncharacterized protein LOC105166652    228   6e-66    
gb|KJB73493.1|  hypothetical protein B456_011G234900                    225   9e-66    
ref|XP_010543563.1|  PREDICTED: uncharacterized protein LOC104816431    226   2e-65    
ref|XP_006361717.1|  PREDICTED: uncharacterized protein LOC102585444    226   2e-65    
ref|XP_009614669.1|  PREDICTED: uncharacterized protein LOC104107543    226   2e-65    
ref|XP_002442614.1|  hypothetical protein SORBIDRAFT_08g023010          226   3e-65    
emb|CBI17146.3|  unnamed protein product                                230   5e-65    
ref|XP_008811024.1|  PREDICTED: uncharacterized protein LOC103722300    224   6e-65    
ref|XP_012064707.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    224   6e-65    
ref|XP_006664781.1|  PREDICTED: uncharacterized protein LOC102705033    224   8e-65    
ref|XP_006349027.1|  PREDICTED: uncharacterized membrane protein ...    223   1e-64    
ref|XP_004250977.1|  PREDICTED: uncharacterized membrane protein ...    223   1e-64    
ref|XP_010933292.1|  PREDICTED: uncharacterized protein LOC105053726    224   1e-64    
ref|XP_009782107.1|  PREDICTED: uncharacterized membrane protein ...    223   2e-64    
ref|XP_006662218.1|  PREDICTED: uncharacterized protein LOC102719238    223   2e-64    
gb|KJB56225.1|  hypothetical protein B456_009G111100                    218   4e-64    
gb|EYU39872.1|  hypothetical protein MIMGU_mgv1a024761mg                222   4e-64    
ref|XP_006366091.1|  PREDICTED: uncharacterized protein LOC102598479    222   5e-64    
ref|XP_004963328.1|  PREDICTED: uncharacterized protein LOC101752820    222   7e-64    
ref|XP_002443658.1|  hypothetical protein SORBIDRAFT_08g023020          222   7e-64    
ref|XP_010068872.1|  PREDICTED: uncharacterized protein LOC104455848    221   1e-63    
gb|KCW65471.1|  hypothetical protein EUGRSUZ_G02881                     221   1e-63    
gb|EMS62461.1|  hypothetical protein TRIUR3_33479                       216   1e-63    
emb|CDX77158.1|  BnaC04g39530D                                          217   2e-62    
ref|XP_008652149.1|  PREDICTED: uncharacterized protein LOC103632070    219   2e-62    
emb|CDO99802.1|  unnamed protein product                                216   7e-62    
ref|XP_004147311.1|  PREDICTED: uncharacterized protein LOC101204873    214   3e-61    
ref|XP_008464760.1|  PREDICTED: uncharacterized protein LOC103502564    214   4e-61    
emb|CAN71485.1|  hypothetical protein VITISV_025339                     213   8e-61    
ref|XP_009399380.1|  PREDICTED: uncharacterized protein LOC103983816    213   2e-60    
ref|XP_008464796.1|  PREDICTED: uncharacterized protein LOC103502596    202   4e-60    
ref|XP_007208600.1|  hypothetical protein PRUPE_ppa022397mg             208   2e-59    
ref|XP_007206245.1|  hypothetical protein PRUPE_ppa015599mg             198   6e-59    
ref|XP_008464731.1|  PREDICTED: uncharacterized protein LOC103502544    207   1e-58    
gb|AAM01022.1|AC090488_22  Hypothetical protein                         207   2e-58    
gb|KGN64768.1|  hypothetical protein Csa_1G095540                       204   3e-58    
gb|EAY77816.1|  hypothetical protein OsI_32858                          207   3e-58    
ref|XP_008464767.1|  PREDICTED: uncharacterized protein LOC103502570    206   4e-58    
ref|XP_003540770.1|  PREDICTED: uncharacterized protein LOC100799928    206   6e-58    
ref|XP_007132716.1|  hypothetical protein PHAVU_011G118800g             205   1e-57    
gb|KHN21070.1|  hypothetical protein glysoja_006549                     205   2e-57    
ref|XP_004147303.2|  PREDICTED: uncharacterized protein LOC101202941    204   2e-57    
ref|XP_004147309.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    204   2e-57    
ref|XP_004147312.1|  PREDICTED: uncharacterized membrane protein ...    204   2e-57    
ref|XP_002272443.3|  PREDICTED: uncharacterized protein LOC100242799    204   3e-57    
ref|XP_004147308.1|  PREDICTED: uncharacterized protein LOC101204150    203   5e-57    
emb|CAN72050.1|  hypothetical protein VITISV_016339                     202   8e-57    
gb|KCW65297.1|  hypothetical protein EUGRSUZ_G027542                    192   1e-56    
gb|KCW65476.1|  hypothetical protein EUGRSUZ_G028861                    192   3e-56    
ref|XP_008464784.1|  PREDICTED: uncharacterized protein LOC103502588    200   7e-56    
gb|KGN64769.1|  hypothetical protein Csa_1G096040                       197   1e-55    
ref|XP_002461320.1|  hypothetical protein SORBIDRAFT_02g000890          198   4e-55    
ref|XP_008670908.1|  PREDICTED: uncharacterized protein LOC103648199    196   8e-55    
ref|XP_004147304.1|  PREDICTED: uncharacterized protein LOC101203173    196   2e-54    
ref|XP_008464773.1|  PREDICTED: uncharacterized protein LOC103502580    196   2e-54    
gb|KJB26227.1|  hypothetical protein B456_004G231600                    193   5e-54    
gb|KDO37221.1|  hypothetical protein CISIN_1g039263mg                   193   6e-54    
ref|XP_008670991.1|  PREDICTED: uncharacterized protein LOC103648285    192   8e-53    
ref|XP_006436517.1|  hypothetical protein CICLE_v10033479mg             182   2e-52    
ref|XP_008464809.1|  PREDICTED: uncharacterized protein LOC103502605    191   2e-52    
ref|XP_011648449.1|  PREDICTED: probable transporter MCH1               181   4e-52    
gb|KGN54809.1|  hypothetical protein Csa_4G507390                       187   9e-52    
ref|NP_001067373.1|  Os12g0637700                                       186   1e-50    
ref|XP_002979899.1|  hypothetical protein SELMODRAFT_271410             180   2e-48    
ref|XP_009400855.1|  PREDICTED: uncharacterized protein LOC103984984    174   1e-46    
ref|XP_002979925.1|  hypothetical protein SELMODRAFT_178001             171   3e-45    
ref|XP_008374915.1|  PREDICTED: uncharacterized protein LOC103438155    171   3e-45    
ref|XP_002987406.1|  hypothetical protein SELMODRAFT_235284             170   5e-45    
tpg|DAA54793.1|  TPA: hypothetical protein ZEAMMB73_389508              166   6e-45    
ref|XP_010091041.1|  hypothetical protein L484_006405                   166   8e-45    
ref|XP_009788802.1|  PREDICTED: uncharacterized protein LOC104236559    168   2e-44    
ref|XP_011087196.1|  PREDICTED: uncharacterized protein LOC105168751    168   2e-44    
gb|KHN01934.1|  Putative transporter MCH1                               166   3e-44    
dbj|BAF00426.1|  nodulin-like protein                                   167   6e-44    
ref|NP_850229.2|  major facilitator protein                             167   6e-44    
ref|XP_002266530.2|  PREDICTED: uncharacterized protein LOC100244916    167   7e-44    
ref|XP_002442621.1|  hypothetical protein SORBIDRAFT_08g023130          167   7e-44    
ref|XP_009343443.1|  PREDICTED: uncharacterized protein LOC103935402    167   7e-44    
ref|XP_010255962.1|  PREDICTED: uncharacterized protein LOC104596480    167   7e-44    
emb|CBI15294.3|  unnamed protein product                                167   1e-43    
tpg|DAA54792.1|  TPA: nodulin-like protein                              166   1e-43    
ref|XP_010272188.1|  PREDICTED: uncharacterized protein LOC104608039    166   1e-43    
ref|XP_010917688.1|  PREDICTED: uncharacterized membrane protein ...    166   1e-43    
ref|XP_006838662.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4      166   1e-43    
ref|NP_001149402.1|  nodulin-like protein                               166   1e-43    
ref|XP_003579078.1|  PREDICTED: uncharacterized protein LOC100846557    166   1e-43    
gb|KHN19369.1|  Putative transporter MCH1                               162   2e-43    
ref|XP_007206727.1|  hypothetical protein PRUPE_ppa024782mg             165   3e-43    
gb|AES67885.2|  MFS transporter                                         165   3e-43    
ref|XP_003523049.1|  PREDICTED: uncharacterized protein LOC100775...    165   3e-43    
ref|XP_011087197.1|  PREDICTED: uncharacterized protein LOC105168753    164   5e-43    
ref|XP_004299629.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    164   5e-43    
ref|XP_008239662.1|  PREDICTED: probable transporter MCH1               164   5e-43    
emb|CAH10046.1|  Unknown similar to A.thaliana Hypothetical prote...    164   6e-43    
ref|XP_008801875.1|  PREDICTED: uncharacterized protein LOC103715...    164   6e-43    
emb|CAH10068.1|  Unknown similar to A.thaliana Hypothetical prote...    164   7e-43    
gb|ACJ22502.1|  unknown                                                 164   7e-43    
ref|XP_007209882.1|  hypothetical protein PRUPE_ppa003974mg             164   7e-43    
emb|CAH10204.1|  Unknown similar to A.thaliana Hypothetical prote...    164   8e-43    
ref|XP_003597634.1|  Nodulin-like protein                               164   8e-43    
ref|XP_003636432.1|  Nodulin-like protein                               164   8e-43    
ref|XP_006294011.1|  hypothetical protein CARUB_v10022999mg             163   1e-42    
gb|KCW49356.1|  hypothetical protein EUGRSUZ_K02900                     164   1e-42    
ref|XP_010037619.1|  PREDICTED: uncharacterized protein LOC104426318    163   1e-42    
ref|XP_002879492.1|  hypothetical protein ARALYDRAFT_321151             168   1e-42    
ref|XP_010509767.1|  PREDICTED: uncharacterized protein LOC104786129    162   1e-42    
ref|NP_177616.1|  nodulin-like and major facilitator domain-conta...    163   1e-42    
gb|AAP04143.1|  unknown protein                                         163   1e-42    
ref|XP_010504888.1|  PREDICTED: uncharacterized protein LOC104781820    162   1e-42    
ref|XP_009783437.1|  PREDICTED: uncharacterized protein LOC104232044    163   2e-42    
ref|XP_010540538.1|  PREDICTED: probable transporter MCH1 isoform X1    162   2e-42    
ref|XP_010540539.1|  PREDICTED: probable transporter MCH1 isoform X2    162   2e-42    
ref|XP_006416551.1|  hypothetical protein EUTSA_v10007356mg             162   2e-42    
ref|XP_010428471.1|  PREDICTED: uncharacterized protein LOC104713117    162   2e-42    
ref|XP_004963339.1|  PREDICTED: probable transporter mch1-like          162   2e-42    
ref|XP_008777475.1|  PREDICTED: probable transporter mch1               163   3e-42    
ref|XP_006302127.1|  hypothetical protein CARUB_v10020132mg             162   3e-42    
gb|AAC27411.1|  nodulin-like protein                                    167   3e-42    
ref|XP_011659929.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4      162   3e-42    
ref|XP_003528176.1|  PREDICTED: uncharacterized protein LOC100799596    162   3e-42    
gb|KCW49359.1|  hypothetical protein EUGRSUZ_K029031                    160   3e-42    
gb|EAY84053.1|  hypothetical protein OsI_39282                          162   3e-42    
ref|XP_009141377.1|  PREDICTED: uncharacterized protein LOC103865331    162   4e-42    
ref|XP_010516580.1|  PREDICTED: uncharacterized protein LOC104792188    162   4e-42    
ref|XP_006367059.1|  PREDICTED: uncharacterized protein LOC102578204    162   5e-42    
ref|XP_006390390.1|  hypothetical protein EUTSA_v10018391mg             161   6e-42    
ref|XP_008453166.1|  PREDICTED: uncharacterized protein LOC103493962    162   6e-42    
ref|NP_001067386.1|  Os12g0639100                                       161   6e-42    
ref|XP_002887558.1|  nodulin family protein                             161   8e-42    
ref|XP_010459545.1|  PREDICTED: probable transporter MCH1 isoform X2    158   8e-42    
ref|XP_009104745.1|  PREDICTED: uncharacterized protein LOC103830685    161   9e-42    
ref|XP_004236184.1|  PREDICTED: uncharacterized protein LOC101244171    161   9e-42    
ref|XP_007037173.1|  Nodulin-like / Major Facilitator Superfamily...    161   1e-41    
ref|XP_009609132.1|  PREDICTED: uncharacterized protein LOC104102978    161   1e-41    
ref|XP_010471567.1|  PREDICTED: uncharacterized protein LOC104751346    160   1e-41    
ref|XP_010933941.1|  PREDICTED: probable transporter mch1 isoform X1    161   1e-41    
ref|XP_012080182.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4      161   1e-41    
ref|XP_010539949.1|  PREDICTED: uncharacterized protein LOC104813863    160   1e-41    
emb|CAH10054.1|  Unknown similar to A.thaliana Hypothetical prote...    160   1e-41    
ref|XP_009609133.1|  PREDICTED: uncharacterized protein LOC104102979    161   1e-41    
gb|AAV49984.1|  hypothetical protein                                    160   1e-41    
ref|XP_010416334.1|  PREDICTED: uncharacterized protein LOC104702206    160   2e-41    
ref|XP_010459543.1|  PREDICTED: uncharacterized protein LOC104740...    158   2e-41    
emb|CDX68165.1|  BnaA07g22050D                                          160   2e-41    
ref|XP_010091038.1|  putative transporter MCH1                          157   2e-41    
ref|XP_010541167.1|  PREDICTED: uncharacterized protein LOC104814691    163   3e-41    
emb|CDY26708.1|  BnaA06g13140D                                          159   4e-41    
emb|CDY19262.1|  BnaC05g14630D                                          159   4e-41    
ref|XP_006307112.1|  hypothetical protein CARUB_v10008700mg             159   4e-41    
gb|KDO38592.1|  hypothetical protein CISIN_1g038282mg                   153   4e-41    
gb|KJB18828.1|  hypothetical protein B456_003G071000                    159   5e-41    
ref|XP_004299628.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    158   7e-41    
ref|XP_010498299.1|  PREDICTED: uncharacterized protein LOC104776010    158   7e-41    
ref|XP_001777486.1|  predicted protein                                  159   8e-41    
ref|XP_006367060.1|  PREDICTED: uncharacterized protein LOC102578528    158   9e-41    
gb|KDO76012.1|  hypothetical protein CISIN_1g008482mg                   157   9e-41    
ref|XP_002511500.1|  conserved hypothetical protein                     158   1e-40    
ref|XP_002511499.1|  conserved hypothetical protein                     158   1e-40    
ref|XP_006410579.1|  hypothetical protein EUTSA_v10016523mg             157   1e-40    
ref|XP_002890306.1|  nodulin family protein                             157   2e-40    
ref|XP_002321541.2|  nodulin family protein                             157   2e-40    



>ref|XP_009792652.1| PREDICTED: uncharacterized protein LOC104239662 [Nicotiana sylvestris]
Length=598

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSE+FL KYKFPRPL LTI L ISC+GH+LIA
Sbjct  380  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLIISCIGHILIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  440  FNVPGGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYLLNVRV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EAE+Q+KALG+ RR GEDL+C GV CF+LAFIIITAVT FG  VS +L +RTR
Sbjct  500  AGHLYDKEAEKQLKALGRTRRQGEDLNCDGVVCFKLAFIIITAVTIFGAFVSIILVIRTR  559

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  560  KFYKSDIYKKFR  571



>ref|XP_009780392.1| PREDICTED: uncharacterized protein LOC104229438 [Nicotiana sylvestris]
Length=598

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRVA+GFLSEHFL+KYKFPRPL+LTI L ISC+GHLLIA
Sbjct  379  LGYPKTSISTFVSLVSIWNYLGRVASGFLSEHFLSKYKFPRPLMLTITLIISCLGHLLIA  438

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+VRGGLY AS++IGFCFGAQWPLL+AIISELFGLKYYSTLYNFGS ASPIG+Y+LNVR+
Sbjct  439  FDVRGGLYIASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYVLNVRL  498

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EAE+QMKALG+ R+ GEDL+CVG +CF+LAFIIITAVT  G LVS +L +RTR
Sbjct  499  AGHLYDKEAEKQMKALGRSRKIGEDLECVGAECFKLAFIIITAVTILGALVSIILVLRTR  558

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  559  NFYKNDIYKKFR  570



>ref|XP_009598854.1| PREDICTED: uncharacterized protein LOC104094596 [Nicotiana tomentosiformis]
Length=603

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GFLSEHFL+KYKFPRPL+LTI L ISC+GHLLIA
Sbjct  384  LGYPKTSISTFVSLVSIWNYLGRVVSGFLSEHFLSKYKFPRPLMLTITLIISCLGHLLIA  443

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+VRGGLY AS++IGFCFGAQWPLL+AIISELFGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  444  FDVRGGLYIASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYVLNVRV  503

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EAE+QMKALG+ R+ GEDL+C+G +CF+LAFIIITAVT  G LVS +L +RTR
Sbjct  504  AGHLYDKEAEKQMKALGRSRKIGEDLECIGAECFKLAFIIITAVTILGALVSIILVLRTR  563

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  564  NFYKNDIYKKFR  575



>ref|XP_009627853.1| PREDICTED: uncharacterized protein LOC104118334 [Nicotiana tomentosiformis]
Length=600

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSE+FL KYKFPRPL LTI L ISC+GH+LIA
Sbjct  382  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLIISCIGHILIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  442  FNVPGGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYLLNVRV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EAE+Q+ A+G+ R+ G+DL+C GV+CF+LAFIIITAVT FG  VS +L +RTR
Sbjct  502  AGHLYDKEAEKQLNAMGRTRQQGKDLNCDGVECFKLAFIIITAVTIFGAFVSIILVIRTR  561

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  562  KFYKSDIYKKFR  573



>emb|CDO99801.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   332 bits (852),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV +GF+SEHFLTKYKFPR L+LTIIL ISC GHLLIA
Sbjct  396  LGYPKRSISTFVSLVSIWNYLGRVVSGFVSEHFLTKYKFPRTLMLTIILVISCTGHLLIA  455

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  456  FGVSNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYLLNVRV  515

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREAERQ+ ALG  R+ GEDL+C GV+CF+L+FIIITAVT FG L+S +L  RTR
Sbjct  516  AGHLYDREAERQLNALGLKRKHGEDLNCDGVECFKLSFIIITAVTVFGALISLILVSRTR  575

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKFR
Sbjct  576  NFYKGDIYKKFR  587



>gb|EYU39645.1| hypothetical protein MIMGU_mgv1a0070051mg, partial [Erythranthe 
guttata]
Length=420

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSEHFL KYKFPRPL+LT+ L+ISC+GHLLIA
Sbjct  202  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEHFLKKYKFPRPLMLTLTLAISCIGHLLIA  261

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V  GLY ASV+IGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASP+G Y+LNVRV
Sbjct  262  FGVTNGLYFASVVIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPVGLYVLNVRV  321

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREAE+Q++A G++R  GE+LDC GV+CF+LAF IITAVT FG  VS +L +RTR
Sbjct  322  AGNLYDREAEKQLRAAGRVRIRGEELDCDGVECFRLAFFIITAVTVFGTFVSLLLVMRTR  381

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  382  KFYKSDIYKKFR  393



>ref|XP_006361693.1| PREDICTED: uncharacterized protein LOC102605820 [Solanum tuberosum]
Length=595

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSE+FL KYKFPRPL LTI L +SC+GH+LIA
Sbjct  384  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLVVSCIGHILIA  443

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  444  FNVPSGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYVLNVRV  503

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREAE+Q+K LG+ R  GEDL+C GV+CF+LAFIIIT VT FG  VS +L +RTR
Sbjct  504  AGYLYDREAEKQLKVLGRTRGDGEDLNCDGVECFKLAFIIITLVTIFGAFVSIILVIRTR  563

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  564  KFYKSDIYKKFR  575



>ref|XP_004250040.1| PREDICTED: uncharacterized protein LOC101265191 [Solanum lycopersicum]
Length=604

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSE+FL KYKFPRPL LTI L +SC+GH+LIA
Sbjct  392  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLIVSCIGHILIA  451

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  452  FNVPSGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYVLNVRV  511

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q+K L +IRR GEDL+C GV+CF+LAFIIIT VT FG  +S +L +RTR
Sbjct  512  AGYLYDKEAEKQLKILRRIRREGEDLNCDGVECFKLAFIIITLVTIFGAFISIILVIRTR  571

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  572  KFYKSDIYKKFR  583



>ref|XP_010534423.1| PREDICTED: uncharacterized protein LOC104809977 [Tarenaya hassleriana]
Length=593

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LTIIL ISC+GHLLIA
Sbjct  382  LGYPKRSISTFVSLVSIWNYFGRVTSGVVSEIFLIKYKFPRPLLLTIILFISCIGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  442  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGAYLLNVRV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EAE+QM+ALG  RR GEDL C G +CF+L+FIIITAVT FGVLVSAVL  RT+
Sbjct  502  AGHLYDKEAEKQMRALGLKRREGEDLTCNGTECFKLSFIIITAVTLFGVLVSAVLVARTK  561

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  562  KFYKSDIYKKFR  573



>ref|XP_004240185.2| PREDICTED: uncharacterized protein LOC101262315 [Solanum lycopersicum]
Length=566

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GFLSEHFLTKY+FPRPL+LTI L ISC+GHLLIA
Sbjct  353  LGYPKTSISTFVSLVSIWNYLGRVVSGFLSEHFLTKYRFPRPLMLTITLVISCLGHLLIA  412

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS++IGFCFGAQWPLL+AIISELFGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  413  FNVSGGLYVASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYLLNVRV  472

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA RQ+ A+GKIR+ GEDL+C+G +CF+LAF+IIT VT  G  VS +L +RTR
Sbjct  473  VGYLYDKEANRQIVAMGKIRKIGEDLECIGDECFKLAFLIITGVTILGAFVSIILVLRTR  532

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  533  KFYKNDIYKKFR  544



>ref|XP_011094505.1| PREDICTED: uncharacterized protein LOC105174183 [Sesamum indicum]
Length=610

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV AGFLSEHFL KYKFPRPL+LT+ L IS +GH+LIA
Sbjct  396  LGYPKKSISTFVSLVSIWNYLGRVVAGFLSEHFLKKYKFPRPLMLTLTLIISSIGHVLIA  455

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  456  FNVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVRV  515

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYDREAE+Q+ A G+ RR GE+LDC GV+CF+LAF+IITAVT FG +VS +L +RTR
Sbjct  516  TGHLYDREAEKQLLASGRSRRPGEELDCNGVECFKLAFVIITAVTVFGAIVSLLLVIRTR  575

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  576  KFYKSDIYKKFR  587



>gb|KJB73494.1| hypothetical protein B456_011G235000 [Gossypium raimondii]
Length=611

 Score =   327 bits (837),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV +GF+SE FLTKY+FPRPL+LT+I+ +SCVGHLLIA
Sbjct  389  LGYPKRSISTFVSLVSIWNYLGRVTSGFVSEIFLTKYRFPRPLMLTLIMLLSCVGHLLIA  448

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSYILNV+V
Sbjct  449  FNVPGGLYIASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYILNVKV  508

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA++QM ALG  R+AGEDLDC GV CF+L+FIIITA T FG +VS +LA+RTR
Sbjct  509  AGNLYDREAKKQMAALGIRRQAGEDLDCNGVDCFKLSFIIITAATLFGTVVSFILALRTR  568

Query  289  KFYKGDIYKKFR  254
            +FYK DIYKKFR
Sbjct  569  QFYKSDIYKKFR  580



>ref|XP_006345994.1| PREDICTED: uncharacterized protein LOC102592436 [Solanum tuberosum]
Length=582

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GFLSEHFLTKYKFPRPL+LTI L ISC+GHLLIA
Sbjct  369  LGYPKTSISTFVSLVSIWNYLGRVVSGFLSEHFLTKYKFPRPLMLTITLVISCLGHLLIA  428

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS++IGFCFGAQWPLL+AIISELFGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  429  FNVSGGLYVASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYLLNVRV  488

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA RQ+ A+GKIR+ GEDL+C G +CF+LAF+IIT VT  G  VS +L +RTR
Sbjct  489  VGYLYDKEANRQIMAMGKIRKIGEDLECNGDECFKLAFLIITGVTILGAFVSIILVLRTR  548

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  549  KFYKNDIYKKFR  560



>ref|XP_011084395.1| PREDICTED: uncharacterized protein LOC105166653 [Sesamum indicum]
Length=588

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTFVSLVSIWNYLGRV +GFLSEHFL KYKFPRP++LT+IL +SC+GHLLIA
Sbjct  372  LGYPTNSISTFVSLVSIWNYLGRVVSGFLSEHFLDKYKFPRPVMLTLILVMSCIGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
             +V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  432  LDVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSAASPIGSYLLNVRV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE Q++ALG+ R+ GEDL+CVGV+CF++AF+IIT VT FG  VS VL VRTR
Sbjct  492  AGYLYDKEAEEQLRALGRARKPGEDLNCVGVECFKMAFVIITFVTLFGAFVSLVLVVRTR  551

Query  289  KFYKGDIYKKFR  254
            +FYK DIYKKFR
Sbjct  552  EFYKSDIYKKFR  563



>gb|EPS72672.1| hypothetical protein M569_02085, partial [Genlisea aurea]
Length=548

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV +GFLSEHFL KYKFPRPL+LT+ L ISCVGHLLIA
Sbjct  355  LGYPKKSISTFVSLVSIWNYLGRVVSGFLSEHFLKKYKFPRPLMLTLTLLISCVGHLLIA  414

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN   GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIG YILNVRV
Sbjct  415  FNPPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGLYILNVRV  474

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA RQ+ A G+ R+ G++L+CVG +CF+LAFIII  VTAFG L+S +L  RTR
Sbjct  475  AGHLYDREANRQLIAAGQQRKHGQELNCVGTECFKLAFIIIAMVTAFGTLISILLVFRTR  534

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY+KFR
Sbjct  535  KFYRSDIYRKFR  546



>ref|XP_007010014.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY18824.1| Major facilitator superfamily protein [Theobroma cacao]
Length=624

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV AGF+SE FL KYKFPRPL+LT+I+  SCVGHLLIA
Sbjct  385  LGYPKRSISTFVSLVSIWNYLGRVTAGFVSEIFLAKYKFPRPLMLTLIMLFSCVGHLLIA  444

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSYILNV+V
Sbjct  445  FGVPGGLYIASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYILNVKV  504

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA++QM ALG  R+AGEDLDC GV+CF+L+FIII A T FG +V+ +LA+RTR
Sbjct  505  AGNLYDREAKKQMAALGLKRKAGEDLDCNGVECFKLSFIIIAAATLFGTVVAFLLALRTR  564

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  565  KFYKSDIYKKFR  576



>ref|XP_012080987.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP30493.1| hypothetical protein JCGZ_16172 [Jatropha curcas]
Length=599

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIW YLGRV AGF SEHFLTKYKFPRPL+LT+IL  SCVGHLLIA
Sbjct  382  LGYPKRSISTFVSLVSIWGYLGRVVAGFASEHFLTKYKFPRPLMLTLILLFSCVGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSY+LNV+V
Sbjct  442  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGMASPIGSYVLNVKV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA++Q+ A G  R+ G++L C+G++CF+L+FIIITAVT F  LVS +L +RTR
Sbjct  502  AGHLYDIEAKKQLAAKGLTRQHGQELSCIGIECFKLSFIIITAVTIFSTLVSLILVLRTR  561

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  562  KFYKSDIYKKFR  573



>ref|XP_010103517.1| putative transporter MCH1 [Morus notabilis]
 gb|EXB96177.1| putative transporter MCH1 [Morus notabilis]
Length=593

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK++ISTFVSLVSIWNYLGRV +GF+SE FL +YKFPRPL+LT+I+ +SCVGHLLIA
Sbjct  377  LGYPKRTISTFVSLVSIWNYLGRVFSGFVSEIFLKRYKFPRPLMLTLIMLLSCVGHLLIA  436

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V GGLYAAS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIG Y+LNVR+
Sbjct  437  FDVSGGLYAASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVRL  496

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA+RQM+  G +R+AGE L+C GVKCFQL+FIII AV  FG LVS +L VRTR
Sbjct  497  TGHLYDKEAKRQMEIKGLVRKAGEQLNCDGVKCFQLSFIIIAAVALFGSLVSLILVVRTR  556

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  557  KFYKSDIYKKFR  568



>gb|KFK36814.1| hypothetical protein AALP_AA4G174900 [Arabis alpina]
Length=591

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GY KKS+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT+IL  SC GHLLIAF
Sbjct  370  GYSKKSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLMLTMILLFSCAGHLLIAF  429

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            N+ GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRVA
Sbjct  430  NIPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVA  489

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD EAE+Q KALGK R  G+DLDC+G  CF+L+FIIITAVT FGVLVS +L +RTRK
Sbjct  490  GYLYDVEAEKQYKALGKTREEGKDLDCIGTACFKLSFIIITAVTLFGVLVSMILVIRTRK  549

Query  286  FYKGDIYKKFR  254
            FYK DIYKKFR
Sbjct  550  FYKSDIYKKFR  560



>ref|XP_006436518.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
 ref|XP_006485321.1| PREDICTED: uncharacterized protein LOC102627686 [Citrus sinensis]
 gb|ESR49758.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
Length=611

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV +GF+SE FL KYKFPRPL+LTIIL +SC+GHLLIA
Sbjct  397  LGYPKKSISTFVSLVSIWNYLGRVVSGFVSEIFLAKYKFPRPLMLTIILLLSCIGHLLIA  456

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS+IIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG +ASP+GSY+LNVRV
Sbjct  457  FNVPGGLYVASIIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGSASPLGSYLLNVRV  516

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA+RQM A G  R+ G DL C+GV+CF+L+FIIITA T FG  +S +L +RT+
Sbjct  517  AGHLYDKEAKRQMAASGITRKKGGDLTCIGVECFKLSFIIITAATLFGAFISLILVLRTK  576

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  577  KFYKSDIYKKFR  588



>ref|XP_002862889.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39148.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  328  LGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIA  387

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  388  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  447

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q KALGK R  G+DL+C+G  CF+L+FIIITAVT FGVLVS VL +RT+
Sbjct  448  AGYLYDVEAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSMVLVIRTK  507

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  508  KFYKSDIYKKFR  519



>ref|XP_002881636.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57895.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=576

 Score =   315 bits (808),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  348  LGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIA  407

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  408  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  467

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q KALGK R  G+DL+C+G  CF+L+FIIITAVT FGVLVS VL +RT+
Sbjct  468  AGYLYDVEAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSMVLVIRTK  527

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  528  KFYKSDIYKKFR  539



>emb|CDY07663.1| BnaA03g18480D [Brassica napus]
Length=579

 Score =   315 bits (808),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPLVLT+IL  SC GHLLIA
Sbjct  351  LGYPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLFSCAGHLLIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  411  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q  ALG  R  G+DL C G  CF+L+FIIITAVT FGVLVS +L +RTR
Sbjct  471  AGYLYDKEAEKQNNALGIQRSGGQDLSCTGTACFKLSFIIITAVTLFGVLVSMILVIRTR  530

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  531  KFYKSDIYKKFR  542



>ref|XP_010067353.1| PREDICTED: uncharacterized protein LOC104454252 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65467.1| hypothetical protein EUGRSUZ_G02877 [Eucalyptus grandis]
Length=604

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGFLSE  L +YKFPRPL+LT IL ISC GHLLIA
Sbjct  390  LGYQKQSTSTFVSLVSIWNYLGRVVAGFLSEILLKQYKFPRPLMLTFILLISCAGHLLIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASPIG Y+LNVRV
Sbjct  450  FNVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGTVASPIGGYLLNVRV  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM ALG +R+AGEDLDC GVKC+QLAF+IIT  T FG  VS +L VRTR
Sbjct  510  AGHLYDKEARKQMAALGLVRKAGEDLDCTGVKCYQLAFLIITFTTLFGTFVSFILVVRTR  569

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  570  KFYRSDIYKKFR  581



>ref|XP_009133348.1| PREDICTED: uncharacterized protein LOC103857852 [Brassica rapa]
Length=600

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPLVLT+IL  SC GHLLIA
Sbjct  372  LGYPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLFSCAGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  432  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q  ALG  R  G+DL C G  CF+L+FIIITAVT FGVLVS +L +RTR
Sbjct  492  AGYLYDKEAEKQNNALGIQRSGGQDLSCTGTACFKLSFIIITAVTLFGVLVSMILVIRTR  551

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  552  KFYKSDIYKKFR  563



>ref|XP_012080986.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X2 
[Jatropha curcas]
Length=573

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV AGF SEHFLTKYKFPRPL+ T+IL  SCVGHLLIA
Sbjct  343  LGYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLTKYKFPRPLMFTLILLCSCVGHLLIA  402

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            +NV GGLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNF   ASPIGS++LNVRV
Sbjct  403  YNVPGGLYVASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFAGMASPIGSFVLNVRV  462

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA++Q+ A G  R+ G++L C+G +CF+L+FIIITAVT F   VS +L +RTR
Sbjct  463  AGHLYDIEAKKQLAAKGLTRQHGQELSCIGTECFKLSFIIITAVTIFSTFVSLILVLRTR  522

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  523  KFYKSDIYKKFR  534



>ref|NP_181454.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAL31925.1|AF419593_1 At2g39210/T16B24.15 [Arabidopsis thaliana]
 gb|AAC28987.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09646.1| major facilitator protein [Arabidopsis thaliana]
Length=601

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  373  LGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIA  432

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  433  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  492

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q KALGK R  G+DL+C+G  CF+L+FIII AVT FGVLVS VL +RT+
Sbjct  493  AGYLYDVEAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIIAAVTLFGVLVSMVLVIRTK  552

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  553  KFYKSDIYKKFR  564



>ref|XP_012080985.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X1 
[Jatropha curcas]
 gb|KDP30492.1| hypothetical protein JCGZ_16171 [Jatropha curcas]
Length=605

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV AGF SEHFLTKYKFPRPL+ T+IL  SCVGHLLIA
Sbjct  375  LGYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLTKYKFPRPLMFTLILLCSCVGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            +NV GGLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNF   ASPIGS++LNVRV
Sbjct  435  YNVPGGLYVASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFAGMASPIGSFVLNVRV  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA++Q+ A G  R+ G++L C+G +CF+L+FIIITAVT F   VS +L +RTR
Sbjct  495  AGHLYDIEAKKQLAAKGLTRQHGQELSCIGTECFKLSFIIITAVTIFSTFVSLILVLRTR  554

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  555  KFYKSDIYKKFR  566



>ref|XP_010557206.1| PREDICTED: uncharacterized protein LOC104826258 [Tarenaya hassleriana]
Length=599

 Score =   313 bits (802),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNY GRV++G +SE FL KYKFPRPL+ TIIL +SC+GHLLIA
Sbjct  382  LGYPKRSISTFVSLVSIWNYFGRVSSGVVSEIFLIKYKFPRPLMFTIILLVSCIGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG  ASP+GSY+L+VRV
Sbjct  442  FNVPGGLYIASVIIGFCFGAQWPLIFAIISEIFGLKYYSTLYNFGGMASPVGSYLLSVRV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAERQM+ LG  R+ GEDL C G  CF+ +FIIITA T FGVLVSA+L VRT+
Sbjct  502  AGNLYDKEAERQMRELGLTRQEGEDLTCNGTACFKTSFIIITAATLFGVLVSALLVVRTK  561

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  562  KFYKSDIYKKFR  573



>emb|CDY44632.1| BnaC04g06300D [Brassica napus]
Length=577

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G LSE FL KYKFPRP++LT+IL  SC GHLLIA
Sbjct  351  LGYPKRSVSTFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSCTGHLLIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL NFGS ASPIG+Y+LNVRV
Sbjct  411  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGAYLLNVRV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q KALG +R+ G+DL C+G  CF+L+FIIIT VT FGVLVS +L VRT+
Sbjct  471  AGYLYDKEAEKQHKALGILRKEGQDLSCMGTACFKLSFIIITVVTLFGVLVSMILVVRTK  530

Query  289  KFYKGDIYKKFR  254
            KFYK DIYK+FR
Sbjct  531  KFYKSDIYKRFR  542



>ref|XP_003637404.1| Nitrate and chloride transporter [Medicago truncatula]
Length=596

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFLTKY+FPRPL+LT+ L +SCVGHLLIA
Sbjct  374  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTMTLFVSCVGHLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  434  FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q++ALGK R  G++L+CVGV C++L+FIIITA T FG +VS +L  RTR
Sbjct  494  AGHLYDKEAKKQLEALGKQRIEGQELNCVGVDCYKLSFIIITAATFFGAVVSLILVARTR  553

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  554  KFYKGDIYKRYR  565



>gb|KEH44269.1| MFS transporter [Medicago truncatula]
Length=596

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFLTKY+FPRPL+LT+ L +SCVGHLLIA
Sbjct  374  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTLTLFVSCVGHLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  434  FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q++ALGK R  G++L+CVGV C++L+FIIITA T FG +VS +L  RTR
Sbjct  494  AGHLYDKEAKKQLEALGKQRIEGQELNCVGVDCYKLSFIIITAATFFGAVVSLILVARTR  553

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  554  KFYKGDIYKRYR  565



>gb|KCW65304.1| hypothetical protein EUGRSUZ_G02762 [Eucalyptus grandis]
Length=425

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  178  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  237

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  238  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  297

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  298  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  357

Query  289  KFYKGDIYKKFR  254
            KFY+ D+YKKFR
Sbjct  358  KFYRSDLYKKFR  369



>ref|XP_002272074.2| PREDICTED: uncharacterized protein LOC100266758 [Vitis vinifera]
Length=599

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KS+STF+SLVSIWNYLGRV AGF SE  L KYKFPRPL+LT+IL +SCVGHLLIA
Sbjct  384  LGYPQKSLSTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLLSCVGHLLIA  443

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN++ GLY AS+IIGFCFGAQWPLLFA+ISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  444  FNIKNGLYFASIIIGFCFGAQWPLLFAVISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  503

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+E +RQM ALGK R+ GEDLDC GV+CF+L+FIIITA T FG LVS +L +RTR
Sbjct  504  AGYLYDKEGKRQMAALGKKRKRGEDLDCTGVECFKLSFIIITAATLFGSLVSLILVLRTR  563

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  564  KFYKGDIYKKFR  575



>ref|XP_010068849.1| PREDICTED: uncharacterized protein LOC104455823, partial [Eucalyptus 
grandis]
Length=439

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  211  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  270

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  271  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  330

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  331  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  390

Query  289  KFYKGDIYKKFR  254
            KFY+ D+YKKFR
Sbjct  391  KFYRSDLYKKFR  402



>ref|XP_010691115.1| PREDICTED: uncharacterized protein LOC104904540 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSISTFVSLVSIWNYLGRV AGF SEH L KYK PRPL LT +L +SC GHLLIA
Sbjct  376  LGYPPKSISTFVSLVSIWNYLGRVVAGFYSEHLLKKYKLPRPLFLTFMLLLSCAGHLLIA  435

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNVR GLY ASVIIGFCFGAQWPLLF IISE+FGLKYYSTLYNFGS ASPIG YILNVR+
Sbjct  436  FNVRNGLYVASVIIGFCFGAQWPLLFGIISEIFGLKYYSTLYNFGSVASPIGGYILNVRI  495

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA RQM ALG+ RR+GE+L+CVG +CF LAFIIITA T  G+ +S +L  RTR
Sbjct  496  TGHLYDKEATRQMLALGRSRRSGEELNCVGQECFHLAFIIITAATLVGMFISLILVFRTR  555

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY++FR
Sbjct  556  KFYQSDIYQRFR  567



>emb|CDX74863.1| BnaA05g06090D [Brassica napus]
Length=577

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G LSE FL KYKFPRP++LT+IL  SC GHLLIA
Sbjct  351  LGYPKRSVSTFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSCTGHLLIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL NFGS ASPIG+Y+LNVRV
Sbjct  411  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGAYLLNVRV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q KALG +R+ G+DL C+G  CF+L+FIIIT VT FGV VS +L VRT+
Sbjct  471  AGYLYDKEAEKQHKALGIVRKEGQDLSCMGTACFKLSFIIITLVTLFGVFVSMILVVRTK  530

Query  289  KFYKGDIYKKFR  254
            KFYK DIYK+FR
Sbjct  531  KFYKSDIYKRFR  542



>ref|XP_012080984.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP30491.1| hypothetical protein JCGZ_16170 [Jatropha curcas]
Length=608

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPK+SISTFVSLVSIWNYLGRV AGF SEHFL+KYKFPRPL+LT+IL  SCVGHLLIA
Sbjct  390  LEYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLSKYKFPRPLMLTLILLFSCVGHLLIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSY+L+VRV
Sbjct  450  FNVPGGLYVASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVASPIGSYVLSVRV  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA +Q+ A G  R+ G++L C+G +CF+L+FIIITAVT FG  VS +L +RTR
Sbjct  510  AGQLYDIEANKQLAAKGLKRQHGQELSCIGTECFKLSFIIITAVTLFGTFVSLILVLRTR  569

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  570  KFYKSDIYKKFR  581



>gb|KJB60522.1| hypothetical protein B456_009G310000 [Gossypium raimondii]
Length=620

 Score =   311 bits (798),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +SISTFVSLVSIWNYLGRV AGF+SE FL KYKFPRPL+LT+I+ +SCVGHLLI 
Sbjct  380  LGYPTRSISTFVSLVSIWNYLGRVVAGFVSEFFLMKYKFPRPLMLTLIMLVSCVGHLLIV  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V GG+Y ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+GSY+L+V++
Sbjct  440  FDVPGGVYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPVGSYLLSVKL  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G++YD EA +QMKALG  R  GEDLDC GV+CF+L+FIIITAVT FG  +S +LA RTR
Sbjct  500  TGNVYDNEARKQMKALGISRNDGEDLDCHGVECFRLSFIIITAVTVFGTFISFLLAYRTR  559

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKF 
Sbjct  560  KFYKGDIYKKFN  571



>ref|XP_009143336.1| PREDICTED: uncharacterized protein LOC103867059 [Brassica rapa]
Length=588

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G LSE FL KYKFPRP++LT+IL  SC GHLLIA
Sbjct  362  LGYPKRSVSTFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSCTGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL NFGS ASPIG+Y+LNVRV
Sbjct  422  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGAYLLNVRV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q KALG +R+ G+DL C+G  CF+L+FIIIT VT FGV VS +L VRT+
Sbjct  482  AGYLYDKEAEKQHKALGIVRKEGQDLSCMGTACFKLSFIIITLVTLFGVFVSMILVVRTK  541

Query  289  KFYKGDIYKKFR  254
            KFYK DIYK+FR
Sbjct  542  KFYKSDIYKRFR  553



>ref|XP_010691116.1| PREDICTED: uncharacterized protein LOC104904540 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSISTFVSLVSIWNYLGRV AGF SEH L KYK PRPL LT +L +SC GHLLIA
Sbjct  376  LGYPPKSISTFVSLVSIWNYLGRVVAGFYSEHLLKKYKLPRPLFLTFMLLLSCAGHLLIA  435

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNVR GLY ASVIIGFCFGAQWPLLF IISE+FGLKYYSTLYNFGS ASPIG YILNVR+
Sbjct  436  FNVRNGLYVASVIIGFCFGAQWPLLFGIISEIFGLKYYSTLYNFGSVASPIGGYILNVRI  495

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA RQM ALG+ RR+GE+L+CVG +CF LAFIIITA T  G+ +S +L  RTR
Sbjct  496  TGHLYDKEATRQMLALGRSRRSGEELNCVGQECFHLAFIIITAATLVGMFISLILVFRTR  555

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY++FR
Sbjct  556  KFYQSDIYQRFR  567



>gb|KEH44271.1| MFS transporter [Medicago truncatula]
Length=594

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFLTKY+FPRPL+LT+ L +SCVGHLLIA
Sbjct  374  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTLTLFVSCVGHLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  434  FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q++ALGK R  G +L+CVGV CF+L+FIIITA T FG +VS +L  RTR
Sbjct  494  TGHLYDKEAKKQLEALGKHRIEGHELNCVGVDCFKLSFIIITAATFFGAVVSLILVSRTR  553

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  554  KFYKGDIYKRYR  565



>ref|XP_010068847.1| PREDICTED: uncharacterized protein LOC104455819 [Eucalyptus grandis]
Length=619

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  391  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  450

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  451  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  510

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  511  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  570

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  571  KFYRSDIYKKFR  582



>gb|KCW65302.1| hypothetical protein EUGRSUZ_G02759 [Eucalyptus grandis]
Length=621

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  364  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  424  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  484  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  543

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  544  KFYRSDIYKKFR  555



>ref|XP_004497124.1| PREDICTED: uncharacterized protein LOC101508657 [Cicer arietinum]
Length=607

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF SEHFL KY+FPRPL+LT+ L +SCVGHLLIA
Sbjct  381  LRYPKKSISTFVSLVSIWNYLGRVFSGFASEHFLRKYRFPRPLMLTLTLFVSCVGHLLIA  440

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  441  FDVPDGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  500

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYDREA++Q+ A+GK+R  G++L+CVGV CF+L+FIIIT  T  G +VS VL  RTR
Sbjct  501  TGHLYDREAKKQLLAIGKVREQGQELNCVGVDCFKLSFIIITIATFLGAVVSLVLVARTR  560

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  561  KFYKGDIYKRYR  572



>gb|KEH44270.1| MFS transporter [Medicago truncatula]
Length=588

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFLTKY+FPRPL+L++ L +SCVGHLLIA
Sbjct  370  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLSLTLFVSCVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS  SPIG Y+LNV +
Sbjct  430  FDVPQGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSITSPIGLYVLNVAI  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EAE+Q++ALGK R  G++L+CVGV CF+L+FIII A T FG +V+ +L  RTR
Sbjct  490  TGHLYDKEAEKQLEALGKQRIEGQELNCVGVDCFKLSFIIIAAATFFGAVVNLILVARTR  549

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  550  KFYKGDIYKRYR  561



>gb|KCW65468.1| hypothetical protein EUGRSUZ_G02878, partial [Eucalyptus grandis]
Length=607

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  391  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  450

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  451  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  510

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  511  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  570

Query  289  KFYKGDIYKKFR  254
            KFY+ D+YKKFR
Sbjct  571  KFYRSDLYKKFR  582



>emb|CAN66928.1| hypothetical protein VITISV_011832 [Vitis vinifera]
Length=599

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KS+STF+SLVSIWNYLGRV AGF SE  L KYKFPRPL+LT+IL +SCVGHLLIA
Sbjct  384  LGYPQKSLSTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLLSCVGHLLIA  443

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN++ GLY AS+IIGFCFGAQWP+LFA+ISE+FGLKYYSTLYNFG+ ASPIGSY+L+VRV
Sbjct  444  FNIKNGLYFASIIIGFCFGAQWPILFAVISEIFGLKYYSTLYNFGAVASPIGSYLLSVRV  503

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+E +RQM ALG  R+AGEDLDC GV+CF+L+FIIITA T FG LVS +L +RTR
Sbjct  504  AGYLYDKEGKRQMAALGIERKAGEDLDCTGVECFKLSFIIITAATLFGSLVSLILVLRTR  563

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  564  KFYKGDIYKKFR  575



>ref|XP_010068870.1| PREDICTED: uncharacterized protein LOC104455846 [Eucalyptus grandis]
Length=619

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K+S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR LVLTIIL ISC GHLLIA
Sbjct  391  LGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLLIA  450

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  451  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  510

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG +R+ G+DL+C GVKC+QL+F+IIT  T FGV VS +L +RTR
Sbjct  511  AGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLRTR  570

Query  289  KFYKGDIYKKFR  254
            KFY+ D+YKKFR
Sbjct  571  KFYRSDLYKKFR  582



>ref|XP_002519465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42879.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV AGF SE  LTKYK PRPL+ T +L  SCVGHLLIA
Sbjct  386  LGYPTRSTTTFVSLVSIWNYLGRVVAGFASEILLTKYKIPRPLLFTFVLLFSCVGHLLIA  445

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSYILNVRV
Sbjct  446  FGVPNSLYIASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYILNVRV  505

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QMK LG  R AG+DL C GV+C++LAF+IITA T FG L+S +L +RTR
Sbjct  506  AGHLYDKEALKQMKDLGLTREAGQDLTCNGVQCYKLAFLIITAATVFGCLISVLLVLRTR  565

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  566  KFYQGDIYKKFR  577



>ref|XP_011094591.1| PREDICTED: uncharacterized protein LOC105174255 [Sesamum indicum]
Length=568

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSLVSIWNYLGRVAAGF SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  370  LGYPSKSITTFVSLVSIWNYLGRVAAGFASEIFLAKYKFPRPLMLTLVLLVSCTGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVI+GFCFGAQWPL+FAIISELFGLKYYSTLY  G  ASP+G+YILNVR+
Sbjct  430  FGVPNSLYAASVIMGFCFGAQWPLIFAIISELFGLKYYSTLYTLGGGASPLGAYILNVRI  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYDREA +Q+ A G +R+ GEDL CVG +C++LAF+IITA T  G  VS++L +RTR
Sbjct  490  TGHLYDREAMKQLAAKGLVRKEGEDLSCVGAQCYKLAFLIITATTLVGFFVSSILVIRTR  549

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  550  KFYKGDIYKKFR  561



>ref|XP_010243234.1| PREDICTED: uncharacterized protein LOC104587357 [Nelumbo nucifera]
Length=633

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S STF+SLVSIWNYLGRVA+GF SE FL KYKFPRPL+LT++L +SCVGHLLIA
Sbjct  393  LGYPSRSTSTFISLVSIWNYLGRVASGFASEIFLKKYKFPRPLMLTMVLLLSCVGHLLIA  452

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G LY ASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG  ASP+G YILNVRV
Sbjct  453  FGVPGSLYVASVIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNFGGAASPVGLYILNVRV  512

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA +QM   G  R AG++L C GV+C+QL+FIIIT VT  G  VS +L VRTR
Sbjct  513  AGHLYDREARKQMAGSGTTRTAGKELSCTGVQCYQLSFIIITTVTLLGAFVSLILVVRTR  572

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  573  KFYKSDIYKKFR  584



>gb|KGN52236.1| hypothetical protein Csa_5G622530 [Cucumis sativus]
Length=442

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  823  YPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAFN  644
            YPKKSISTFVSLVSIWNYLGRV AGFLSEH L KYKFPRPL+LTI+L +SC+ HLLIAFN
Sbjct  216  YPKKSISTFVSLVSIWNYLGRVMAGFLSEHLLIKYKFPRPLMLTIVLLLSCIAHLLIAFN  275

Query  643  VRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVAG  464
              GGLY AS++ G+C+GAQWPLLFAI+SE+FGLKYY+TLYNFGS ASP+G Y+LNV VAG
Sbjct  276  PSGGLYIASILTGYCYGAQWPLLFAIVSEIFGLKYYATLYNFGSVASPVGLYLLNVNVAG  335

Query  463  HLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRKF  284
            +LYD+EA++Q+   GKIR+ GE+L C G  CF+L+F+IITAV+ FG LVS VL +RT+KF
Sbjct  336  YLYDKEAKKQLSMAGKIRKTGEELVCNGTVCFKLSFVIITAVSLFGALVSLVLVLRTKKF  395

Query  283  YKGDIYKKFR  254
            YK DIYKKF+
Sbjct  396  YKSDIYKKFK  405



>emb|CDY24976.1| BnaC03g21960D [Brassica napus]
Length=579

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPLVLT+IL +SC GHLLIA
Sbjct  351  LGYPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLLSCAGHLLIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  411  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAE+Q  ALG  R  G+DL C G  CF+L+FIIITAVT FGVLVS +L +RTR
Sbjct  471  AGYLYDKEAEKQNNALGIQRSDGQDLSCTGTACFKLSFIIITAVTLFGVLVSMILVIRTR  530

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  531  KFYKSDIYKKFR  542



>ref|XP_010505589.1| PREDICTED: uncharacterized protein LOC104782373 [Camelina sativa]
Length=599

 Score =   303 bits (776),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  375  LGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTLVLLLSCAGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  435  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  494

Query  469  AGHLYDREAERQMKAL--GKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVR  296
            AG+LYD EA++Q KAL  G  RR GEDL+C+G  CF+L+FIIITAVT FGVLVS VL +R
Sbjct  495  AGYLYDVEAQKQNKALGIGNARRDGEDLNCIGTSCFKLSFIIITAVTFFGVLVSLVLVIR  554

Query  295  TRKFYKGDIYKKFR  254
            T+KFYK DIYKKFR
Sbjct  555  TKKFYKSDIYKKFR  568



>gb|KCW65466.1| hypothetical protein EUGRSUZ_G02876 [Eucalyptus grandis]
Length=571

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR L+LTIIL ISC GHLLIA
Sbjct  342  LGYATQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLMLTIILLISCAGHLLIA  401

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  402  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  461

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG  R+ G+DL+C GVKC+QL+F+IIT  T FG  VS +L VRTR
Sbjct  462  AGHLYDKEAKKQLAALGLARQPGQDLECTGVKCYQLSFLIITFATLFGAFVSFILVVRTR  521

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  522  KFYRSDIYKKFR  533



>ref|XP_010067354.1| PREDICTED: uncharacterized protein LOC104454252 isoform X3 [Eucalyptus 
grandis]
Length=604

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR L+LTIIL ISC GHLLIA
Sbjct  390  LGYATQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLMLTIILLISCAGHLLIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  450  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG  R+ G+DL+C GVKC+QL+F+IIT  T FG  VS +L VRTR
Sbjct  510  AGHLYDKEAKKQLAALGLARQPGQDLECTGVKCYQLSFLIITFATLFGAFVSFILVVRTR  569

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  570  KFYRSDIYKKFR  581



>ref|XP_007027453.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY07955.1| Major facilitator superfamily protein [Theobroma cacao]
Length=611

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +SI+TFVSLVSIWNYLGR  AGF SE+ LTKYK PRPL+ T ++  SCVGHLLIA
Sbjct  385  LGYPSRSITTFVSLVSIWNYLGRAVAGFFSEYLLTKYKIPRPLLFTSVILFSCVGHLLIA  444

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL++AIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  445  FAVPNSLYFASVIIGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVASPVGSYILNVRV  504

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QMKALG+ R+ GEDL C G +C+++AFIII A T FG LVS +L +RTR
Sbjct  505  AGHLYDKEALKQMKALGRTRKPGEDLTCTGGQCYRMAFIIIIATTLFGFLVSCILVLRTR  564

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  565  KFYKSDIYKKFR  576



>ref|XP_007142882.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
 gb|ESW14876.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
Length=596

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  374  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLVKYKFPRPLMLTLTLLVSCVGHLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  434  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYLLNVKM  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA++Q+ ALG  R+ G++L C+GV CF+L+FI+I A T FG +VS +L  RTR
Sbjct  494  TGYLYDKEAKKQLAALGLQRKEGQELKCIGVDCFRLSFIVIAAATFFGAIVSLILVARTR  553

Query  289  KFYKGDIYKKFR  254
            KFY  DIYK+FR
Sbjct  554  KFYSSDIYKRFR  565



>ref|XP_004497125.1| PREDICTED: uncharacterized protein LOC101508976 [Cicer arietinum]
Length=591

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GF+SEHFLTKY FPRPL+LT+ + +SCVGHLLIA
Sbjct  370  LGYPKTSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYNFPRPLMLTLTMFLSCVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASPIG Y+LNVRV
Sbjct  430  FDVPNGLYVASVIIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGVASPIGLYVLNVRV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+   G  R+ G +L+CVG  C++L+FIIITA T FG ++S +L  RT 
Sbjct  490  AGHLYDKEAKKQLLKSGVPRKYGHELNCVGASCYKLSFIIITATTLFGAIISLILVARTI  549

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  550  KFYKGDIYKRYR  561



>ref|XP_010067352.1| PREDICTED: uncharacterized protein LOC104454252 isoform X1 [Eucalyptus 
grandis]
Length=619

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +S STFVSLVSIWNYLGRV AGF+SE  LT+YKFPR L+LTIIL ISC GHLLIA
Sbjct  390  LGYATQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLMLTIILLISCAGHLLIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS+IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG Y+LNVRV
Sbjct  450  FDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRV  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA++Q+ ALG  R+ G+DL+C GVKC+QL+F+IIT  T FG  VS +L VRTR
Sbjct  510  AGHLYDKEAKKQLAALGLARQPGQDLECTGVKCYQLSFLIITFATLFGAFVSFILVVRTR  569

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  570  KFYRSDIYKKFR  581



>ref|XP_008366664.1| PREDICTED: uncharacterized protein LOC103430307 [Malus domestica]
Length=258

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT +L +SC GHLLIA
Sbjct  29   LGYPSDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLMLTFVLLLSCAGHLLIA  88

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL N G  ASPIG+Y+LNV+V
Sbjct  89   FGVPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYLLNVKV  148

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q+KALG+ R+ GEDL CVGV+C++LAFII+ AV  FG LVS +L +RTR
Sbjct  149  AGNLYDAEALKQLKALGRTRKXGEDLRCVGVQCYKLAFIIMAAVAFFGSLVSFILVIRTR  208

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  209  KFYKSDIYKKFR  220



>gb|KEH44272.1| MFS transporter [Medicago truncatula]
Length=595

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GF+SEH LTKYKFPRPL+ T+I+ +SCVGHLLIA
Sbjct  372  LGYPKTSISTFVSLVSIWNYLGRVFSGFVSEHVLTKYKFPRPLMFTLIMFLSCVGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V+ G+Y ASVIIGFCFGAQWPL+FAIISELFGLKYYSTL NFG  ASPIG Y LNVRV
Sbjct  432  FDVQNGIYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLMNFGGVASPIGLYFLNVRV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA+RQ+   G  R+ G++L+CVG  CF+L+FIIITA T FG ++S +L  RT 
Sbjct  492  AGHLYDKEAKRQLIEKGVKRKLGQELNCVGASCFRLSFIIITAATLFGAIISLILVARTN  551

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  552  KFYKGDIYKRYR  563



>ref|XP_010658347.1| PREDICTED: uncharacterized protein LOC100256418 isoform X1 [Vitis 
vinifera]
Length=587

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  S+STF+SL+SIWNYLGRV AGF+SE FLTKYKFPRPL+L ++  ++C GHLL+A
Sbjct  395  LGYPTDSLSTFISLMSIWNYLGRVVAGFVSEIFLTKYKFPRPLMLALVQLLACAGHLLMA  454

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV   LY A +IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  455  FNVHNALYLAWMIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  514

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAERQM A G  R+ GE+L C+G +CF+LAF+II  VT FG L S +L +RTR
Sbjct  515  AGYLYDKEAERQMAATGSHRKRGEELTCIGAECFKLAFLIIAGVTFFGTLASFILVLRTR  574

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  575  KFYRSDIYKKFR  586



>emb|CBI31406.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS++TF+SLVSIWNYLGRV AGF SE  L KYKFPRPL+LT+IL +SCVGHLLIA
Sbjct  343  LGYPHKSLNTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLLSCVGHLLIA  402

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN++ GLY AS+IIGFCFGAQWP+L+A+ISE+FGLKYYSTLYNFG+ ASPIGSY+ NV V
Sbjct  403  FNIKNGLYFASIIIGFCFGAQWPILYAVISEIFGLKYYSTLYNFGAVASPIGSYLFNVMV  462

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+E +RQM ALG  R+ GEDLDC GV+CF+L+FIIITA T FG LVS +L +RTR
Sbjct  463  AGYLYDKEGKRQMAALGIERKPGEDLDCTGVECFKLSFIIITAATLFGSLVSLILVLRTR  522

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  523  KFYKGDIYKKFR  534



>ref|XP_002267992.3| PREDICTED: uncharacterized protein LOC100256418 isoform X2 [Vitis 
vinifera]
Length=581

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  S+STF+SL+SIWNYLGRV AGF+SE FLTKYKFPRPL+L ++  ++C GHLL+A
Sbjct  389  LGYPTDSLSTFISLMSIWNYLGRVVAGFVSEIFLTKYKFPRPLMLALVQLLACAGHLLMA  448

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV   LY A +IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  449  FNVHNALYLAWMIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  508

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAERQM A G  R+ GE+L C+G +CF+LAF+II  VT FG L S +L +RTR
Sbjct  509  AGYLYDKEAERQMAATGSHRKRGEELTCIGAECFKLAFLIIAGVTFFGTLASFILVLRTR  568

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  569  KFYRSDIYKKFR  580



>ref|XP_004142503.1| PREDICTED: uncharacterized protein LOC101205503 [Cucumis sativus]
Length=596

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  823  YPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAFN  644
            YPKKSISTFVSLVSIWNYLGRV AGFLSEH L KYKFPRPL+LTI+L +SC+ HLLIAFN
Sbjct  370  YPKKSISTFVSLVSIWNYLGRVMAGFLSEHLLIKYKFPRPLMLTIVLLLSCIAHLLIAFN  429

Query  643  VRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVAG  464
              GGLY AS++ G+C+GAQWPLLFAI+SE+FGLKYY+TLYNFGS ASP+G Y+LNV VAG
Sbjct  430  PSGGLYIASILTGYCYGAQWPLLFAIVSEIFGLKYYATLYNFGSVASPVGLYLLNVNVAG  489

Query  463  HLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRKF  284
            +LYD+EA++Q+   GKIR+ GE+L C G  CF+L+F+IITAV+ FG LVS VL +RT+KF
Sbjct  490  YLYDKEAKKQLSMAGKIRKTGEELVCNGTVCFKLSFVIITAVSLFGALVSLVLVLRTKKF  549

Query  283  YKGDIYKKFR  254
            YK DIYKKF+
Sbjct  550  YKSDIYKKFK  559



>ref|XP_010509060.1| PREDICTED: uncharacterized protein LOC104785526 [Camelina sativa]
Length=596

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 2/193 (1%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV AG +SE FL KYKFPRPL+LT++L +SC GHLLIAF
Sbjct  373  GYPKRSVSTFVSLVSIWNYYGRVVAGVVSEIFLIKYKFPRPLMLTLVLLLSCAGHLLIAF  432

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYY+TLYNFGS ASPIGSY+LNVRVA
Sbjct  433  NVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGSYLLNVRVA  492

Query  466  GHLYDREAERQMKAL--GKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRT  293
            G+LYD EA +Q KAL  G  RR GEDL+C+G  CF+L+FIIITAVT FGVLVS VL +RT
Sbjct  493  GYLYDVEAHKQNKALGIGNERRDGEDLNCIGTSCFKLSFIIITAVTFFGVLVSLVLVIRT  552

Query  292  RKFYKGDIYKKFR  254
            +KFYK DIYKKFR
Sbjct  553  KKFYKSDIYKKFR  565



>ref|XP_008446818.1| PREDICTED: uncharacterized protein LOC103489434 [Cucumis melo]
Length=596

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  823  YPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAFN  644
            YPKKSISTFVSLVSIWNYLGRV AGFLSEH L KYKFPRPL+LTI+L +SC+ HLLIAFN
Sbjct  370  YPKKSISTFVSLVSIWNYLGRVMAGFLSEHLLVKYKFPRPLMLTIVLLLSCIAHLLIAFN  429

Query  643  VRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVAG  464
              GGLY AS++ GFC+GAQWPLLFAI+SE+FGLKYY+TLYNFGS ASP+G Y+LNV VAG
Sbjct  430  PSGGLYIASILTGFCYGAQWPLLFAIVSEIFGLKYYATLYNFGSVASPVGLYLLNVNVAG  489

Query  463  HLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRKF  284
            +LYD+EA++Q+   G+IR+ GE+L C G  CF+L+F+IITAV+ FG LVS VL +RT+KF
Sbjct  490  YLYDKEAKKQLAMAGRIRKTGEELVCNGTVCFKLSFVIITAVSLFGALVSLVLVLRTKKF  549

Query  283  YKGDIYKKFR  254
            YK DIYKKF+
Sbjct  550  YKSDIYKKFK  559



>ref|XP_010658344.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Vitis 
vinifera]
Length=599

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS++TF+SLVSIWNYLGRV AGF SE  L KYKFPRPL+LT+IL +SCVGHLLIA
Sbjct  384  LGYPHKSLNTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLLSCVGHLLIA  443

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN++ GLY AS+IIGFCFGAQWP+L+A+ISE+FGLKYYSTLYNFG+ ASPIGSY+ NV V
Sbjct  444  FNIKNGLYFASIIIGFCFGAQWPILYAVISEIFGLKYYSTLYNFGAVASPIGSYLFNVMV  503

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+E +RQM ALG  R+ GEDLDC GV+CF+L+FIIITA T FG LVS +L +RTR
Sbjct  504  AGYLYDKEGKRQMAALGIERKPGEDLDCTGVECFKLSFIIITAATLFGSLVSLILVLRTR  563

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  564  KFYKGDIYKKFR  575



>ref|XP_007142881.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
 gb|ESW14875.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
Length=636

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV +GF+SEHFL KY FPRPL+LT+ + +SCVGHLLIA
Sbjct  411  LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLHKYNFPRPLMLTLTMLLSCVGHLLIA  470

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV +
Sbjct  471  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPVGLYLLNVVM  530

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+ ALG  R+ G++L+CVGV CF+L+FIIITA T FG +VS VL  RTR
Sbjct  531  TGHLYDKEAKKQLAALGLERKEGQELNCVGVHCFKLSFIIITAATFFGAMVSVVLVGRTR  590

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK+FR
Sbjct  591  KFYKGDIYKRFR  602



>ref|XP_006293868.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
 gb|EOA26766.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
Length=597

 Score =   298 bits (762),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPR L+LT++L +SC GHLLIAF
Sbjct  376  GYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRTLMLTLVLLLSCAGHLLIAF  435

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRVA
Sbjct  436  NVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVA  495

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            GHLYD EA +Q  ALG  R  G+DL+C+G  CF+L+FIIITAVT FGVLVS VL +RT+K
Sbjct  496  GHLYDVEANKQYTALGTQRTEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSFVLVIRTKK  555

Query  286  FYKGDIYKKFR  254
            FYK DIYKKFR
Sbjct  556  FYKSDIYKKFR  566



>dbj|BAO45884.1| nitrate and chloride transporter [Acacia mangium]
Length=630

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV AGF+SE++L KYKFPR L+LT+ L +SC GHLLIA
Sbjct  381  LGYPKTSISTFVSLVSIWNYLGRVFAGFVSEYYLAKYKFPRTLMLTLTLLVSCAGHLLIA  440

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV+ GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG +ASPIG YILNVR+
Sbjct  441  FNVKDGLYVASVIIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGSASPIGLYILNVRI  500

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+ ALG  R  G++L+CVG +CF+L+FIIITA T FG L+S +L  RTR
Sbjct  501  TGHLYDKEAKKQLAALGLRRDPGKELNCVGTECFRLSFIIITAATFFGALISLILVARTR  560

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK+FR
Sbjct  561  KFYKGDIYKRFR  572



>ref|XP_004142499.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=581

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRVA+GF+SE  LTKYKFPRPL+  + L +SCVGHL+IA
Sbjct  365  LGYPKRSISTFVSLVSIWNYLGRVASGFISEIVLTKYKFPRPLIRALTLLLSCVGHLMIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS++IGFCFGAQWPL+FAIISELFGLKYYSTLYNFGS ASPIG Y LNV+V
Sbjct  425  FDVPNGLYVASIVIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYFLNVKV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+ Y+REAE+Q++A   IR+AGE+L C G +CF+L+FI+IT VT  G+LVS +L +RTR
Sbjct  485  AGNFYEREAEKQLEAKRIIRKAGEELKCFGGECFKLSFIVITGVTLLGMLVSLILVIRTR  544

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  545  SFYKSDIYKKFR  556



>ref|XP_010435975.1| PREDICTED: uncharacterized protein LOC104719709 [Camelina sativa]
Length=587

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC G+LLIAF
Sbjct  366  GYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGYLLIAF  425

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFC GAQWPLL AIISE+FGLKYY+TLYNFG+ A+PIGSY+L V VA
Sbjct  426  NVPGGLYVASVIIGFCCGAQWPLLLAIISEIFGLKYYATLYNFGAVATPIGSYLLKVWVA  485

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD EA++Q KALG   R GEDL+CVG  CF+L+FIIITA+T FGVLVS VL VRT+K
Sbjct  486  GYLYDVEADKQNKALGNTSRGGEDLNCVGTSCFKLSFIIITAITLFGVLVSMVLVVRTKK  545

Query  286  FYKGDIYKKFR  254
            FYK DI KKFR
Sbjct  546  FYKSDIKKKFR  556



>ref|XP_008446819.1| PREDICTED: uncharacterized protein LOC103489435 [Cucumis melo]
Length=582

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFV+LVSIWNYLGRVA+GF+SE  LTKYKFPRPL+L++ L +SCVGHL+IA
Sbjct  366  LGYPKRSISTFVTLVSIWNYLGRVASGFISEIVLTKYKFPRPLILSLTLLLSCVGHLIIA  425

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS++IGFCFGAQWPL+FAIISELFGLKYYSTLYNFGS ASPIG YILNV+V
Sbjct  426  FDVPNGLYVASIVIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYILNVKV  485

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+ YDREAE+Q+ A G IR+AGE+L C G +CF+L+FI+ITAVT  G+LVS VL +RTR
Sbjct  486  AGNFYDREAEKQLSAKGIIRKAGEELKCFGGECFKLSFIVITAVTLLGMLVSLVLVIRTR  545

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  546  SFYKSDIYKKFR  557



>ref|XP_010517258.1| PREDICTED: uncharacterized protein LOC104792736 [Camelina sativa]
Length=594

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 170/193 (88%), Gaps = 1/193 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV AG +SE FL KYKFPRPL+LT++L +SC GHLLIA
Sbjct  371  LGYPKRSVSTFVSLVSIWNYYGRVVAGVVSEIFLIKYKFPRPLMLTLVLLLSCAGHLLIA  430

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYY+TLYNFGS ASPIG+Y+L+VRV
Sbjct  431  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGTYLLSVRV  490

Query  469  AGHLYDREAERQMKALGKIRRA-GEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRT  293
            AG+LYD EA++Q KALGK  R  GEDL+C+G  C++L+FIIITAVT FGVLVS VL +RT
Sbjct  491  AGYLYDMEADKQYKALGKTPRTDGEDLNCIGTSCYKLSFIIITAVTFFGVLVSLVLVIRT  550

Query  292  RKFYKGDIYKKFR  254
            +KFY  DIYKKFR
Sbjct  551  KKFYNSDIYKKFR  563



>emb|CDX93282.1| BnaC04g46140D [Brassica napus]
Length=576

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KY+FPRPL+LT+IL +SC GHLLIA
Sbjct  359  LGYPKRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYRFPRPLMLTLILLLSCAGHLLIA  418

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  419  FNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  478

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EAE+Q  AL   R  G DL C G  CF+L+FIIITAVT FGVLVS +L +RTR
Sbjct  479  AGYLYDVEAEKQNNALKIPRIDGRDLTCTGTACFKLSFIIITAVTLFGVLVSMILVIRTR  538

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  539  KFYKSDIYKKFR  550



>gb|KHN02305.1| Putative transporter MCH1 [Glycine soja]
Length=554

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVA+G+ SE FLTKYK PRP +LT++L +SCVGH+LIA
Sbjct  350  LGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKIPRPYMLTLVLLVSCVGHVLIA  409

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  410  LGVPNSLYFASVIIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYILNVKV  469

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +Q+KA G  R  G+DL CVGV+C+++AFIIITA T  G L S +LA+RTR
Sbjct  470  AGVLYDKEALKQLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLVGCLASVILALRTR  529

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  530  KFYKGDIYRKFR  541



>ref|XP_011031645.1| PREDICTED: uncharacterized protein LOC105130706 [Populus euphratica]
Length=609

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV +GF SEH L KYKF RPL+ T+ L +SCVGHLLIA
Sbjct  393  LGYPKKSISTFVSLVSIWNYLGRVVSGFGSEHVLKKYKFSRPLLFTLTLLLSCVGHLLIA  452

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFG+ ASP+G Y+LNVR+
Sbjct  453  FNVSGGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGAVASPVGLYLLNVRL  512

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA +Q+ A G IR+ G+ LDCVG  CF+L+FIIITA T FG  VS +L  RTR
Sbjct  513  TGHLYDKEAGKQLAAKGLIRKHGDALDCVGTVCFRLSFIIITAATLFGAFVSLILVYRTR  572

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  573  KFYKSDIYKKFR  584



>ref|XP_002265621.3| PREDICTED: uncharacterized protein LOC100245195 [Vitis vinifera]
Length=326

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +S+STF+SL+SIWNYLGRV +GF+SE  LTKYK PRP++L++I  +SCVG+LL+A
Sbjct  109  LGYSTRSLSTFISLMSIWNYLGRVFSGFVSEIILTKYKVPRPVLLSLIQLLSCVGYLLMA  168

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN++  +Y A +I+GFC GAQWPLLFAIISE+FGLKYYSTL+NF S ASPIGSY+LNVRV
Sbjct  169  FNLKNSIYIAWIIVGFCLGAQWPLLFAIISEIFGLKYYSTLFNFSSVASPIGSYLLNVRV  228

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA RQM  LG  R+ GEDL+C GV+CF+LAFIIITAVT FG LVS VL +RTR
Sbjct  229  TGHLYDQEARRQMAVLGIQRKPGEDLNCSGVECFKLAFIIITAVTFFGSLVSFVLVLRTR  288

Query  289  KFYKGDIYKKFR  254
            +FYK DIY KFR
Sbjct  289  EFYKSDIYNKFR  300



>ref|XP_012082447.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP29179.1| hypothetical protein JCGZ_16568 [Jatropha curcas]
Length=618

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  S +TFVSLVSIWNYLGR  AGF SE  LTKYK PRPL+ T++L  SCVGHLLIA
Sbjct  370  LGYPSHSTTTFVSLVSIWNYLGRAVAGFASEFLLTKYKIPRPLLFTLVLLFSCVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+GSYILNVRV
Sbjct  430  FGVPNSLYFASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPVGSYILNVRV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +Q++ LG  R AG+ L C GV+C+++AF+IITA T FG ++S++L VRTR
Sbjct  490  AGHLYDKEALKQIEGLGLKREAGKYLTCSGVQCYKMAFLIITAATLFGCVISSILVVRTR  549

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  550  KFYQGDIYKKFR  561



>ref|XP_006428454.1| hypothetical protein CICLE_v10013568mg [Citrus clementina]
 gb|ESR41694.1| hypothetical protein CICLE_v10013568mg [Citrus clementina]
Length=597

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV AGF SE  L KYK PRPL+ T +L  SCVGHL IA
Sbjct  358  LGYPARSTTTFVSLVSIWNYLGRVVAGFASEILLKKYKIPRPLLFTFVLLFSCVGHLFIA  417

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            + +   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+G+YILNV+V
Sbjct  418  YGIPNSLYAASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPVGAYILNVKV  477

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA  QM+ALG  R+AG+DL C GV+C+++AFIIIT  T FG LVS +L +RT 
Sbjct  478  AGQLYDKEALNQMEALGITRQAGQDLTCNGVQCYKMAFIIITTATLFGCLVSVILVIRTN  537

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  538  KFYKGDIYKKFR  549



>gb|KHN11443.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV AGF+SEH+L KYKFPRPL+LT+ + +SCVGHLLIA
Sbjct  369  LRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCVGHLLIA  428

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFG KYY+TLYNFGS ASP+G Y+LNV +
Sbjct  429  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVVM  488

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+ ALG  R+ G++L+C+G+ CF+L+FIIITA T FGV+VS +L  RTR
Sbjct  489  TGHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTR  548

Query  289  KFYKGDIYKKFR  254
             FYKGDIYK++R
Sbjct  549  TFYKGDIYKRYR  560



>ref|XP_009141793.1| PREDICTED: uncharacterized protein LOC103865707 [Brassica rapa]
Length=588

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+S+STFVSLVSIWNY GRV +G +SE FL KY+FPRPL+LT+IL +SC GHLLIA
Sbjct  371  LGYPKRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYRFPRPLMLTLILLLSCAGHLLIA  430

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN  GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  431  FNAPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  490

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EAE+Q  AL   R  G DL C G  CF+L+FIIITAVT FGVLVS +L +RTR
Sbjct  491  AGYLYDVEAEKQNNALKIPRIDGRDLTCTGTACFKLSFIIITAVTLFGVLVSMILVIRTR  550

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  551  KFYKSDIYKKFR  562



>ref|XP_003554397.1| PREDICTED: uncharacterized protein LOC100818752 [Glycine max]
Length=581

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVA+G+ SE FLTKYK PRP +LT++L +SCVGH+LIA
Sbjct  377  LGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKIPRPYMLTLVLLVSCVGHVLIA  436

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  437  LGVPNSLYFASVIIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYILNVKV  496

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +Q+KA G  R  G+DL CVGV+C+++AFIIITA T  G L S +LA+RTR
Sbjct  497  AGVLYDKEALKQLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLVGCLASVILALRTR  556

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  557  KFYKGDIYRKFR  568



>ref|XP_003555225.2| PREDICTED: uncharacterized protein LOC100819121 [Glycine max]
Length=607

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV AGF+SEH+L KYKFPRPL+LT+ + +SCVGHLLIA
Sbjct  390  LRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCVGHLLIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFG KYY+TLYNFGS ASP+G Y+LNV +
Sbjct  450  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVVM  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+ ALG  R+ G++L+C+G+ CF+L+FIIITA T FGV+VS +L  RTR
Sbjct  510  TGHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTR  569

Query  289  KFYKGDIYKKFR  254
             FYKGDIYK++R
Sbjct  570  TFYKGDIYKRYR  581



>ref|XP_006379525.1| nodulin family protein [Populus trichocarpa]
 gb|ERP57322.1| nodulin family protein [Populus trichocarpa]
Length=609

 Score =   295 bits (756),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIWNYLGRV +GF SEH L KYKF RPL+ T+ L +SCVGHLLIA
Sbjct  393  LGYPKKSISTFVSLVSIWNYLGRVVSGFGSEHVLKKYKFSRPLLFTLTLLLSCVGHLLIA  452

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFG+ ASP+G Y+LNVR+
Sbjct  453  FNVSGGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGAAASPVGLYLLNVRL  512

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA +Q+ A G  R+ G+ LDCVG +CF+L+FIIITA T FG  VS +L  RTR
Sbjct  513  TGHLYDKEAGKQLAAKGLKRKHGDALDCVGTECFRLSFIIITAATLFGTFVSLILVHRTR  572

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  573  KFYKSDIYKKFR  584



>ref|XP_011094731.1| PREDICTED: uncharacterized protein LOC105174351 [Sesamum indicum]
Length=578

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSLVSIWNYLG+VAAGF SE FL KYKFPRPL+LT++L  SC GHLLIA
Sbjct  380  LGYPPKSITTFVSLVSIWNYLGKVAAGFASEIFLAKYKFPRPLMLTLVLLFSCTGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY ASVI GFCFGAQWPL+F IISE+FGLKYYSTLY+ G  ASP+G+YI NVR+
Sbjct  440  FGIPNSLYVASVITGFCFGAQWPLIFTIISEIFGLKYYSTLYSLGGGASPLGAYIFNVRI  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYDREA +QM A    R+ GEDL CVGV+C++LAF+IITA T  G  VS++L +RTR
Sbjct  500  TGHLYDREAMKQMAAKALNRKEGEDLSCVGVQCYKLAFLIITATTLIGCFVSSILVIRTR  559

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  560  KFYKGDIYKKFR  571



>ref|XP_010267223.1| PREDICTED: uncharacterized protein LOC104604543 [Nelumbo nucifera]
Length=636

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +SISTFVSLVSIWNYLGRV +GF SE FL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  398  LGYPSRSISTFVSLVSIWNYLGRVVSGFASEIFLKKYKFPRPLMLTMTLLLSCVGHLLIA  457

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G LY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASPIG YILNVRV
Sbjct  458  FGVPGSLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPIGLYILNVRV  517

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM A G+ R  G DL C GV C++L+FIIITAVT FG +VS VL  RTR
Sbjct  518  AGHLYDKEANKQMAAFGRTRAPGTDLSCTGVDCYKLSFIIITAVTLFGAVVSYVLVHRTR  577

Query  289  KFYKGDIYKKFR  254
             FY+ DIYKKFR
Sbjct  578  DFYRSDIYKKFR  589



>emb|CDP15282.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   293 bits (749),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT++L +SC GHLLIA
Sbjct  386  LGYPTKSISTFISLVSIWNYLGRVTSGFASEILLAKYKFPRPLMLTMVLLLSCAGHLLIA  445

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVI+GF FGAQWPL+FAIISELFGLKYYSTLYN G+ ASP+G+YILNVRV
Sbjct  446  FGVPNSLYVASVIMGFSFGAQWPLIFAIISELFGLKYYSTLYNLGAGASPVGAYILNVRV  505

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM A G IR+AGEDL C GV C++LAF+IITA T  G  +S +L  RTR
Sbjct  506  AGHLYDKEALKQMAAKGLIRKAGEDLTCNGVMCYKLAFLIITAATMCGCAISFILVFRTR  565

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKFR
Sbjct  566  NFYKGDIYKKFR  577



>ref|XP_006491715.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=609

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV AGF SE  L KYK PRPL+ T +L  SCVGH  IA
Sbjct  370  LGYPARSTTTFVSLVSIWNYLGRVVAGFASEILLKKYKIPRPLLFTFVLLFSCVGHPFIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            + +   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+G+YILNV+V
Sbjct  430  YGIPNSLYAASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPVGAYILNVKV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA  QM+ALG  R+AG+DL C GV+C+++AFIIIT  T FG LVS +L +RT 
Sbjct  490  AGQLYDKEALNQMEALGITRQAGQDLTCNGVQCYKMAFIIITTATLFGCLVSVILVIRTN  549

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  550  KFYKGDIYKKFR  561



>ref|XP_010450661.1| PREDICTED: uncharacterized protein LOC104732777 [Camelina sativa]
Length=588

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC G+LLIAF
Sbjct  367  GYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGYLLIAF  426

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFC GAQWPLL AIISE+FGLKYY+TLYNFG+ A+PIGSY+L V VA
Sbjct  427  NVPGGLYLASVIIGFCCGAQWPLLLAIISEIFGLKYYATLYNFGAVATPIGSYLLKVWVA  486

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD EA +Q KA G   R GEDL+C+G  CF+L+FIIITA+T FGVLVS VL VRT+K
Sbjct  487  GYLYDVEANKQNKASGNTSRDGEDLNCIGTSCFKLSFIIITAITLFGVLVSMVLVVRTKK  546

Query  286  FYKGDIYKKFR  254
            FYK DI KKFR
Sbjct  547  FYKSDIKKKFR  557



>ref|XP_008362281.1| PREDICTED: uncharacterized protein LOC103425934 [Malus domestica]
Length=598

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSLVSIWNYLGRV +GF SE  L +YKFPRPL+LT+ L +SCVGHLL+A
Sbjct  380  LGYPKQSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLLSCVGHLLVA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV+ GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS+ASP+G Y+LNVR+
Sbjct  440  FNVKNGLYLASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGLYLLNVRL  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GH+YD+EA++Q+ A G +R+AG++L CVG +CF+L+FIII A T FG  VS +L +RTR
Sbjct  500  TGHVYDKEAKKQLAAKGLVRQAGKELTCVGGECFKLSFIIIAAATLFGTFVSLILVMRTR  559

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  560  KFYQSDIYKKFR  571



>gb|KHN05589.1| Putative transporter MCH1 [Glycine soja]
Length=598

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV AGF+SEH+L KYKFPRPL+LT+ + +SC GHLLIA
Sbjct  375  LRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCAGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFG KYY+TLYNFGS ASP+G Y+LNV +
Sbjct  435  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVVM  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+ ALG  R+ G++L+C+G+ CF+L+FIIITA T FGV+VS +L  RTR
Sbjct  495  TGHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTR  554

Query  289  KFYKGDIYKKFR  254
             FYK DIYK++R
Sbjct  555  TFYKSDIYKRYR  566



>gb|KJB36485.1| hypothetical protein B456_006G161500 [Gossypium raimondii]
Length=607

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSLVSIWNYLGR  AGF SE+ LTKYK PRPL+ T ++ +SCVGH+LIA
Sbjct  383  LGYPSHSITTFVSLVSIWNYLGRAVAGFASEYLLTKYKIPRPLLFTFVILLSCVGHVLIA  442

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY AS+IIGFCFGAQWPL++AIISE+FGLKYYSTLYNFGS ASP+GSYILNV+V
Sbjct  443  FAVPNSLYFASIIIGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGSVASPVGSYILNVKV  502

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +Q+KALG+ R  GEDL C G +C++ AF+II A T FG LVS +L +RTR
Sbjct  503  AGHLYDQEALKQLKALGRTRNHGEDLTCNGGQCYRKAFLIIIATTLFGFLVSGILVIRTR  562

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  563  SFYKSDIYKKFR  574



>ref|XP_010098802.1| putative transporter MCH1 [Morus notabilis]
 gb|EXB75890.1| putative transporter MCH1 [Morus notabilis]
Length=462

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  S +TF+SLVSIWNYLGRVA+GF SE FLTKYKFPRPL+LT +L  SC+GHLLIA
Sbjct  128  LGYPSHSTTTFISLVSIWNYLGRVASGFASEIFLTKYKFPRPLMLTFVLLFSCIGHLLIA  187

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL+N G  ASP+G YILNV V
Sbjct  188  FAIPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLHNCGGLASPVGCYILNVLV  247

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA RQ++A G  R+ G+DL C GV C+++AFIIITA   FG  VSA+L VRTR
Sbjct  248  AGRLYDKEALRQLEAQGLTRKPGQDLTCKGVHCYRMAFIIITAAALFGSFVSAILVVRTR  307

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  308  KFYKGDIYKKFR  319



>ref|NP_001236811.1| nitrate and chloride transporter [Glycine max]
 gb|AAW51884.1| nitrate and chloride transporter [Glycine max]
Length=598

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKKSISTFVSLVSIWNYLGRV AGF+SEH+L KYKFPRPL+LT+ + +SC GHLLIA
Sbjct  375  LRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCAGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAASVIIGFCFGAQWPLLFAIISELFG KYY+TLYNFGS ASPIG Y+LNV +
Sbjct  435  FDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPIGLYVLNVVM  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA++Q+  LG  R+ G++L+C+G+ CF+L+FIIITA T FGV+VS +L  RTR
Sbjct  495  TGHLYDKEAKKQLAELGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTR  554

Query  289  KFYKGDIYKKFR  254
             FYK DIYK++R
Sbjct  555  TFYKSDIYKRYR  566



>emb|CBI30156.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GY   S +TFVSLVSIWNYLGRV +GF SE FLT+YKFPRPL+LT +L  SCVGHLLIAF
Sbjct  316  GYTAHSTTTFVSLVSIWNYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLIAF  375

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
             V   LY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG+ ASP+GSYILNV+VA
Sbjct  376  AVPNSLYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVKVA  435

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            GHLYD+EA +Q++A G  R AG+DL C G  C++L+FIIITA T FG ++S +L +RT+K
Sbjct  436  GHLYDKEALKQLEASGVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRTKK  495

Query  286  FYKGDIYKKFR  254
            FY+GDIYKKFR
Sbjct  496  FYQGDIYKKFR  506



>ref|XP_009417128.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSL+SIWNY GRV AGF SE FLTKYKFPRPL+LT IL +SCVGHLLIA
Sbjct  395  LGYPKRSISTFVSLISIWNYAGRVTAGFASEIFLTKYKFPRPLMLTAILLLSCVGHLLIA  454

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY ASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSYILNVRV
Sbjct  455  FGLTNSLYFASVVIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGAASPIGSYILNVRV  514

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +Q    G  R  G DL C+GV+CF+L+FIIITAVT  G LVS +L  RT+
Sbjct  515  AGYLYDKEALKQNN--GVRRPPGTDLTCIGVECFKLSFIIITAVTVLGALVSLLLVYRTK  572

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  573  DFYKGDIYAKFR  584



>ref|XP_002268663.2| PREDICTED: uncharacterized protein LOC100248651 [Vitis vinifera]
Length=638

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GY   S +TFVSLVSIWNYLGRV +GF SE FLT+YKFPRPL+LT +L  SCVGHLLIAF
Sbjct  383  GYTAHSTTTFVSLVSIWNYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLIAF  442

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
             V   LY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG+ ASP+GSYILNV+VA
Sbjct  443  AVPNSLYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVKVA  502

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            GHLYD+EA +Q++A G  R AG+DL C G  C++L+FIIITA T FG ++S +L +RT+K
Sbjct  503  GHLYDKEALKQLEASGVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRTKK  562

Query  286  FYKGDIYKKFR  254
            FY+GDIYKKFR
Sbjct  563  FYQGDIYKKFR  573



>ref|XP_006354409.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Solanum 
tuberosum]
Length=579

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KSI+TFVSLVSIWNYLGRV +GF+SE FL KYKFPRP++LT++L +SC GHLLIA
Sbjct  379  LGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLKKYKFPRPMMLTLVLLLSCSGHLLIA  438

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY AS+++GFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASP+G+Y+LNVRV
Sbjct  439  FGVPNSLYIASILMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGGASPVGAYLLNVRV  498

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+ A +QM A G  R+ G+DL C+GV+C++LAF+IIT  T     +S +L +RTR
Sbjct  499  TGHLYDKVATKQMLAKGLKRKIGQDLTCIGVECYKLAFLIITGATLLSCAISLILVIRTR  558

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  559  KFYKGDIYKKFR  570



>ref|XP_006411146.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
 gb|ESQ52599.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
Length=598

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT+IL +SC GHLLIAF
Sbjct  374  GYPKRSVSTFVSLVSIWNYFGRVVSGVISEIFLIKYKFPRPLMLTLILLLSCAGHLLIAF  433

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFCFGAQWPLLFAIISE+FGLKYY+TLYNFGS ASPIGSY+LNVRVA
Sbjct  434  NVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGSYLLNVRVA  493

Query  466  GHLYDREAERQMKALGKIRRAG-EDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            G+LYD EAE+Q  ALG  R+ G +DL C G  CF+L+FIIITAVT  GVLVS +L +RT+
Sbjct  494  GYLYDVEAEKQNNALGIDRKEGRQDLSCKGTVCFKLSFIIITAVTLLGVLVSTILVIRTK  553

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKK+R
Sbjct  554  KFYKSDIYKKYR  565



>ref|XP_010509061.1| PREDICTED: uncharacterized protein LOC104785527 [Camelina sativa]
Length=594

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 161/192 (84%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+ ISTFVSLVSIWNY GRV    +SE  L KYKFPRPL+LT++L +SC GHLLIA
Sbjct  374  LGYPKRGISTFVSLVSIWNYFGRV----VSEIILVKYKFPRPLMLTMVLLLSCAGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV GGLY ASVIIGFCFGAQWPL+FAIISE+FGLK+YSTLYNFGS ASP+GSY+LNVRV
Sbjct  430  FNVPGGLYVASVIIGFCFGAQWPLIFAIISEIFGLKHYSTLYNFGSVASPVGSYLLNVRV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA++Q K L   R+  +DL C+G  CF+L+FIIITAVT FGV VS +L +RT+
Sbjct  490  AGYLYDVEADKQNKTLRITRKGVQDLSCIGTSCFKLSFIIITAVTLFGVFVSTILVIRTK  549

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  550  TFYKSDIYKKFR  561



>ref|XP_008387534.1| PREDICTED: uncharacterized protein LOC103449994 [Malus domestica]
Length=612

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT +L +SC GHLLIA
Sbjct  383  LGYPSDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLMLTFVLLLSCAGHLLIA  442

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL N G  ASPIG+Y+LNV+V
Sbjct  443  FGVPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYLLNVKV  502

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q+KALG+ R+ GEDL CVGV+C++LAFII+ AV  FG LVS +L +RTR
Sbjct  503  AGNLYDAEALKQLKALGRTRKXGEDLRCVGVQCYKLAFIIMAAVAFFGSLVSFILVIRTR  562

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  563  KFYKSDIYKKFR  574



>ref|XP_007220549.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
 gb|EMJ21748.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
Length=595

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S STFVSLVSIWNYLGRV +GF SE  L +YKFPRPL+LT+ L +SCVGHLLIAF
Sbjct  382  GYPKRSASTFVSLVSIWNYLGRVMSGFGSEILLKRYKFPRPLMLTLTLLLSCVGHLLIAF  441

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV  GLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS+ASP+G Y+LNV++ 
Sbjct  442  NVPNGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGLYLLNVKLT  501

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD+EA++Q+ ALG  R+AGE+L+C G +CF+LAFI+I A T FG LVS +L +RTRK
Sbjct  502  GYLYDKEAKKQLAALGLERKAGEELNCAGGECFKLAFIVIAAATFFGTLVSLILVIRTRK  561

Query  286  FYKGDIYKKFR  254
            FYK DIYKKFR
Sbjct  562  FYKSDIYKKFR  572



>ref|XP_009765800.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
sylvestris]
Length=601

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KSI+TFVSLVSIWNYLGRV +GF+SE FLTKYK PRP++LT++L +SC GHLLIA
Sbjct  374  LGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLTKYKCPRPMMLTLVLLLSCAGHLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV++GFCFGAQWPL+FAIISELFGLKYYSTLYNFG+ ASP+G+Y+LNV+V
Sbjct  434  FGVPNSLYLASVLMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGAGASPVGAYLLNVKV  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+ A +QM A G  R+ GEDL C+GV+C++LAF++IT  T     VS +L +RTR
Sbjct  494  AGQLYDKVATKQMLAKGLKRKDGEDLTCIGVECYKLAFLVITGATLISCAVSLILVIRTR  553

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  554  KFYKGDIYKKFR  565



>gb|KHN18681.1| Putative transporter MCH1 [Glycine soja]
Length=573

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVA+G+ SE FLTKYK PRP +LT++L +SCVGH+LIA
Sbjct  365  LGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKVPRPYMLTLVLLLSCVGHVLIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY ASV+IGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  425  LGVPNSLYLASVVIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYILNVKV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA + +KA G  R+ G+DL CVGV+C+++AFIIITA T  G   S +LA+RTR
Sbjct  485  AGVLYDKEALKLLKAKGLTRQEGKDLTCVGVQCYKMAFIIITASTLVGCFASIILALRTR  544

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  545  KFYKGDIYRKFR  556



>ref|XP_008233256.1| PREDICTED: uncharacterized protein LOC103332309 [Prunus mume]
Length=600

 Score =   290 bits (741),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S STFVSLVSIWNYLGRV +GF SE  L +YKFPRPL+LT+ L +SCVGHLLIAF
Sbjct  382  GYPKRSASTFVSLVSIWNYLGRVMSGFGSEILLKRYKFPRPLMLTLTLLLSCVGHLLIAF  441

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV  GLY AS+IIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS+ASP+G Y+LNV++ 
Sbjct  442  NVPNGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGLYLLNVKLT  501

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            GHLYD+EA++Q+ A G +R+A E+L+C G +CF+LAFI+I A T FG LVS +L +RTRK
Sbjct  502  GHLYDKEAKKQLAASGLVRKAEEELNCAGGECFKLAFIVIAAATFFGTLVSLILVIRTRK  561

Query  286  FYKGDIYKKFR  254
            FYK DIYKKFR
Sbjct  562  FYKSDIYKKFR  572



>ref|XP_004307342.1| PREDICTED: uncharacterized protein LOC101306672 [Fragaria vesca 
subsp. vesca]
Length=597

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S  TFV LVSIWNYLGRV AGF+SE  L +YKFPRPL+LT+ L +SC GHLLIA
Sbjct  377  LGYPTRSRKTFVGLVSIWNYLGRVVAGFVSEFLLKRYKFPRPLILTLTLFVSCFGHLLIA  436

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV+ GLY ASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASP+G Y+LNV++
Sbjct  437  FNVKNGLYLASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSAASPVGLYLLNVKL  496

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GH+YD+EA +Q+ A G  R   E+L C+G +CF+L+FIIITA T FG LVS +L +RTR
Sbjct  497  TGHVYDKEAMKQLVAKGLERNKDEELTCLGGECFKLSFIIITAATFFGALVSLILVMRTR  556

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  557  KFYQSDIYKKFR  568



>ref|XP_006285261.1| hypothetical protein CARUB_v10006632mg, partial [Capsella rubella]
 gb|EOA18159.1| hypothetical protein CARUB_v10006632mg, partial [Capsella rubella]
Length=382

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYPK+S+STFVSLVSIWNY GRV +G +SE FL KYKFPRPL+LT++L +SC GHLLIAF
Sbjct  169  GYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIAF  228

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV GGLY ASVIIGFC GAQ PL+ AIISE+FGLKYY+TLYNFGS A+PIGSY+L V VA
Sbjct  229  NVPGGLYVASVIIGFCCGAQLPLILAIISEVFGLKYYATLYNFGSLATPIGSYLLKVWVA  288

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD EA +Q KALG     G+DL+C+G   F+L+FIIITA+T FG LVS VL +RT+K
Sbjct  289  GYLYDVEAAKQNKALGNTSTDGKDLNCIGTSNFKLSFIIITAITLFGALVSMVLVIRTKK  348

Query  286  FYKGDIYKKFR  254
            FYK DI K+FR
Sbjct  349  FYKSDIKKRFR  359



>ref|XP_010325963.1| PREDICTED: uncharacterized protein LOC101257997 [Solanum lycopersicum]
Length=615

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KSI+TFVSLVSIWNYLGRV +GF+SE FL KYKFPRP++LT++L +SC GHLLIA
Sbjct  415  LGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLKKYKFPRPMMLTLVLLLSCSGHLLIA  474

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY AS+++GFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASP+G+Y+LNVRV
Sbjct  475  FGVPNSLYIASILMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGGASPVGAYLLNVRV  534

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+ A++QM A G  R  G+DL C+GV+C+++AF+IIT  T     +S +L +RTR
Sbjct  535  TGHLYDKVAKKQMLAKGLKREIGQDLTCIGVECYKMAFLIITGATLLSCAISLILVIRTR  594

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  595  KFYKGDIYKKFR  606



>ref|XP_003521414.2| PREDICTED: uncharacterized protein LOC100797779 [Glycine max]
Length=616

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVA+G+ SE FLTKYK PRP +LT++L +SCVGH+LIA
Sbjct  408  LGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKVPRPYMLTLVLLLSCVGHVLIA  467

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY ASV+IGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  468  LGVPNSLYLASVVIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYILNVKV  527

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA + +KA G  R+ G+DL CVGV+C+++AFIIITA T  G   S +LA+RTR
Sbjct  528  AGVLYDKEALKLLKAKGLTRQEGKDLTCVGVQCYKMAFIIITASTLVGCFASIILALRTR  587

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  588  KFYKGDIYRKFR  599



>ref|XP_003553561.1| PREDICTED: uncharacterized protein LOC100798313 [Glycine max]
 gb|KHN02306.1| Putative transporter MCH1 [Glycine soja]
Length=571

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KSI+T VSL+SIWNYLGRV AG+ SE FLTKYK PRP +LT++L +SCVGH+LIA
Sbjct  359  LGYPRKSITTCVSLLSIWNYLGRVVAGYASEIFLTKYKLPRPYMLTLVLLLSCVGHILIA  418

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
                  LY ASVIIGFC GAQWPL+FAIISE+FGLKYYSTL+NFG+ ASP+GSYILNV+V
Sbjct  419  IGAPNSLYLASVIIGFCLGAQWPLMFAIISEIFGLKYYSTLFNFGAVASPVGSYILNVKV  478

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +Q+KA G  R  G+DL CVGV+C+++AFIIITA T F  +VS VL VRTR
Sbjct  479  AGVLYDKEALKQLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLFACIVSFVLVVRTR  538

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  539  KFYKGDIYRKFR  550



>emb|CDP15281.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSI+TFVSLVSIW+YLGRVA+GF SE  L KYKFPRPL+LT++L +SC GHLLIA
Sbjct  344  LGYPKKSIATFVSLVSIWSYLGRVASGFASEILLAKYKFPRPLMLTLVLLVSCAGHLLIA  403

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +S+I GFCFGAQWPL+FAIISELFGLKYYSTL N G+ ASP G+YILNV++
Sbjct  404  FGVPYSLYVSSLIAGFCFGAQWPLIFAIISELFGLKYYSTLINLGAGASPFGNYILNVQI  463

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGH YDREA +QM A    RRAGEDL C GV+C++L+F+IITA T FG +VS VL +RTR
Sbjct  464  AGHFYDREALKQMAAKEVTRRAGEDLTCDGVECYKLSFLIITATTLFGCVVSLVLYLRTR  523

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKF+
Sbjct  524  NFYKGDIYKKFK  535



>ref|XP_007162787.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
 gb|ESW34781.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
Length=573

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVAAG+ SE  L KYK PRP ++T++L +SCVGH+LIA
Sbjct  361  LGYPSKSTTTFVSLVSIWNYLGRVAAGYGSEVLLAKYKVPRPYMVTLVLLLSCVGHILIA  420

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              +   LY +SVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYN G  ASP+GSYILNV+V
Sbjct  421  LGIPNSLYLSSVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNLGGAASPVGSYILNVKV  480

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +Q+KA G +R AG+DL CVGV+C+++AFIIITA T  G L S +LA+RTR
Sbjct  481  AGILYDKEALKQLKAKGLMREAGKDLTCVGVQCYRMAFIIITASTLVGCLASFILALRTR  540

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  541  KFYKGDIYRKFR  552



>ref|XP_009413295.1| PREDICTED: uncharacterized protein LOC103994629 [Musa acuminata 
subsp. malaccensis]
Length=631

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SI+TFVSL+SIWNY GRVA+GF SE FLTKYKFPRPL+LT +L +SCVGHLLIA
Sbjct  389  LGYPKRSIATFVSLISIWNYAGRVASGFASEIFLTKYKFPRPLMLTAVLLLSCVGHLLIA  448

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSYILNVRV
Sbjct  449  FGVSNSLYFASVVIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVASPIGSYILNVRV  508

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA +Q    G     G DL C+GV+C++L+FIIITAVT  G LVS VL  RT+
Sbjct  509  AGYLYDREALKQNN--GVRGPNGTDLTCIGVECYKLSFIIITAVTVLGALVSLVLVWRTK  566

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  567  DFYKGDIYAKFR  578



>ref|XP_007142880.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
 gb|ESW14874.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
Length=586

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K SISTFVSLVSIWNY+GRV +GF+SEHFL KY FPRPL+LT+ L +SCVGHLLIA
Sbjct  367  LGYSKASISTFVSLVSIWNYMGRVFSGFVSEHFLQKYHFPRPLMLTLTLLLSCVGHLLIA  426

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY +SVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFG  ASPIG YILNVRV
Sbjct  427  FDVPNGLYLSSVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGGAASPIGLYILNVRV  486

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +Q+ A G  R  G++L+C G  CF+++FIIITA T FG ++S +L  RT 
Sbjct  487  AGHLYDKEALKQLAAAGISRNGGQELNCTGPSCFKMSFIIITAATVFGAMISLILVARTV  546

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  547  KFYKGDIYKRYR  558



>ref|XP_004142500.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=581

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFV+LVSIWNYLGRVA GFLSE  L KYK PR L+L++IL +SCVGHL+IA
Sbjct  365  LGYPKRSISTFVTLVSIWNYLGRVACGFLSEIVLRKYKCPRTLILSLILLLSCVGHLMIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS++IGFCFGAQWPL+FAIISELFGLKYYSTLYNFGS ASPIG Y+LNV+V
Sbjct  425  FDVPNGLYVASIVIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVKV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+ YDREAE+Q++A G IR+AGE+L C+G  CF+L+FI+IT VT  G+LVS +L +RTR
Sbjct  485  AGNFYDREAEKQLEAKGIIRKAGEELKCIGGACFKLSFIVITGVTLLGMLVSLILVIRTR  544

Query  289  KFYKGDIYKKFR  254
             FY+ DIYKKFR
Sbjct  545  SFYRSDIYKKFR  556



>ref|XP_009762916.1| PREDICTED: uncharacterized protein LOC104214891 [Nicotiana sylvestris]
Length=564

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L Y   SISTFVSLVSIWNYLGRVA+GF SE FL KY FPRPL+LT +L +SC GHLLIA
Sbjct  356  LNYQDSSISTFVSLVSIWNYLGRVASGFASEIFLRKYNFPRPLMLTFVLLLSCGGHLLIA  415

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F VR  LYA+S++IGFCFGAQWPL+ AIISELFGLKYY+TLYNFGS ASPIG YILNVRV
Sbjct  416  FGVRNSLYASSILIGFCFGAQWPLILAIISELFGLKYYATLYNFGSIASPIGGYILNVRV  475

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +Q+ A G  R+ GEDL+CVGV+C++ AF+IITA T  G +VS +L +RTR
Sbjct  476  AGYLYDKEALKQLTAKGIARKVGEDLNCVGVQCYKQAFLIITAATFAGSIVSLILVLRTR  535

Query  289  KFYKGDIYKKFR  254
            KFY  DIYKKF 
Sbjct  536  KFYASDIYKKFE  547



>ref|XP_010670396.1| PREDICTED: uncharacterized protein LOC104887465 [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLV+IW YLGRV  G +SEH L KYK+PRP  LTI+L +SC+ HLLIA
Sbjct  337  LGYPKKSISTFVSLVAIWQYLGRVVGGLISEHLLHKYKWPRPASLTIVLVLSCISHLLIA  396

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY ASVI+ FCFGA+W  L+AIISELFGLK+Y+TLYN+GS A+P+GSYI NVRV
Sbjct  397  FNVPYGLYVASVIMAFCFGAEWTYLYAIISELFGLKHYATLYNYGSLAAPLGSYIFNVRV  456

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDRE  RQ++ALG  R+ GE+L C+GVKC+QLA+III   T    LVS +L  RTR
Sbjct  457  AGHLYDREGIRQLQALGLTRKEGEELHCIGVKCYQLAYIIIAVATFVTALVSLILVARTR  516

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK+F+
Sbjct  517  KFYKGDIYKRFQ  528



>gb|KHN05591.1| hypothetical protein glysoja_035791 [Glycine soja]
Length=583

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNY+GRV +GF+SEHFL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  361  LGYPKASISTFVSLVSIWNYMGRVFSGFVSEHFLKKYKFPRPLMLTLTLLLSCVGHLLIA  420

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASPIG Y+LNVRV
Sbjct  421  FDVANGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRV  480

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+ A G  R+   +L CVG  CF+L+FIIITA T FG L+S +L  RT 
Sbjct  481  TGYLYDKEALKQLAATGISRKIDTELTCVGSSCFKLSFIIITAATFFGALISLILVARTI  540

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  541  KFYKGDIYKRYR  552



>ref|XP_003555226.2| PREDICTED: uncharacterized protein LOC100819661 [Glycine max]
Length=571

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKK+ STFVSLVSIWNYLGRV +GF+SE+FL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  357  LRYPKKTRSTFVSLVSIWNYLGRVFSGFVSEYFLQKYKFPRPLMLTLTLLLSCVGHLLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  417  FDVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPLGLYVLNVKM  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA++Q+ ALG  R  G++L+CVGV CF+L+FIIITA T FG +VS +L  RTR
Sbjct  477  TGYLYDKEAKKQLAALGLKRIEGQELNCVGVHCFKLSFIIITAATFFGAIVSLILVARTR  536

Query  289  KFYKGDIYKKFR  254
             FYK DIYK++R
Sbjct  537  TFYKSDIYKRYR  548



>gb|KEH24041.1| MFS transporter [Medicago truncatula]
Length=618

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TFVSLVSIWNYLGRVA+G++SE  LT+YK PRP +LT ++ +SCVGH+LIA
Sbjct  386  LGYPNKSTTTFVSLVSIWNYLGRVASGYISEILLTRYKIPRPYLLTFVMLLSCVGHILIA  445

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              +   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYI NVRV
Sbjct  446  LGISNSLYFASVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYIFNVRV  505

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +Q++A G  R+ G+DL CVGV+C+++AFIIITA T  G  +S +L +RTR
Sbjct  506  AGYLYDKEALKQLEAKGLRRQKGKDLTCVGVECYRMAFIIITASTLIGCFISFILVLRTR  565

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+K+R
Sbjct  566  KFYKGDIYEKYR  577



>ref|XP_004249478.1| PREDICTED: uncharacterized protein LOC101244136 [Solanum lycopersicum]
Length=581

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSL+SIWNYLGRV +GF+SE FL+KYKFPRPL+LTI+L +SC GHLLIA
Sbjct  369  LGYPSTSITTFVSLLSIWNYLGRVVSGFVSEIFLSKYKFPRPLMLTIVLLLSCTGHLLIA  428

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +S+I+GFCFGAQWPL+FAI+SE+FGLKYYSTLYN    ASP G+YILNVRV
Sbjct  429  FGVPNSLYISSIIMGFCFGAQWPLIFAIVSEIFGLKYYSTLYNLSGGASPFGAYILNVRV  488

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG  YD+ A RQMK  G IR  GEDL C+GV+C+++AF++IT  T    +VS VLA+RTR
Sbjct  489  AGQWYDKMALRQMKTNGLIRGVGEDLTCIGVECYKMAFLVITGATLISCVVSLVLAIRTR  548

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  549  EFYKGDIYKKFR  560



>ref|XP_011018791.1| PREDICTED: uncharacterized protein LOC105121728 [Populus euphratica]
Length=607

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +SI+TFVSLVSIWNYLGRV +GF SE  L KYK PRPL+L+I+L  +CVGH+LIA
Sbjct  387  LGYPSRSITTFVSLVSIWNYLGRVVSGFASEILLKKYKIPRPLLLSIVLLFTCVGHILIA  446

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F     LY ASVI+GFCFGAQWPL++AIISE+FGLKYYSTLYNFG+ ASP+GSYILNV +
Sbjct  447  FPSSNSLYFASVILGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVASPVGSYILNVVI  506

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +QMKALG  R+ GEDL C GV+C++++ IIITA T FG   S +L +RTR
Sbjct  507  AGDLYDKEALKQMKALGLKRKEGEDLTCNGVQCYRMSSIIITAATLFGSFASLILTLRTR  566

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  567  KFYKGDIYKKFR  578



>ref|XP_007144375.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
 gb|ESW16369.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
Length=588

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKS++TFVSLVSIWNYLGR ++GF SE  LTKYKFPRPL+LT+++ +SCVGH+LIA
Sbjct  366  LGYPKKSLTTFVSLVSIWNYLGRASSGFASEILLTKYKFPRPLMLTLVMLLSCVGHILIA  425

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY +SVIIGFCFGA WPL+FAIISE+FGLKYYSTLYN G+ ASP+GSYILNVR+
Sbjct  426  FGIPNSLYFSSVIIGFCFGAMWPLMFAIISEIFGLKYYSTLYNLGAVASPVGSYILNVRI  485

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+   G  R+ G+DL C+GV+CF+ AFIIITA T  G  VS +L +RTR
Sbjct  486  TGYLYDKEALKQLGMKGLTRQNGKDLTCLGVQCFKTAFIIITASTLVGCFVSFILVLRTR  545

Query  289  KFYKGDIYKKFR  254
            KFY+GDIY+KFR
Sbjct  546  KFYQGDIYEKFR  557



>ref|XP_003555885.1| PREDICTED: uncharacterized protein LOC100808975 [Glycine max]
Length=591

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GF+SEHFL KYKFPRPL+LT+ L +SC GHLLIA
Sbjct  367  LGYPKASISTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCAGHLLIA  426

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASPIG Y+LNVRV
Sbjct  427  FDVPNGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRV  486

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA +Q+   G  R   ++L C+G  CF+L+FIIITA T FG L+S +L  RT 
Sbjct  487  TGHLYDKEALKQLAVAGIPRNDAKELTCIGSSCFKLSFIIITAATFFGALISLILVARTI  546

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  547  KFYKGDIYKRYR  558



>ref|XP_003536696.1| PREDICTED: uncharacterized protein LOC100776865 [Glycine max]
 gb|KHN05588.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKK+ STFVSLVSIWNYLGRV +GF+SEHFL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  372  LRYPKKTRSTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCVGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  432  FDVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKM  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA++Q+ A G  R  G +L+CVGV CF+L+FIIITA T FG +VS +L  RTR
Sbjct  492  TGYLYDKEAKKQLAASGLTREEGHELNCVGVNCFKLSFIIITAATFFGAIVSLILVARTR  551

Query  289  KFYKGDIYKKFR  254
             FY+ DIYK++R
Sbjct  552  TFYRSDIYKRYR  563



>ref|XP_003590250.1| Nodule-specific protein Nlj70 [Medicago truncatula]
 gb|AES60501.1| MFS transporter [Medicago truncatula]
Length=597

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSL++IW YLG+V  G +SE  +TK K PRPL+LT IL  SC+GHLLIA
Sbjct  381  LGYPAHSITTFVSLMAIWIYLGKVTQGVISEFIITKLKLPRPLMLTSILIFSCLGHLLIA  440

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+IIGFCFGA WP+LF+IISELFGLKYYSTLYN GS ASPIGSY+L+VRV
Sbjct  441  FNVPNGLYVASIIIGFCFGANWPVLFSIISELFGLKYYSTLYNVGSIASPIGSYLLSVRV  500

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM ALG  R+ GE+L+C G +C++LAFIIITAV+  G LVS  L +RTR
Sbjct  501  AGHLYDKEALKQMAALGLKRKPGEELNCNGSECYKLAFIIITAVSLLGALVSLTLVIRTR  560

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  561  EFYKGDIYKKFR  572



>gb|KHN11444.1| hypothetical protein glysoja_015339 [Glycine soja]
Length=584

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GF+SEHFL KYKFPRPL+LT+ L +SC GHLLIA
Sbjct  360  LGYPKASISTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCAGHLLIA  419

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASPIG Y+LNVRV
Sbjct  420  FDVPNGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRV  479

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD+EA +Q+   G  R   ++L C+G  CF+L+FIIITA T FG L+S +L  RT 
Sbjct  480  TGHLYDKEALKQLAVAGIPRNDAKELTCIGSSCFKLSFIIITAATFFGALISLILVARTI  539

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  540  KFYKGDIYKRYR  551



>ref|XP_003535733.2| PREDICTED: uncharacterized protein LOC100787176 [Glycine max]
Length=622

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNY+GRV +GF+SEHFL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  400  LGYPKASISTFVSLVSIWNYMGRVFSGFVSEHFLKKYKFPRPLMLTLTLLLSCVGHLLIA  459

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG  ASPIG Y+LNVRV
Sbjct  460  FDVANGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRV  519

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+ A G  R+   +L CVG  CF+L+FIIITA T FG L+S +L  RT 
Sbjct  520  TGYLYDKEALKQLAATGISRKIDTELTCVGSSCFKLSFIIITAATFFGALISLILVARTI  579

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK++R
Sbjct  580  KFYKGDIYKRYR  591



>ref|XP_006381386.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
 gb|ERP59183.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
Length=610

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +SI+TFVSLVSIWNYLGRV +GF SE  L KYK PRPL+L+I+L  +C GH+LIA
Sbjct  390  LGYPSRSITTFVSLVSIWNYLGRVVSGFASEILLKKYKIPRPLLLSIVLLFTCAGHILIA  449

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F     LY ASVI+GFCFGAQWPL++AIISE+FGLKYYSTLYNFG+ ASP+GSYILNV +
Sbjct  450  FPSSNSLYFASVILGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVASPVGSYILNVVI  509

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+EA +QMKALG  R AGEDL C GV+C++++ IIITA T FG   S +L +RTR
Sbjct  510  AGDLYDKEASKQMKALGLKRNAGEDLTCNGVQCYRMSSIIITAATLFGSFASFILTLRTR  569

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  570  KFYKGDIYKKFR  581



>ref|XP_010691114.1| PREDICTED: uncharacterized protein LOC104904539 [Beta vulgaris 
subsp. vulgaris]
Length=585

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYP +SI+TFVSLVSIWNYLGRV AGF SEH L KYKFPRPL L++ L +SC GHLLIA 
Sbjct  364  GYPTRSINTFVSLVSIWNYLGRVVAGFYSEHLLKKYKFPRPLFLSLTLLLSCGGHLLIAI  423

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            N+  GLY A+VIIGFC+GAQWPLLF IISE++GLKYYSTL+NFG+ ASPIG YILNVR+ 
Sbjct  424  NLPNGLYVATVIIGFCYGAQWPLLFGIISEIYGLKYYSTLHNFGTLASPIGGYILNVRLT  483

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G LYDREA RQMKALG++R+ GE+L+C+G +CF+LAF+IIT  T   +L S +L VRTRK
Sbjct  484  GPLYDREATRQMKALGRVRQKGEELNCIGTECFRLAFLIITGATIISMLFSLILVVRTRK  543

Query  286  FYKGDIYKKFR  254
            FYK DIY+KFR
Sbjct  544  FYKSDIYRKFR  554



>ref|XP_011469615.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=583

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI  FVSL SIWNY G +AAG  SE F+TKYK+PRPL+ T IL +SCVGHLLIA
Sbjct  356  LGYPLKSIRNFVSLTSIWNYSGHIAAGIGSEIFITKYKWPRPLIFTAILLLSCVGHLLIA  415

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN+  G+Y ASV+ GFCFGA WPL++ IISELFGLKYYSTLYN G  ASPIG Y+LNVRV
Sbjct  416  FNIPYGVYVASVVTGFCFGAHWPLIYTIISELFGLKYYSTLYNIGGLASPIGLYVLNVRV  475

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD EA++QM ALG  R+ GE+L+CVG +CF+ +FIIIT VT  G LVS VL VRTR
Sbjct  476  TGHLYDVEAKKQMAALGIQRKVGEELNCVGGECFKWSFIIITVVTFVGTLVSLVLVVRTR  535

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  536  KFYKGDIYKKFR  547



>ref|XP_002519464.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42878.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGR  AGF SE  LTKYK PRPL+ TI+L  SC GHLLIA
Sbjct  382  LGYPARSTATFVSLVSIWNYLGRAVAGFASEILLTKYKIPRPLLFTIVLLFSCFGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQ PL+FAIISELFGLKYYSTLYNFG+ ASP+GSY+LNV V
Sbjct  442  FGVPNSLYFASVIIGFCFGAQLPLMFAIISELFGLKYYSTLYNFGAVASPVGSYVLNVIV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +Q+KA G    AG+DL C GV+C++L+F+IITAVT  G L+S VL +RTR
Sbjct  502  AGHLYDKEALKQLKAKGLRMEAGQDLICYGVQCYKLSFLIITAVTISGCLISLVLVLRTR  561

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  562  KFYKGDIYRKFR  573



>ref|XP_010673913.1| PREDICTED: uncharacterized protein LOC104890215 [Beta vulgaris 
subsp. vulgaris]
Length=598

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSLVSIWNYLGRV AGF SE  L KYKFPRP+ LTI+L  SC+G+LLIA
Sbjct  374  LGYPTHSITTFVSLVSIWNYLGRVCAGFGSEIVLAKYKFPRPMFLTIVLLFSCIGYLLIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFG+QWPL++AIISE+FGLKYY+TLYNFGS ASP+GSYI NV V
Sbjct  434  FAVPNSLYVASVIIGFCFGSQWPLIYAIISEIFGLKYYATLYNFGSIASPVGSYIFNVVV  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA RQ+ A G  R+ GEDL+CVG +C++++FIIIT  T FG LVS +L +RTR
Sbjct  494  TGKLYDREALRQLYAKGLKRKTGEDLNCVGAECYKVSFIIITGATLFGSLVSFILVLRTR  553

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKFR
Sbjct  554  NFYKGDIYKKFR  565



>gb|KHN11442.1| Putative transporter MCH1 [Glycine soja]
Length=582

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPKK+ STFVSLVSIWNYLGRV +GF+SE+FL KYKFPRPL+LT+ L +SCVGHLLIA
Sbjct  368  LRYPKKTRSTFVSLVSIWNYLGRVFSGFVSEYFLQKYKFPRPLMLTLTLLLSCVGHLLIA  427

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY ASVIIGFCFGAQWPLLFAIISELFGLKYY+TLYNFGS ASP+G Y+LNV++
Sbjct  428  FDVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPLGLYVLNVKM  487

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA++Q+ ALG  R  G++L+CVGV CF+L+FIIITA T FG +VS +L  RTR
Sbjct  488  TGYLYDKEAKKQLAALGLKRIEGQELNCVGVHCFKLSFIIITAATFFGAIVSLILVARTR  547

Query  289  KFYKGDIYKKFR  254
             FYK DIY+++R
Sbjct  548  TFYKSDIYQRYR  559



>ref|XP_009368999.1| PREDICTED: uncharacterized protein LOC103958461 [Pyrus x bretschneideri]
 ref|XP_009369009.1| PREDICTED: uncharacterized protein LOC103958473 [Pyrus x bretschneideri]
Length=598

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTFVSLVSIWNYLGRV +GF SE  L +YKFPRPL+LT+ L +SC GHLLIA
Sbjct  380  LGYPKHSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLLSCAGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
             NV+ GLY ASVIIGFC GA WPLLFAIISELFGLKYYSTL+NFG+ ASP+G Y+LNVR+
Sbjct  440  LNVKNGLYVASVIIGFCLGALWPLLFAIISELFGLKYYSTLFNFGACASPVGLYLLNVRL  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGH+YD+EA +Q+ A G +R AGE+L CVG +CF+L+FI+I AVT FG  VS +L +RTR
Sbjct  500  AGHIYDKEANKQLAAKGLVREAGEELTCVGGECFKLSFIVIAAVTLFGTFVSLILVMRTR  559

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  560  KFYQSDIYKKFR  571



>ref|NP_001051581.1| Os03g0800000 [Oryza sativa Japonica Group]
 dbj|BAF13495.1| Os03g0800000, partial [Oryza sativa Japonica Group]
Length=393

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV +GF SE FL +Y+FPRPL+LT +L ++CVGHLLIA
Sbjct  172  LGYPAKSIKTFISLISIWNYAGRVTSGFASEMFLARYRFPRPLMLTAVLLLACVGHLLIA  231

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+G+Y+LNVRV
Sbjct  232  FGVAQSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPVGAYVLNVRV  291

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ         AG D  C+GV+CF+ AF+IITA T  G L+S VL  RTR
Sbjct  292  AGYLYDVEAARQHGG----SLAGGDKTCLGVQCFRKAFLIITAATVAGALISLVLVWRTR  347

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  348  NFYKGDIYAKFR  359



>ref|XP_007027450.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY07952.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=550

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SIS F+SLVSIWN+LGRV AG+LSE  LTKY FPRPL+LT ++ +SCVGHLLIA
Sbjct  319  LGYPTHSISAFISLVSIWNFLGRVLAGYLSEIVLTKYNFPRPLMLTFVILLSCVGHLLIA  378

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+ GFC GAQ PLL AIISELFGLK+YST+YN GS +SP+GSYI NVRV
Sbjct  379  FAVPNSLYFASVMTGFCLGAQLPLLCAIISELFGLKHYSTMYNVGSVSSPVGSYIFNVRV  438

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +Q +ALG+ R+ G+DL+C G KC++LAF+IITA T FG +VS +L  RTR
Sbjct  439  AGHLYDKEAVKQTEALGRTRKPGQDLNCSGAKCYRLAFLIITAATLFGSIVSLILVFRTR  498

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKF+
Sbjct  499  TFYKGDIYKKFK  510



>ref|XP_009630642.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
tomentosiformis]
Length=608

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KSI+TFVSLVSIWNYLGRV +GF+SE FLTKYK PRPL+LT++L +SC GHLLIA
Sbjct  378  LGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLTKYKCPRPLMLTLVLLLSCAGHLLIA  437

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV++GFCFGAQWPL+FAIISELFGLKYYSTLYNFG+ ASP+G+Y+LNV+V
Sbjct  438  FGVPNSLYIASVLMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGAGASPVGAYLLNVKV  497

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+ A +QM A G  R+ GEDL C+GV+C++LAF+IIT  T     VS +L +RTR
Sbjct  498  AGHLYDKVATKQMLAKGLKRKDGEDLTCIGVECYKLAFLIITGATLISCAVSLILVIRTR  557

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  558  KFYKGDIYKKFR  569



>ref|XP_008241388.1| PREDICTED: uncharacterized protein LOC103339814 [Prunus mume]
Length=631

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT++L +SCVGHLLIA
Sbjct  380  LGYPTHSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLLLTLVLLLSCVGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL N G  ASPIG+Y+LNV+V
Sbjct  440  FGVPNSLYVASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYLLNVKV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q+KALGK+R+AGEDL C GV C++LAFII+ AV  FG LVS +L +RTR
Sbjct  500  AGNLYDAEALKQLKALGKVRKAGEDLTCEGVHCYRLAFIIMAAVALFGSLVSFILVIRTR  559

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  560  KFYRSDIYKKFR  571



>ref|XP_010933270.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Elaeis 
guineensis]
Length=626

 Score =   283 bits (724),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YP +SI TFVSL+SIWNY GRV AGF+SE  L KYKFPRPL LT +L +SCVGHLLIA
Sbjct  395  LEYPDRSIKTFVSLISIWNYAGRVTAGFVSEIILAKYKFPRPLALTFVLLLSCVGHLLIA  454

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSYILNVRV
Sbjct  455  FGVSQSLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVASPIGSYILNVRV  514

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA +Q   L   R  G+DL CVGV+CF+L+FIIITA T FG  VS +L  RTR
Sbjct  515  AGHLYDREANKQNSGL--TRTDGKDLTCVGVECFKLSFIIITAATVFGAFVSLILVWRTR  572

Query  289  KFYKGDI  269
             FYKGDI
Sbjct  573  NFYKGDI  579



>ref|XP_003590365.1| Nodule-specific protein Nlj70 [Medicago truncatula]
 gb|AES60616.1| MFS transporter [Medicago truncatula]
Length=587

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSL++IW YLG+VA G +SE  +TK K PRPL+LT IL++SC GHLLIA
Sbjct  372  LGYPSHSITTFVSLMAIWIYLGKVAQGVISEFIITKLKLPRPLILTSILTVSCFGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN+  GLY AS+IIGFCFGA  P+LF+IISELFGLKYYSTLYN G  ASPIGSY+L+VRV
Sbjct  432  FNIPNGLYVASIIIGFCFGANLPVLFSIISELFGLKYYSTLYNVGLIASPIGSYLLSVRV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM ALG +R+ GE+L+C G +C++LAFIIIT V+ FG LVS  L +RTR
Sbjct  492  AGHLYDKEAIKQMAALGLMRKPGEELNCNGSQCYKLAFIIITVVSLFGALVSLTLVIRTR  551

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKF+
Sbjct  552  EFYKGDIYKKFK  563



>ref|XP_009377045.1| PREDICTED: uncharacterized protein LOC103965696 [Pyrus x bretschneideri]
Length=611

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KY FPRPL+LT++L +SCVGHLLIA
Sbjct  379  LGYPSDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYMFPRPLMLTLVLLLSCVGHLLIA  438

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL N G  ASPIG+Y+LNV+V
Sbjct  439  FGVPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYLLNVKV  498

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q+KALG+ R+AGEDL CVGV+C++LAFII+ AV  FG L+S +L +RTR
Sbjct  499  AGNLYDAEAMKQLKALGRTRKAGEDLRCVGVQCYKLAFIIMAAVAFFGSLISFILVIRTR  558

Query  289  KFYKGDIYKKFR  254
            KFYK DIYKKFR
Sbjct  559  KFYKSDIYKKFR  570



>ref|XP_008456537.1| PREDICTED: uncharacterized protein LOC103496460 [Cucumis melo]
Length=600

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPK+SISTFVSLVSIWNYLGRV +GF SE FLTKYKFPR L+LT+IL +SCVGH+LIA
Sbjct  391  LQYPKRSISTFVSLVSIWNYLGRVVSGFTSEIFLTKYKFPRTLILTLILLLSCVGHILIA  450

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN  GGLY AS++IGFC+GAQWP+LFAIISE+FGLKYYSTLYNFGS ASPIG Y +NVRV
Sbjct  451  FNPPGGLYFASIVIGFCYGAQWPILFAIISEIFGLKYYSTLYNFGSVASPIGLYFVNVRV  510

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA+RQ+ A G  R  G++L+CVGV CF+++FIIIT VT  G L S VL +RTR
Sbjct  511  AGHLYDEEAKRQLAASGMKRIPGKELNCVGVNCFKMSFIIITGVTLLGALFSFVLVLRTR  570

Query  289  KFYKGDIYKKFR  254
             FYK DIY+KFR
Sbjct  571  AFYKTDIYRKFR  582



>gb|EYU29889.1| hypothetical protein MIMGU_mgv1a003835mg [Erythranthe guttata]
Length=561

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSLVSIWNYLGRV +GF SE FL KYKFPRPL+L+++L +SC GHLLIA
Sbjct  364  LGYPAKSITTFVSLVSIWNYLGRVTSGFASEIFLAKYKFPRPLMLSLVLLLSCSGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V+  LY ASVI+GFCFGAQWPL+FAIISE+FGLKYYSTLY  G  ASP+G+YILNVR+
Sbjct  424  FGVKDSLYVASVIMGFCFGAQWPLIFAIISEIFGLKYYSTLYTLGGGASPLGAYILNVRI  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA +Q+ A G +RR GEDL C GV+C+++AF+IITA T  G  VS+VL VRTR
Sbjct  484  AGYLYDREATKQLAAKGLVRRKGEDLSCSGVECYKVAFLIITAATLVGCAVSSVLVVRTR  543

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  544  KFYRGDIYKKFR  555



>ref|XP_004150375.2| PREDICTED: uncharacterized protein LOC101208506 [Cucumis sativus]
Length=590

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YPK+SISTFVSLVSIWNYLGRV +GF SE FL+KYKFPR L+LT+IL +SCVGH+LIA
Sbjct  374  LKYPKQSISTFVSLVSIWNYLGRVVSGFTSEIFLSKYKFPRTLILTLILLLSCVGHILIA  433

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FN  GGLY AS++IGFC+GAQWP+LFAIISE+FGLKYYSTLYNFGS ASPIG Y +NVRV
Sbjct  434  FNPPGGLYFASIVIGFCYGAQWPILFAIISEIFGLKYYSTLYNFGSVASPIGLYFVNVRV  493

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA+RQ+ A G  R  G++L+CVGV CF+++FIIIT VT  G L S VL +RTR
Sbjct  494  AGHLYDEEAKRQLAASGMKRMPGKELNCVGVDCFKMSFIIITGVTLLGALFSFVLVLRTR  553

Query  289  KFYKGDIYKKFR  254
             FYK DIY+KFR
Sbjct  554  AFYKTDIYRKFR  565



>ref|XP_011651970.1| PREDICTED: uncharacterized protein LOC101216551 [Cucumis sativus]
 gb|KGN58997.1| hypothetical protein Csa_3G742600 [Cucumis sativus]
Length=580

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   SI+TF+SLVSIWNYLGRV +GF+SE+F  KYK PRPL L   L +SCVGHLLIA
Sbjct  365  LGYQSHSITTFISLVSIWNYLGRVVSGFVSEYFWKKYKVPRPLFLFATLILSCVGHLLIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +S++IGFCFGAQWPL++AIISE+FGLKYY+TL +    ASPIG+YILNVRV
Sbjct  425  FGVPNSLYFSSIVIGFCFGAQWPLIYAIISEIFGLKYYATLSSMSGGASPIGAYILNVRV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA+RQM+A G+ R  GEDL C+GV+C++ AF+IITA T FG LVS +L VRT 
Sbjct  485  AGHLYDREAQRQMEATGRRRNIGEDLSCLGVECYRKAFLIITAATVFGALVSLILVVRTW  544

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY+KFR
Sbjct  545  KFYKGDIYRKFR  556



>gb|KHN39024.1| Putative transporter MCH1 [Glycine soja]
Length=555

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKS++TFVSLVSIWNYLGR ++GF+SE+ LTKYKFPRPL+LT+++ +SCVGH+LIA
Sbjct  329  LGYPKKSLTTFVSLVSIWNYLGRASSGFVSEYLLTKYKFPRPLLLTLVMLLSCVGHILIA  388

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY +SVIIGFCFGA WPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  389  FGIPNSLYFSSVIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVRV  448

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+   G IR+ G+DL CVGV+C+++AF+IITA T  G +VS +L +RTR
Sbjct  449  TGYLYDKEALKQLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTR  508

Query  289  KFYKGDIYKKFR  254
             FYKGDIY+KFR
Sbjct  509  NFYKGDIYEKFR  520



>ref|XP_003537006.1| PREDICTED: uncharacterized protein LOC100782396 [Glycine max]
Length=580

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKS++TFVSLVSIWNYLGR ++GF+SE+ LTKYKFPRPL+LT+++ +SCVGH+LIA
Sbjct  354  LGYPKKSLTTFVSLVSIWNYLGRASSGFVSEYLLTKYKFPRPLLLTLVMLLSCVGHILIA  413

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY +SVIIGFCFGA WPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  414  FGIPNSLYFSSVIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVRV  473

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+   G IR+ G+DL CVGV+C+++AF+IITA T  G +VS +L +RTR
Sbjct  474  TGYLYDKEALKQLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTR  533

Query  289  KFYKGDIYKKFR  254
             FYKGDIY+KFR
Sbjct  534  NFYKGDIYEKFR  545



>ref|XP_008379735.1| PREDICTED: uncharacterized protein LOC103442697 [Malus domestica]
Length=610

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K SISTFVSLVSIWNYLGRV +GF SE  L +YKFPRPL+LT+ L +SC GHLLIA
Sbjct  380  LGYHKHSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLLSCAGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV+ GLY ASVIIGFC GA WPLLFAIISELFGLKYYSTL+NFG+ ASP+G Y+LNVR+
Sbjct  440  FNVKNGLYVASVIIGFCLGALWPLLFAIISELFGLKYYSTLFNFGACASPVGLYLLNVRL  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGH+YD+EA +Q+ A G +R  GE+L CVG +CF+L+FI+I AVT FG  VS VL +RTR
Sbjct  500  AGHIYDKEANKQLAAKGLVREVGEELTCVGGECFKLSFIVIAAVTLFGTFVSLVLVMRTR  559

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  560  KFYQSDIYKKFR  571



>ref|XP_007204603.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
 gb|EMJ05802.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
Length=631

 Score =   281 bits (718),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT++L +SCVGHLLIA
Sbjct  380  LGYPTHSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLLLTLVLLLSCVGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPL+FAIISE+FGLKYY+TL N G  ASPIG+Y+LNV+V
Sbjct  440  FGVPNSLYVASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYLLNVKV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA +Q+KALGK+R+AGEDL C GV C++LAF I+ AV  FG LVS +L +RTR
Sbjct  500  AGNLYDAEALKQLKALGKVRKAGEDLTCEGVPCYRLAFCIMAAVALFGSLVSFILVIRTR  559

Query  289  KFYKGDIYKKFR  254
            KFY+ DIYKKFR
Sbjct  560  KFYRSDIYKKFR  571



>gb|EPS59101.1| hypothetical protein M569_15705, partial [Genlisea aurea]
Length=549

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSLVSIW YLGRV++GF SE  L+KY+FPRPL+LTI+L +SC GHLLIA
Sbjct  359  LGYPSKSITTFVSLVSIWGYLGRVSSGFASEILLSKYRFPRPLMLTIVLLLSCAGHLLIA  418

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LYAASVI+GFCFGAQWPL+F+IISELFGLKYYSTLY+ G  ASP+G+YI NV+V
Sbjct  419  FGIPNSLYAASVIVGFCFGAQWPLIFSIISELFGLKYYSTLYSIGGGASPLGAYIFNVKV  478

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYDREA RQM A G +R AGEDL C GV C+++AF II A +  G + S  L +RTR
Sbjct  479  TGYLYDREARRQMAAAGIVRAAGEDLSCAGVHCYRVAFFIIAATSFAGCVTSLALVLRTR  538

Query  289  KFYKGDIYKKF  257
            KFY GDIYKKF
Sbjct  539  KFYGGDIYKKF  549



>gb|AFK46076.1| unknown [Lotus japonicus]
Length=340

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  +I+TFVSL+SIW +LG++A G LSE  +TK K PRPL+ TI+  +SC+GHLLIA
Sbjct  133  LGYPSYTITTFVSLMSIWIFLGKIAQGVLSEFMITKLKLPRPLMFTIVHVLSCIGHLLIA  192

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLYAAS+ IGFC GA WP++ ++ISELFGLK+YSTLYN G+ ASPIGSY+LNV+V
Sbjct  193  FNVPNGLYAASIFIGFCLGASWPIINSLISELFGLKHYSTLYNVGTVASPIGSYLLNVKV  252

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA RQM ALG  R+ GE+L+C G  C++LA+IIITAV  FG LVS +L +RTR
Sbjct  253  AGYLYDREARRQMAALGLQRKPGEELNCSGSDCYKLAYIIITAVCLFGALVSFILVLRTR  312

Query  289  KFYKGDIYKKF  257
            +FYK DIYKKF
Sbjct  313  QFYKTDIYKKF  323



>ref|XP_007221112.1| hypothetical protein PRUPE_ppa017904mg [Prunus persica]
 gb|EMJ22311.1| hypothetical protein PRUPE_ppa017904mg [Prunus persica]
Length=562

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GYP +SI  FVSL SIWN+LG++ AG  SE F+ KYK+PRPL+ T +L +SCVGHLLIAF
Sbjct  366  GYPLRSIRNFVSLTSIWNFLGQIVAGIGSEMFIIKYKWPRPLIFTAVLLLSCVGHLLIAF  425

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
            NV  GLY +SV+ GFCFGA WPL+F +ISELFGLKYYSTLYNFG  ASPIG Y+LNVRV 
Sbjct  426  NVPYGLYVSSVVTGFCFGAHWPLIFTLISELFGLKYYSTLYNFGGLASPIGLYLLNVRVT  485

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            G+LYD+EA++QM ALG  R+ GE+L+CVG +CF+L+FII+  V  FG LVS +L VRTRK
Sbjct  486  GYLYDKEAKKQMAALGLQRKVGEELNCVGGQCFKLSFIILAVVALFGALVSLLLVVRTRK  545

Query  286  FYKGDIYKKFR  254
            FYK DIYKKFR
Sbjct  546  FYKSDIYKKFR  556



>ref|XP_007145510.1| hypothetical protein PHAVU_007G244600g [Phaseolus vulgaris]
 gb|ESW17504.1| hypothetical protein PHAVU_007G244600g [Phaseolus vulgaris]
Length=586

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   SI+TFVSL++IW Y+G++  G +SE  + K+K PRPL+ T IL + C+G+LLIA
Sbjct  370  LGYSSHSITTFVSLMAIWIYMGKIVQGVISEIIIAKFKVPRPLLFTSILVMPCIGYLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLYAASVIIGFCFGA WPLLF+IISELFGLK+YSTLYN GS ASPIGSY+ +VRV
Sbjct  430  FNVPNGLYAASVIIGFCFGANWPLLFSIISELFGLKFYSTLYNVGSVASPIGSYLFSVRV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA RQM ALG  R+ GE+L+C G +C++LAFIIITAV+ FG LVS +L +RTR
Sbjct  490  AGHLYDKEATRQMAALGLKRKPGEELNCNGRECYKLAFIIITAVSLFGALVSLILVLRTR  549

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  550  EFYKGDIYKKFR  561



>ref|XP_010050695.1| PREDICTED: uncharacterized protein LOC104439313 [Eucalyptus grandis]
 gb|KCW89358.1| hypothetical protein EUGRSUZ_A01654 [Eucalyptus grandis]
Length=629

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV +GF SE  LTKYK PRPL+LT++L +SCVGHLLIA
Sbjct  383  LGYPSRSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIA  442

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAAS+IIGFCFGAQWPL+FAIISE+FGLKYYSTLYN G+ ASP+GSYILNV+V
Sbjct  443  FGVPNSLYAASIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAGASPVGSYILNVKV  502

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYDREA RQM A G  R+ G+DL C GV+C++ AF++IT  T FG +VS  L +RTR
Sbjct  503  AGRLYDREAARQMAAAGLARKDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTR  562

Query  289  KFYKGDIYKKFR  254
            KFY+GDIY+KFR
Sbjct  563  KFYRGDIYRKFR  574



>ref|XP_006651692.1| PREDICTED: uncharacterized protein LOC102719372 [Oryza brachyantha]
Length=631

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SISTFVSLVSIWNY GRV AGF SE+ L +YK PRPL LT++L ++C GHLLIA
Sbjct  389  LGYPQRSISTFVSLVSIWNYAGRVVAGFASEYVLARYKVPRPLALTVVLVLACAGHLLIA  448

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYST+YNFG+ ASP+ SYILNVRV
Sbjct  449  LGVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTIYNFGAVASPVSSYILNVRV  508

Query  469  AGHLYDREAERQM-----KALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVL  305
             G LYDREAERQ+        G  R+ G DL CVGV CF+++F+II AVT  G  VS +L
Sbjct  509  TGRLYDREAERQLAAGAVAVAGAARKGGRDLTCVGVGCFRVSFLIIAAVTLLGAAVSLLL  568

Query  304  AVRTRKFYKGDIYKKFR  254
            A RTR FY+GD+Y KFR
Sbjct  569  AWRTRNFYRGDLYGKFR  585



>ref|XP_010050685.1| PREDICTED: uncharacterized protein LOC104439301 [Eucalyptus grandis]
 gb|KCW89357.1| hypothetical protein EUGRSUZ_A01653 [Eucalyptus grandis]
Length=629

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV +GF SE  LTKYK PRPL+LT++L +SCVGHLLIA
Sbjct  383  LGYPSRSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIA  442

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAAS+IIGFCFGAQWPL+FAIISE+FGLKYYSTLYN G+ ASP+GSYILNV+V
Sbjct  443  FGVPNSLYAASIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAGASPVGSYILNVKV  502

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYDREA RQM A G  R+ G+DL C GV+C++ AF++IT  T FG +VS  L +RTR
Sbjct  503  AGRLYDREAARQMAAAGLARKDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTR  562

Query  289  KFYKGDIYKKFR  254
            KFY+GDIY+KFR
Sbjct  563  KFYRGDIYRKFR  574



>gb|EAZ28933.1| hypothetical protein OsJ_12977 [Oryza sativa Japonica Group]
Length=591

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV +GF SE FL +Y+FPRPL+LT +L ++CVGHLLIA
Sbjct  370  LGYPAKSIKTFISLISIWNYAGRVTSGFASEMFLARYRFPRPLMLTAVLLLACVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+G+Y+LNVRV
Sbjct  430  FGVAQSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPVGAYVLNVRV  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ         AG D  C+GV+CF+ AF+IITA T  G L+S VL  RTR
Sbjct  490  AGYLYDVEAARQHGG----SLAGGDKTCLGVQCFRKAFLIITAATVAGALISLVLVWRTR  545

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  546  NFYKGDIYAKFR  557



>ref|XP_003541428.1| PREDICTED: uncharacterized protein LOC100814000 [Glycine max]
Length=588

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KS++TFVSLVSIWNYLGR ++GF SE+ LTKYKFPRPL+LT+++ +SCVGH+LIA
Sbjct  362  LGYPRKSLTTFVSLVSIWNYLGRASSGFASEYLLTKYKFPRPLLLTLVMLLSCVGHILIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY +SVIIGFCFGA WPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  422  FGIPNSLYFSSVIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+   G IR+ G+DL CVGV+C+++AF+IITA T  G +VS +L +RTR
Sbjct  482  TGYLYDKEALKQLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTR  541

Query  289  KFYKGDIYKKFR  254
             FYKGDIY+KFR
Sbjct  542  NFYKGDIYEKFR  553



>emb|CBI31408.3| unnamed protein product [Vitis vinifera]
Length=909

 Score =   283 bits (724),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  S+STF+SL+SIWNYLGRV AGF+SE FLTKYKFPRPL+L ++  ++C GHLL+A
Sbjct  338  LGYPTDSLSTFISLMSIWNYLGRVVAGFVSEIFLTKYKFPRPLMLALVQLLACAGHLLMA  397

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV   LY A +IIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIGSY+LNVRV
Sbjct  398  FNVHNALYLAWMIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRV  457

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EAERQM A G  R+ GE+L C+G +CF+LAF+II  VT FG L S +L +RTR
Sbjct  458  AGYLYDKEAERQMAATGSHRKRGEELTCIGAECFKLAFLIIAGVTFFGTLASFILVLRTR  517

Query  289  KFYKGDI  269
            KFY+ ++
Sbjct  518  KFYRKEM  524


 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  472  VAGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRT  293
            VAGHLYD+EA+RQM ALG  R+ GE+L+C GV+CF+LAFIIIT VT FG LVS +L +RT
Sbjct  821  VAGHLYDKEAKRQMAALGIQRKPGEELNCSGVECFKLAFIIITGVTIFGSLVSFMLVIRT  880

Query  292  RKFYKGDIYKKFR  254
            R+FY+ DIYKKFR
Sbjct  881  RRFYQTDIYKKFR  893



>gb|KCW65303.1| hypothetical protein EUGRSUZ_G02761, partial [Eucalyptus grandis]
Length=360

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S STF+SLVSIWNYLGRV AGFLSE  L +YKFPRPL+LT IL ISC GHLLIA
Sbjct  191  LGYPARSTSTFISLVSIWNYLGRVVAGFLSEILLKQYKFPRPLMLTFILLISCAGHLLIA  250

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
             NV  G+Y AS+II FCFGAQWPLLF IISE+FGLKYYSTLYNFG+  SPIG ++LNVRV
Sbjct  251  INVPNGIYFASIIISFCFGAQWPLLFTIISEIFGLKYYSTLYNFGTVVSPIGGHLLNVRV  310

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGV  323
            AGHLYD+EA +QM ALG +R+ GEDLDC GVKC+QLAF+IIT  T FG 
Sbjct  311  AGHLYDKEARKQMAALGLVRKPGEDLDCTGVKCYQLAFLIITFTTLFGT  359



>ref|XP_010050677.1| PREDICTED: uncharacterized protein LOC104439293 [Eucalyptus grandis]
 gb|KCW89356.1| hypothetical protein EUGRSUZ_A01652 [Eucalyptus grandis]
Length=627

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSLVSIWNYLGRV +GF SE  LTKYK PRPL+LT++L +SCVGHLLIA
Sbjct  382  LGYPSRSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYA+S+IIGFCFGAQWPL+FAIISE+FGLKYYSTLYN G+ ASP+GSY+LNV+V
Sbjct  442  FGVPNSLYASSIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAAASPVGSYVLNVKV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYDREA RQM A G  R  G+DL C GV+C++ AF++IT  T FG +VS  L +RTR
Sbjct  502  AGRLYDREAARQMAAAGLAREDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTR  561

Query  289  KFYKGDIYKKFR  254
            KFY+GDIY+KFR
Sbjct  562  KFYRGDIYRKFR  573



>gb|AAO37543.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 gb|ABF99380.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY92205.1| hypothetical protein OsI_13924 [Oryza sativa Indica Group]
Length=628

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV +GF SE FL +Y+FPRPL+LT +L ++CVGHLLIA
Sbjct  407  LGYPAKSIKTFISLISIWNYAGRVTSGFASEMFLARYRFPRPLMLTAVLLLACVGHLLIA  466

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+G+Y+LNVRV
Sbjct  467  FGVAQSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPVGAYVLNVRV  526

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ         AG D  C+GV+CF+ AF+IITA T  G L+S VL  RTR
Sbjct  527  AGYLYDVEAARQHGG----SLAGGDKTCLGVQCFRKAFLIITAATVAGALISLVLVWRTR  582

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  583  NFYKGDIYAKFR  594



>ref|XP_004304474.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=600

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTF+SLVSIWNYLGRV +GF SE  L KYKFPRPL+LT++L ++CVGHLLIA
Sbjct  372  LGYPTDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLMLTLVLLLACVGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +SVIIGFCFGAQWPL+FAIISELFGLKYY+TL NFG  ASP+G+YILNV+V
Sbjct  432  FGVPNSLYFSSVIIGFCFGAQWPLIFAIISELFGLKYYATLINFGGAASPLGAYILNVKV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD  A +Q+KALGK R AG DL C GV+C++LAFIII AV  FG LVS +L +RTR
Sbjct  492  AGNLYDAAALKQLKALGKTREAGMDLTCQGVECYRLAFIIIAAVALFGSLVSFILVIRTR  551

Query  289  KFYKGDIYKKF  257
            KFY+ DIYKK+
Sbjct  552  KFYQSDIYKKY  562



>gb|KHN48244.1| Putative transporter MCH1 [Glycine soja]
Length=572

 Score =   275 bits (702),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+KS++TFVSLVSIWNYLGR ++GF SE+ L KYKFPRPL+LT+++ +SCVGH+LIA
Sbjct  346  LGYPRKSLTTFVSLVSIWNYLGRASSGFASEYLLIKYKFPRPLLLTLVMLLSCVGHILIA  405

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F +   LY +SVIIGFCFGA WPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNV+V
Sbjct  406  FGIPNSLYFSSVIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVKV  465

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q+   G IR+ G+DL CVGV+C+++AF+IITA T  G +VS +L +RTR
Sbjct  466  TGYLYDKEALKQLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTR  525

Query  289  KFYKGDIYKKFR  254
             FYKGDIY+KFR
Sbjct  526  NFYKGDIYEKFR  537



>ref|XP_004494077.1| PREDICTED: uncharacterized protein LOC101506073 [Cicer arietinum]
Length=588

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KS +TF+SLVSIWNYLGRVAAG+ SE  L KYK PRP +LT ++ +SCVGH+LIA
Sbjct  372  LGYPSKSTTTFMSLVSIWNYLGRVAAGYSSEILLNKYKIPRPYLLTTVMLLSCVGHILIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              +   LY +SVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVR+
Sbjct  432  LGIPNSLYFSSVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVRL  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EA +Q++  G  R+ G+DL CVGV+C+++AFIIIT  T  G  VS +L +RT+
Sbjct  492  TGYLYDKEALKQLENNGLKRQEGKDLTCVGVECYKMAFIIITTSTLIGCFVSFILVLRTK  551

Query  289  KFYKGDIYKKFR  254
            +FYKGD+++K+R
Sbjct  552  EFYKGDVFRKYR  563



>ref|XP_006339087.1| PREDICTED: uncharacterized protein LOC102587756 [Solanum tuberosum]
Length=569

 Score =   274 bits (700),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SI+TFVSLVSIW YLGRV +GF SE FL KYKFPRPL+LTI+L  SC+ H+LIA
Sbjct  357  LGYPKTSITTFVSLVSIWGYLGRVGSGFASEIFLEKYKFPRPLMLTIVLFFSCLVHVLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              +   LY ASV+IG CFGA WPL+FAIISE+FGLK+YSTL NFG  ASPIG+YI NV+V
Sbjct  417  LGMPNTLYVASVLIGLCFGALWPLIFAIISEVFGLKHYSTLLNFGGAASPIGAYIFNVKV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA +QM A G IR+ GEDL C GV+C++LAF+II A T  G +VS VL +RT 
Sbjct  477  AGNLYDREAMKQMAAHGIIRKRGEDLTCTGVECYKLAFLIIAASTFVGFIVSLVLVIRTF  536

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  537  KFYKGDIYKKFR  548



>ref|XP_006339088.1| PREDICTED: uncharacterized protein LOC102588077 [Solanum tuberosum]
Length=567

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TFVSL+SIWNYLGRV +GF+SE FL+KYKFPRPL+LT++L +SC GHLLIA
Sbjct  355  LGYPSTSITTFVSLLSIWNYLGRVVSGFVSEIFLSKYKFPRPLMLTLVLLLSCTGHLLIA  414

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY AS+I GFCFGAQWPL+FAI+SELFGLKYYSTLYN    ASP G+YILNVRV
Sbjct  415  FGVPNSLYIASIITGFCFGAQWPLIFAIVSELFGLKYYSTLYNLSGGASPFGAYILNVRV  474

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD+ A RQM A G  R  GEDL C+GV+C+++AF++IT  T    +VS VLA+RTR
Sbjct  475  AGQLYDKMALRQMTAKGFTRGVGEDLTCIGVECYKVAFLVITGATLISCVVSLVLAIRTR  534

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  535  EFYKGDIYKKFR  546



>gb|KHN23223.1| hypothetical protein glysoja_047351 [Glycine soja]
Length=557

 Score =   273 bits (698),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   SI+TFVSL++IW Y+G++  G +SE  + K+K PRP++ T+IL + C G+LLIA
Sbjct  341  LGYSAHSITTFVSLMAIWIYMGKIVQGVVSEIIIAKFKVPRPMIFTLILVLPCAGYLLIA  400

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAAS+IIGFCFGA WPLLF IISELFGLK+YSTLYN GS ASPIGSY+ +VR+
Sbjct  401  FDVPNGLYAASIIIGFCFGANWPLLFTIISELFGLKFYSTLYNVGSVASPIGSYLFSVRL  460

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA RQM ALG  RR GE+L+C G +C+++AFIIITAV+ FG LVS +L +RTR
Sbjct  461  AGYLYDKEATRQMAALGLKRRPGEELNCNGSECYKMAFIIITAVSLFGALVSLILVLRTR  520

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  521  EFYKGDIYKKFR  532



>ref|XP_010677449.1| PREDICTED: uncharacterized protein LOC104893078 [Beta vulgaris 
subsp. vulgaris]
Length=598

 Score =   274 bits (701),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSISTFVSLVSIW +LGRV  G +SE  L KYKFPRP  LTI L +SC+ HLLIA
Sbjct  380  LGYPKKSISTFVSLVSIWQFLGRVMGGLISERLLDKYKFPRPACLTIALFVSCIAHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY ASVI+ FCFGA+W  LF+IISELFGLK+Y TLYN+GS A+P+GS+I NVRV
Sbjct  440  FNVPYGLYVASVIMAFCFGAEWTYLFSIISELFGLKHYGTLYNYGSLAAPLGSFIFNVRV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD E  RQ+KA G  R+ G++L C GVKC+QLA+ II A T F  LVS +L  RTR
Sbjct  500  AGHLYDMEGLRQLKASGLTRKHGDELHCYGVKCYQLAYFIIAAATFFTALVSLILVARTR  559

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYK+F+
Sbjct  560  KFYKGDIYKRFQ  571



>ref|XP_008794008.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Phoenix 
dactylifera]
Length=627

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK+SISTFVSL+SIWNY GRV AGF+SE    KYKFPRPL LT++L +SCVGHLLIA
Sbjct  396  LGYPKRSISTFVSLISIWNYAGRVTAGFVSEIVHAKYKFPRPLALTLVLLLSCVGHLLIA  455

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFG  ASPIGSYILNVR+
Sbjct  456  FGVSQSLYLASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVASPIGSYILNVRI  515

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYDRE ++Q   L  +R  G+DL C+GV+CF+L+FIIITA T  G LVS +L  RTR
Sbjct  516  TGHLYDRETDKQNNGL--VRPKGKDLTCIGVECFKLSFIIITAATVLGALVSLILVWRTR  573

Query  289  KFYKGDI  269
             FYKGDI
Sbjct  574  NFYKGDI  580



>ref|XP_003518996.1| PREDICTED: uncharacterized protein LOC100789645 [Glycine max]
Length=589

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   SI+TFVSL++IW Y+G++  G +SE  + K+K PRP++ T+IL + C G+LLIA
Sbjct  373  LGYSAHSITTFVSLMAIWIYMGKIVQGVVSEIIIAKFKVPRPMIFTLILVLPCAGYLLIA  432

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLYAAS+IIGFCFGA WPLLF IISELFGLK+YSTLYN GS ASPIGSY+ +VR+
Sbjct  433  FDVPNGLYAASIIIGFCFGANWPLLFTIISELFGLKFYSTLYNVGSVASPIGSYLFSVRL  492

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA RQM ALG  RR GE+L+C G +C+++AFIIITAV+ FG LVS +L +RTR
Sbjct  493  AGYLYDKEATRQMAALGLKRRPGEELNCNGSECYKMAFIIITAVSLFGALVSLILVLRTR  552

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  553  EFYKGDIYKKFR  564



>ref|XP_010510684.1| PREDICTED: uncharacterized protein LOC104786910 isoform X1 [Camelina 
sativa]
 ref|XP_010510685.1| PREDICTED: uncharacterized protein LOC104786910 isoform X2 [Camelina 
sativa]
 ref|XP_010510687.1| PREDICTED: uncharacterized protein LOC104786910 isoform X3 [Camelina 
sativa]
Length=572

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  364  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  424  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +CF+L F+I+ AVT FG LV+ VLA+RTR
Sbjct  484  TGMLYDREALKQLAAQGLTRKDVKDLTCLGSQCFKLPFVILAAVTFFGALVALVLAMRTR  543

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  544  EFYKGDIYKKFR  555



>gb|KJB36486.1| hypothetical protein B456_006G161600 [Gossypium raimondii]
Length=589

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SISTF+SLVSIWN+LGRV AG+LSE  LT Y FPRPL+LT+++  SC+GHLLIA
Sbjct  364  LGYPKHSISTFISLVSIWNFLGRVLAGYLSEIALTNYNFPRPLMLTLVILFSCIGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+ GFC GAQ PLL AIISELFGLK+YST+YN GS +SP+GSYI NVRV
Sbjct  424  FAVPNSLYFASVMTGFCLGAQLPLLCAIISELFGLKHYSTMYNVGSVSSPVGSYIFNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM+ALG  R+ G+DL C G  C++LAF+II+  T  G +VS +L  RTR
Sbjct  484  AGHLYDKEALKQMEALGLERKPGQDLTCNGATCYRLAFLIISVATLLGSIVSLILVCRTR  543

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKF+
Sbjct  544  TFYKGDIYKKFK  555



>ref|XP_010414589.1| PREDICTED: uncharacterized protein LOC104700725 isoform X1 [Camelina 
sativa]
 ref|XP_010414590.1| PREDICTED: uncharacterized protein LOC104700725 isoform X2 [Camelina 
sativa]
Length=572

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  364  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  424  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS VLA+RTR
Sbjct  484  TGMLYDREALKQLAAQGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLVLAMRTR  543

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  544  EFYKGDIYKKFR  555



>ref|XP_004249479.1| PREDICTED: uncharacterized protein LOC101244433 [Solanum lycopersicum]
Length=569

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SI+TFVSLVSIW YLGRV +GF SE FL KYKFPRPL+L I+L  SC+ H+LIA
Sbjct  357  LGYPKTSITTFVSLVSIWGYLGRVGSGFASEIFLEKYKFPRPLMLAIVLFFSCLVHVLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY ASV+IG CFGA WPL+FAIISE+FGLK+YSTL NFG  ASPIG+YI NV+V
Sbjct  417  LGVPNTLYVASVLIGLCFGALWPLIFAIISEIFGLKHYSTLLNFGGAASPIGAYIFNVKV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA +Q+ A G IR+ GEDL C GV+C++LAF+II A T  G +VS VL +RT 
Sbjct  477  AGNLYDREAMKQLAAHGIIRKRGEDLTCTGVECYKLAFLIIAASTFVGFIVSLVLVIRTF  536

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  537  KFYKGDIYKKFR  548



>gb|AAC39500.1| nodule-specific protein Nlj70 [Lotus japonicus]
Length=575

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  +I+TFVSL+SIW +LG++A G LSE  +TK K PRPL+ TI+  +SC+GHLLIA
Sbjct  368  LGYPSYTITTFVSLMSIWIFLGKIAQGVLSEFMITKLKLPRPLMFTIVHVLSCIGHLLIA  427

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLYAAS+ IGFC GA WP++ ++ISELFGLK+YSTLYN G+ ASPIGSY+LNV+V
Sbjct  428  FNVPNGLYAASIFIGFCLGASWPIINSLISELFGLKHYSTLYNVGTVASPIGSYLLNVKV  487

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYDREA RQM ALG  R+ GE+L+C G  C++LA+IIITAV  FG LVS +L +RTR
Sbjct  488  AGYLYDREARRQMAALGLQRKPGEELNCNGSDCYKLAYIIITAVCLFGALVSFILVLRTR  547

Query  289  KFYKGDIYKKF  257
            +FYK DIYKKF
Sbjct  548  QFYKTDIYKKF  558



>ref|XP_010470138.1| PREDICTED: uncharacterized protein LOC104750092 [Camelina sativa]
Length=570

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ + KYK PRPL++T++L +SC GHLLIA
Sbjct  362  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLVAKYKLPRPLMMTLVLLLSCAGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  422  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS VLA+RTR
Sbjct  482  TGMLYDREALKQLAAQGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLVLAMRTR  541

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  542  EFYKGDIYKKFR  553



>ref|XP_010098800.1| hypothetical protein L484_022565 [Morus notabilis]
 gb|EXB75888.1| hypothetical protein L484_022565 [Morus notabilis]
Length=621

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SI+TF+SLVSIWN+LGRV AGF SE  L KY FPRP +LT ++ +SCVGHLLIA
Sbjct  382  LGYPGHSITTFISLVSIWNFLGRVTAGFASEILLAKYMFPRPSMLTAVILLSCVGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY AS+I GFC+GAQ  LLF IISELFGLKYYSTLYN G+ +SP+GSYI NV+V
Sbjct  442  FGVPHSLYFASIITGFCYGAQLSLLFVIISELFGLKYYSTLYNVGALSSPLGSYIFNVKV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD+EA +QM+ALG +R+AG++L C G +C+++AF++IT  T FG LVS +L +RTR
Sbjct  502  AGHLYDKEARKQMEALGLVRKAGQELTCNGGRCYKMAFLVITVATLFGCLVSFILVLRTR  561

Query  289  KFYKGDIYKKFR  254
            +FYK DIYKKFR
Sbjct  562  RFYKSDIYKKFR  573



>emb|CDY30506.1| BnaA04g16270D [Brassica napus]
Length=566

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T +L +SC GHLLIA
Sbjct  357  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTFVLLLSCAGHLLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  417  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+KA G  R+  +DL C+G +C++L F+I+ +VT FG LVS  LA+RTR
Sbjct  477  TGMLYDREALKQLKARGLTRKDVKDLTCLGSQCYKLPFVILASVTFFGALVSLGLAIRTR  536

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  537  KFYKGDIYKKFR  548



>tpg|DAA51974.1| TPA: hypothetical protein ZEAMMB73_438867 [Zea mays]
Length=403

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AGF SE FL +YKFPRPL+LT++L +SCVGHLLIA
Sbjct  189  LGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLTLVLLLSCVGHLLIA  248

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  249  FGVPQSLYVASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYVLNVRV  308

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA +Q    G     G D  C+GV+CF+ AF+IITA T  G LVS VL  RTR
Sbjct  309  AGALYDVEAAKQH---GGSLAGGADKTCIGVQCFRKAFLIITAATVAGALVSLVLVWRTR  365

Query  289  KFYKGDIYKKFR  254
             FY+GDIY KFR
Sbjct  366  NFYRGDIYAKFR  377



>ref|XP_009606524.1| PREDICTED: uncharacterized protein LOC104100872 [Nicotiana tomentosiformis]
Length=568

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPK SI+TFVSLVSIW YLGRVA+GF SE FL KYKFPRPL+LT++L +SCVGH+LIA
Sbjct  357  LGYPKTSITTFVSLVSIWGYLGRVASGFASEIFLEKYKFPRPLMLTLVLLLSCVGHVLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+ GFCFGA WPL+FAIISELFGLK+YSTL NFG  ASPIG+YI NV+V
Sbjct  417  FGVTNTLYVASVLTGFCFGALWPLIFAIISELFGLKHYSTLLNFGGAASPIGAYIFNVKV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +QM A G IR+ GEDL C GV C++LAF II A T  G +VS VL +RT 
Sbjct  477  AGNLYDKEAIKQMAAHGIIRKPGEDLTCTGVDCYKLAFFIIAASTFVGFIVSLVLVLRTF  536

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKFR
Sbjct  537  NFYKGDIYKKFR  548



>ref|XP_009140846.1| PREDICTED: uncharacterized protein LOC103864824 [Brassica rapa]
Length=581

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T +L +SC GHLLIA
Sbjct  372  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTFVLLLSCAGHLLIA  431

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  432  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  491

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+KA G  R+  +DL C+G +C++L F+I+ +VT FG LVS  LA+RTR
Sbjct  492  TGMLYDREALKQLKARGLTRKDVKDLTCLGSQCYKLPFVILASVTFFGALVSLGLAIRTR  551

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  552  KFYKGDIYKKFR  563



>ref|XP_004981407.1| PREDICTED: uncharacterized protein LOC101759573 [Setaria italica]
Length=622

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV +GF SE FLT+Y+FPRPL+LT++L +SCVGHLLIA
Sbjct  402  LGYPAKSINTFVSLISIWNYAGRVTSGFASEIFLTRYRFPRPLMLTLVLLLSCVGHLLIA  461

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  462  FGVPQSLYAASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYVLNVRV  521

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA RQ         AG D  C+GV+CF+ AF+IITA T  G LVS VL  RTR
Sbjct  522  AGGLYDAEAARQHGG----SLAGGDKTCIGVQCFRKAFLIITAATVAGALVSLVLVWRTR  577

Query  289  KFYKGDIYKKFR  254
            KFYKGDIY KFR
Sbjct  578  KFYKGDIYAKFR  589



>ref|XP_006354407.1| PREDICTED: uncharacterized protein LOC102589907 [Solanum tuberosum]
Length=562

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  SISTFVSLVSIWNYLGRV++GF SE  L+KY FPRPL+LT++L +SC+GHLLIA
Sbjct  353  LGYPDSSISTFVSLVSIWNYLGRVSSGFASEILLSKYNFPRPLMLTLVLLLSCIGHLLIA  412

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F VR  LY +SV++GFCFGAQWPL+ +IISELFGLKYY+TLYNFGS ASPIG YILNVRV
Sbjct  413  FGVRNSLYVSSVLMGFCFGAQWPLILSIISELFGLKYYATLYNFGSVASPIGGYILNVRV  472

Query  469  AGHLYDREAERQMKALGK-IRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRT  293
            AGHLYD+EA +Q++A G   R+ GE L+CVGV+C++ AF+II+  T  G +VS +L +RT
Sbjct  473  AGHLYDKEALKQLEAKGIFTRKIGEVLNCVGVQCYKQAFLIISGATFVGSIVSLILVLRT  532

Query  292  RKFYKGDIYKKFR  254
            RKFY  DIYKKF+
Sbjct  533  RKFYATDIYKKFK  545



>ref|XP_006664561.1| PREDICTED: uncharacterized protein LOC102703921 [Oryza brachyantha]
Length=587

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV +GF SE FLT+YKFPRP++LT++L ++CVGHLLIA
Sbjct  375  LGYPAKSIKTFISLISIWNYAGRVTSGFASEIFLTRYKFPRPMMLTLVLLLACVGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL+NFGS ASPIG+Y+LNVRV
Sbjct  435  FGVPQSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRV  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G +  AG+ + C GV+CF+ +F+IIT VT  G LVS +L  RTR
Sbjct  495  AGRMYDAEAARQH---GGVAVAGDKI-CKGVQCFKHSFLIITGVTFAGALVSLLLVWRTR  550

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KF+
Sbjct  551  SFYKGDIYAKFK  562



>gb|KFK32342.1| hypothetical protein AALP_AA6G229300 [Arabis alpina]
Length=578

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  371  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  430

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F + G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  431  FPIPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  490

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+KA G  R   +DL C+G +C++L F+I+ AVT FG LV+  LA+RTR
Sbjct  491  TGMLYDREALKQLKARGLTREDVKDLTCIGSQCYKLPFVILAAVTFFGALVALGLAIRTR  550

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  551  EFYKGDIYKKFR  562



>ref|XP_002880951.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57210.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=573

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  364  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  424  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  484  TGMLYDREALKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLGLAIRTR  543

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  544  EFYKGDIYKKFR  555



>gb|EMS57879.1| putative transporter MCH1 [Triticum urartu]
Length=452

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG++SE F+ +Y+FPRPL LT +L  SCVGHLLIA
Sbjct  219  LGYPHKSINTFVSLISIWNYAGRVGAGYMSEFFVARYRFPRPLALTAVLLFSCVGHLLIA  278

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVI+GFCFGAQWPLLF+IISE+FGLKYYSTL+NFGS ASPIG+Y+LNVR+
Sbjct  279  FGVPQSLYAASVILGFCFGAQWPLLFSIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRI  338

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G    A  D  C GV CF+ AF+IIT VT  G LVS VL  RTR
Sbjct  339  AGRMYDAEAARQH---GGHAAAVGDKICKGVMCFKHAFLIITGVTLAGALVSLVLVWRTR  395

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KF+
Sbjct  396  NFYKGDIYAKFK  407



>ref|XP_008779532.1| PREDICTED: probable transporter MCH1, partial [Phoenix dactylifera]
Length=350

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K++ISTFVSL+SIWNY GRV AGF+ E  L KYKFPRPL LT++L +SC GHLLIA
Sbjct  112  LGYSKRNISTFVSLISIWNYAGRVTAGFVPEIVLAKYKFPRPLALTLVLLLSCGGHLLIA  171

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASVI+GFCFGAQW LLFAIISE+FGLKYYSTLYNFG  ASPIGSYILNVR+
Sbjct  172  FGVSQSLYVASVIVGFCFGAQWTLLFAIISEIFGLKYYSTLYNFGGVASPIGSYILNVRI  231

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDRE  +Q   L  +R  G+DL C+GV+C++L+FIIITA T  G LVS +L  RTR
Sbjct  232  AGHLYDRETAKQSNGL--LRANGKDLTCIGVECYKLSFIIITAATVLGALVSLILVWRTR  289

Query  289  KFYKGDI  269
             FYKGDI
Sbjct  290  NFYKGDI  296



>ref|XP_003559292.1| PREDICTED: uncharacterized protein LOC100830563 [Brachypodium 
distachyon]
Length=634

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SEH LT+YKFPRPL+LT++L ++CVGHLLIA
Sbjct  414  LGYPAKSIKTFISLISIWNYAGRVTAGFFSEHVLTRYKFPRPLMLTLVLLLACVGHLLIA  473

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+G+Y+LNVRV
Sbjct  474  FGVPSSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPVGAYVLNVRV  533

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+ YD EA +Q    GK+  AG D  C+GV+CF+++F+IITA T  G LVS +L  RTR
Sbjct  534  AGYFYDVEAAKQHG--GKLDGAG-DKTCIGVQCFKMSFLIITAATVAGALVSLLLVWRTR  590

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY KFR
Sbjct  591  KFYRSDIYAKFR  602



>dbj|BAJ89452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG++SE F+ +Y+FPRPL LT +L +SCVGHLLIA
Sbjct  381  LGYPPKSINTFVSLISIWNYAGRVGAGYMSEFFVARYRFPRPLALTAVLLVSCVGHLLIA  440

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVI+GFCFGAQWPLLF+IISE+FGLKYYSTL+NFGS ASPIG+Y+LNVR+
Sbjct  441  FGVPQSLYAASVILGFCFGAQWPLLFSIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRI  500

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G     G+ + C GV CF+ AF+IIT VT  GVLVS VL  RTR
Sbjct  501  AGRMYDAEAARQHG--GNAAAVGDKI-CKGVTCFKHAFLIITGVTLAGVLVSLVLVWRTR  557

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KF+
Sbjct  558  NFYKGDIYAKFK  569



>dbj|BAJ86744.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SE  L +YKFPRPL+LT++L ++CVGHLLIA
Sbjct  368  LGYPAKSIKTFISLISIWNYAGRVTAGFASEAVLARYKFPRPLMLTLVLLLACVGHLLIA  427

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y LNVRV
Sbjct  428  FGVPQSLYAASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYALNVRV  487

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ    G +  AG D  C+GV+CF+LAF+IITAVT  G LVS VL  RTR
Sbjct  488  AGYLYDVEAARQHG--GTLDGAG-DKTCIGVQCFKLAFLIITAVTVAGALVSLVLVWRTR  544

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY KFR
Sbjct  545  KFYRSDIYAKFR  556



>ref|XP_006295838.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
 gb|EOA28736.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
Length=583

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  351  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F + G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  411  FPIPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  471  TGMLYDREALKQLAARGLTRKDVKDLTCIGSQCYKLPFVILAAVTFFGALVSLGLAMRTR  530

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  531  EFYKGDIYKKFR  542



>ref|NP_001066777.2| Os12g0484600 [Oryza sativa Japonica Group]
 gb|ABA98516.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA98517.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29796.2| Os12g0484600 [Oryza sativa Japonica Group]
Length=599

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG+LSE  L +Y+FPRPL LT +L  SCVGHLLIA
Sbjct  371  LGYPAKSINTFVSLISIWNYAGRVGAGYLSEMLLARYRFPRPLALTAVLLASCVGHLLIA  430

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL+NFGS ASPIG+Y+LNVRV
Sbjct  431  FGVPGSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRV  490

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G +  AG+ + C GV CF+ +F+IIT VT  G LVS +L  RTR
Sbjct  491  AGRMYDAEAARQH---GGVAVAGDKI-CKGVMCFKRSFLIITGVTFAGALVSLLLVWRTR  546

Query  289  KFYKGDIYKKFR  254
             FYKGDIY +F+
Sbjct  547  SFYKGDIYARFK  558



>gb|EAY83124.1| hypothetical protein OsI_38340 [Oryza sativa Indica Group]
 gb|EAZ20495.1| hypothetical protein OsJ_36102 [Oryza sativa Japonica Group]
Length=597

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 154/192 (80%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG+LSE  L +Y+FPRPL LT +L  SCVGHLLIA
Sbjct  369  LGYPAKSINTFVSLISIWNYAGRVGAGYLSEMLLARYRFPRPLALTAVLLASCVGHLLIA  428

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G LYAASVIIGFCFGAQWPLLFAIISE+FGLKYYSTL+NFGS ASPIG+Y+LNVRV
Sbjct  429  FGVPGSLYAASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRV  488

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G +  AG+ + C GV CF+ +F+IIT VT  G LVS +L  RTR
Sbjct  489  AGRMYDAEAARQH---GGVAVAGDKI-CKGVMCFKRSFLIITGVTFAGALVSLLLVWRTR  544

Query  289  KFYKGDIYKKFR  254
             FYKGDIY +F+
Sbjct  545  SFYKGDIYARFK  556



>dbj|BAJ93275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SE  L +YKFPRPL+LT++L ++CVGHLLIA
Sbjct  405  LGYPAKSIKTFISLISIWNYAGRVTAGFASEAVLARYKFPRPLMLTLVLLLACVGHLLIA  464

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y LNVRV
Sbjct  465  FGVPQSLYAASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYALNVRV  524

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ    G +  AG D  C+GV+CF+LAF+IITAVT  G LVS VL  RTR
Sbjct  525  AGYLYDVEAARQHG--GTLDGAG-DKTCIGVQCFKLAFLIITAVTVAGALVSLVLVWRTR  581

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY KFR
Sbjct  582  KFYRSDIYAKFR  593



>emb|CDX71381.1| BnaC04g16160D [Brassica napus]
Length=572

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L K+K PRPL++T++L +SC GHLLIA
Sbjct  364  LGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTLVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKY+STL+N G  ASP+GSYILNVRV
Sbjct  424  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  484  TGMLYDREAMKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLGLAIRTR  543

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  544  KFYKGDIYKKFR  555



>ref|NP_180379.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAC98454.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL14413.1| At2g28120/F24D13.9 [Arabidopsis thaliana]
 gb|AAL32615.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAM13326.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC08082.1| major facilitator protein [Arabidopsis thaliana]
Length=577

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  364  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  424  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYD+EA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  484  TGMLYDKEALKQLTARGLTRKDVKDLTCLGSQCYKLPFLILAAVTFFGALVSLGLAIRTR  543

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  544  EFYKGDIYKKFR  555



>emb|CAN63260.1| hypothetical protein VITISV_029213 [Vitis vinifera]
Length=613

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  826  GYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIAF  647
            GY   S +TFVSLVSIWNYLGRV +GF SE FLT+YKFPRPL+LT +L  SCVGHLLIAF
Sbjct  369  GYTAHSTTTFVSLVSIWNYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLIAF  428

Query  646  NVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRVA  467
             V   LY ASVIIGFCFGAQWPL+FAIISELFGLKYYSTLYNFG+ ASP+GSYILNV+VA
Sbjct  429  AVPNSLYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVKVA  488

Query  466  GHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTRK  287
            GHLYD+EA +Q++A G  R AG+DL C G  C++L+FIIITA T FG ++S +L +RT+K
Sbjct  489  GHLYDKEALKQLEASGVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRTKK  548



>ref|XP_009783152.1| PREDICTED: uncharacterized protein LOC104231797 [Nicotiana sylvestris]
Length=568

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY K SI+TFVSLVSIW YLGRVA+GF SE FL KYKFPRPL+LT++L +SCVGH+LIA
Sbjct  357  LGYSKTSITTFVSLVSIWGYLGRVASGFASEIFLEKYKFPRPLMLTLVLLLSCVGHVLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV++GFCFGA WPL+FAIISE+FGLK+YSTL NFG  ASPIG+YI NV+V
Sbjct  417  FGVTNTLYVASVLMGFCFGALWPLIFAIISEIFGLKHYSTLLNFGGAASPIGAYIFNVKV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +QM A G IR+ GEDL C GV+C++L+F+II A T  G +VS VL +RT 
Sbjct  477  AGNLYDKEAIKQMAAHGIIRKPGEDLTCTGVECYKLSFLIIAASTFVGFIVSLVLVLRTF  536

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKFR
Sbjct  537  NFYKGDIYKKFR  548



>emb|CDY04538.1| BnaA07g13640D [Brassica napus]
Length=572

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L K+K PRPL++T++L +SC GHLLIA
Sbjct  365  LGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTLVLLLSCAGHLLIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKY+STL+N G  ASP+GSYILNVRV
Sbjct  425  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQLASPLGSYILNVRV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  485  TGMLYDREAMKQLTARGLTRKDVKDLTCLGRQCYKLPFVILAAVTFFGALVSLGLAIRTR  544

Query  289  KFYKGDIYKKFR  254
            KFYKGDIYKKFR
Sbjct  545  KFYKGDIYKKFR  556



>ref|XP_002464077.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
 gb|EER91075.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
Length=647

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP+++ISTFVSLVSIWNY GRV +GF SE+ L +YK PRPL LT++L ++CVGH LIA
Sbjct  415  LGYPQRTISTFVSLVSIWNYAGRVVSGFASEYVLARYKVPRPLALTVVLLLACVGHALIA  474

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASP+GSYILNVRV
Sbjct  475  FGVGNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPVGSYILNVRV  534

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD+EA RQ       RR  +DL C+GV+CF+ +F+IIT VT  G LVS VLA RTR
Sbjct  535  AGRMYDQEALRQAGG----RRGSKDLTCIGVRCFRESFLIITGVTLLGALVSLVLAWRTR  590

Query  289  KFYKGDIYKKFR  254
             FY+GD+Y +FR
Sbjct  591  NFYRGDLYGQFR  602



>gb|EMT24580.1| hypothetical protein F775_21272 [Aegilops tauschii]
Length=610

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SE  L +YKFPRPL+LT++L ++CVGHLLIA
Sbjct  401  LGYPPKSIKTFISLISIWNYAGRVTAGFASEAVLARYKFPRPLMLTLVLLLACVGHLLIA  460

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISELFGLKYYSTLYNFGS ASPIG+Y LNVRV
Sbjct  461  FGVPQSLYAASVVIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGAYALNVRV  520

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ    G +  AG D  CVGV+CF+LAF+IITA T  G LVS +L  RTR
Sbjct  521  AGYLYDVEAARQHG--GTLDGAG-DKTCVGVQCFKLAFLIITAATVAGALVSLLLVWRTR  577

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY KFR
Sbjct  578  KFYRSDIYAKFR  589



>ref|XP_006838710.1| PREDICTED: uncharacterized protein LOC18429361 [Amborella trichopoda]
 gb|ERN01279.1| hypothetical protein AMTR_s00002p00250920 [Amborella trichopoda]
Length=590

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 2/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  + ISTFVSL+SIWN+LGRV +GF SE  L KYKFPRPL+LTI++  SCVG +LIA
Sbjct  367  LGYGPQGISTFVSLISIWNFLGRVMSGFGSEIVLAKYKFPRPLMLTIVMLFSCVGQILIA  426

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G ++ ASVIIG CFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYI NVRV
Sbjct  427  FPFPGSVFIASVIIGLCFGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPVGSYIFNVRV  486

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA +Q+   GK    G +L C G +CF+L+FIIITA T  G L+S VL VRTR
Sbjct  487  AGHLYDIEAAKQLG--GKALAPGVELTCTGNRCFRLSFIIITACTLLGALISIVLVVRTR  544

Query  289  KFYKGDIYKKFR  254
            +FYKGDIY +FR
Sbjct  545  EFYKGDIYARFR  556



>ref|XP_009103645.1| PREDICTED: uncharacterized membrane protein YMR155W [Brassica 
rapa]
Length=572

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L K+K PRPL++T++L +SC GHLLIA
Sbjct  365  LGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTLVLLLSCAGHLLIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V G +Y AS+++GF FGAQ PLLFAIISELFGLKY+STL+N G  ASP+GSYILNVRV
Sbjct  425  FPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQLASPLGSYILNVRV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+ AVT FG LVS  LA+RTR
Sbjct  485  TGMLYDREAMKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLGLAIRTR  544

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  545  KFYRGDIYKKFR  556



>ref|XP_011655862.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=585

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYPKKSIS FV+LVSIW+YLGRV  GF+SE  L KYKFPR L+L++IL +SCVGHL+IA
Sbjct  362  LGYPKKSISIFVTLVSIWSYLGRVGCGFISEIVLIKYKFPRTLILSLILLLSCVGHLMIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F+V  GLY AS++IGFCFGAQWPL+FAIISELFGLKYY+TL+ FG+ ASP+G Y+LNV+V
Sbjct  422  FDVPNGLYVASIVIGFCFGAQWPLVFAIISELFGLKYYATLHVFGAVASPVGLYVLNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+ YDREA +Q+   G +R+AG++L+C G +CF+L+F +ITAVT  G+ +S +L +RTR
Sbjct  482  AGNFYDREARKQLNTKGILRKAGKELNCYGGECFKLSFTVITAVTLMGMFISLILVIRTR  541

Query  289  KFYKGDIYKKFR  254
             FYK DIYKKFR
Sbjct  542  SFYKSDIYKKFR  553



>ref|XP_011469614.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_004307337.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=597

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   SISTFVSL SIW YLG V  G LSE F+TKYKFPRPL+ T+ L +SC+GHLLIA
Sbjct  365  LGYSLGSISTFVSLTSIWVYLGEVMVGMLSEIFITKYKFPRPLMFTLSLLLSCIGHLLIA  424

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLYAAS+IIGFCFG QWPL+F++ SE+FGLK+ STL N G  A P+GSY++NVRV
Sbjct  425  FNVPNGLYAASIIIGFCFGGQWPLIFSVTSEIFGLKHCSTLNNVGVMACPLGSYLINVRV  484

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EAE+Q++ALG  R+ GE L+C G +C++L FIIIT VT  GVL S VL +RTR
Sbjct  485  TGYLYDKEAEKQLRALGLERKIGEGLNCSGGQCYRLPFIIITGVTMLGVLFSLVLVLRTR  544

Query  289  KFYKGDIYKKFR  254
            KFY  DIYKKF+
Sbjct  545  KFYNSDIYKKFK  556



>dbj|BAJ86921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SE  L +YKFPRPL+LT++L ++CVGHLLIA
Sbjct  405  LGYPAKSIKTFISLISIWNYAGRVTAGFASEAVLARYKFPRPLMLTLVLLLACVGHLLIA  464

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y LNVRV
Sbjct  465  FGVPQSLYAASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYALNVRV  524

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ    G +  AG D  C+GV+CF+LAF+IITAVT  G LVS VL  R R
Sbjct  525  AGYLYDVEAARQHG--GTLDGAG-DKTCIGVQCFKLAFLIITAVTVAGALVSLVLVWRAR  581

Query  289  KFYKGDIYKKFR  254
            KFY+ DIY KFR
Sbjct  582  KFYRSDIYAKFR  593



>emb|CDP14418.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  K+I+TFV+LVSIWNYLGRVAAGF SE  L KYKFPRPL++ ++L +SC GHLLIA
Sbjct  367  LGYQTKAIATFVTLVSIWNYLGRVAAGFASEILLAKYKFPRPLMMALVLLVSCAGHLLIA  426

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F     LY AS+I+GFCFGAQW L+F+I+SELFGLKYYSTL +  + A+P+G+Y+LNVRV
Sbjct  427  FGAPNSLYLASLIVGFCFGAQWTLIFSIVSELFGLKYYSTLISIAAGATPLGNYVLNVRV  486

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA  QM A G  R+ GE L C GV+C++L+F+I+TA T FG ++S VL+ RTR
Sbjct  487  AGHLYDMEALNQMTAKGLTRKEGEGLTCSGVECYKLSFLIVTAATFFGSVLSLVLSYRTR  546

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  547  NFYKGDIYLKFR  558



>ref|XP_008385512.1| PREDICTED: uncharacterized protein LOC103448055 [Malus domestica]
Length=559

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T++L +SCVGHLLIA
Sbjct  362  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  422  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G  R + ++L C+G +C++LAF I+TA+T FG +VS +L VRTR
Sbjct  482  TGMLYDREALKELAKSGMARSSVKELICLGNQCYRLAFSILTAITFFGAVVSLILVVRTR  541

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  542  EFYKGDIYKKFR  553



>ref|XP_006409833.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
 gb|ESQ51286.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
Length=560

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP  ++S+FVSLVSIWNY GRV +GF+SE+ L KYK PRPL++T++L +SC GHLLIA
Sbjct  355  LGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIA  414

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F + G +Y AS+++GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  415  FPIPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  474

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +Q+ A G  R+  +DL C+G +C++L F+I+  VT FG LVS  LA+RTR
Sbjct  475  TGMLYDREALKQLAARGLTRKDVKDLTCLGRQCYKLPFVILATVTFFGALVSLGLAIRTR  534

Query  289  KFYKGDIYKKFR  254
            +FYKGDIY KFR
Sbjct  535  EFYKGDIYNKFR  546



>ref|XP_009345750.1| PREDICTED: uncharacterized protein LOC103937531 [Pyrus x bretschneideri]
Length=559

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T++L +SCVGHLLIA
Sbjct  362  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  422  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G+ R + ++L C+G +C++LAF I+ AVT FG +VS +L VRTR
Sbjct  482  TGMLYDREALKELAKSGRDRSSVKELICLGSQCYRLAFSILAAVTFFGAVVSLILVVRTR  541

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  542  EFYKGDIYKKFR  553



>ref|XP_010689140.1| PREDICTED: uncharacterized protein LOC104902902 [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV AGF+SE  L K+KFPRPL++T+IL ++CVGHLLIA
Sbjct  382  LGYPTKTISSFVSLVSIWNYFGRVFAGFVSETLLAKWKFPRPLMMTLILLLACVGHLLIA  441

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F + G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  442  FPIPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  501

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYD+EA +++   G  R   ++L C+G +C++L+FII+  VT FG L+S +L +RTR
Sbjct  502  TGMLYDKEALKELAKRGLKRSDVKELTCLGTRCYRLSFIILAGVTIFGALISFILVIRTR  561

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  562  EFYKGDIYKKFR  573



>ref|XP_003576191.1| PREDICTED: uncharacterized protein LOC100839547 [Brachypodium 
distachyon]
Length=596

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 150/192 (78%), Gaps = 4/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG++SE FL +Y+FPRPL LT +L +SCVGHLLIA
Sbjct  370  LGYPAKSINTFVSLISIWNYAGRVGAGYMSEFFLARYRFPRPLALTAVLLVSCVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVIIGFCFGAQWPLLF+IISE+FGLKYYSTL+NFGS ASPIG+Y+LNV +
Sbjct  430  FGVPQSLYAASVIIGFCFGAQWPLLFSIISEVFGLKYYSTLFNFGSAASPIGAYVLNVLI  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ         A  D  C GV CF+ AF+IIT VT  G LVS +L  RTR
Sbjct  490  AGRMYDAEAARQHGG----HAAVGDKVCKGVNCFKHAFLIITGVTLAGALVSLILVWRTR  545

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KF+
Sbjct  546  SFYKGDIYAKFK  557



>ref|XP_009335989.1| PREDICTED: uncharacterized protein LOC103928636 [Pyrus x bretschneideri]
Length=559

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T++L +SCVGHLLIA
Sbjct  362  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  422  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G+ R + ++L C+G +C++LAF I+ AVT FG +VS +L VRTR
Sbjct  482  TGMLYDREALKELAKSGRDRSSVKELICLGSQCYRLAFSILAAVTFFGAVVSLILVVRTR  541

Query  289  KFYKGDIYKKFR  254
            +FYKGDIYKKFR
Sbjct  542  EFYKGDIYKKFR  553



>gb|EMT08425.1| hypothetical protein F775_07944 [Aegilops tauschii]
Length=604

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AG++SE F+ +Y+FPRPL LT +L  SCVGHLLIA
Sbjct  370  LGYPHKSINTFVSLISIWNYAGRVGAGYMSEFFVARYRFPRPLALTAVLLFSCVGHLLIA  429

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASVI+GFCFGAQWPLLF+IISE+FGLKYYSTL+NFGS ASPIG+Y+LNVR+
Sbjct  430  FGVPQSLYAASVILGFCFGAQWPLLFSIISEVFGLKYYSTLFNFGSAASPIGAYVLNVRI  489

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA RQ    G    A  D  C GV CF+ AF+IIT VT  G LVS VL  RTR
Sbjct  490  AGRMYDAEAARQHG--GHAAAAVGDKICKGVLCFKHAFLIITGVTLAGALVSLVLVWRTR  547

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KF+
Sbjct  548  NFYKGDIYAKFK  559



>ref|XP_008665606.1| PREDICTED: uncharacterized protein LOC103644190 [Zea mays]
 tpg|DAA51972.1| TPA: hypothetical protein ZEAMMB73_438867 [Zea mays]
 tpg|DAA51973.1| TPA: hypothetical protein ZEAMMB73_438867 [Zea mays]
Length=647

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AGF SE FL +YKFPRPL+LT++L +SCVGHLLIA
Sbjct  433  LGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLTLVLLLSCVGHLLIA  492

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  493  FGVPQSLYVASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYVLNVRV  552

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA +Q    G     G D  C+GV+CF+ AF+IITA T  G LVS VL  RTR
Sbjct  553  AGALYDVEAAKQH---GGSLAGGADKTCIGVQCFRKAFLIITAATVAGALVSLVLVWRTR  609

Query  289  KFYKGDIYKKFR  254
             FY+GDIY KFR
Sbjct  610  NFYRGDIYAKFR  621



>ref|XP_008665607.1| PREDICTED: uncharacterized protein LOC103644191 [Zea mays]
 tpg|DAA51975.1| TPA: hypothetical protein ZEAMMB73_386455 [Zea mays]
Length=649

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AGF SE FL +YKFPRPL+LT++L +SCVGHLLIA
Sbjct  435  LGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLTLVLLLSCVGHLLIA  494

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY ASV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  495  FGVPQSLYVASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYVLNVRV  554

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA +Q    G     G D  C+GV+CF+ AF+IITA T  G LVS VL  RTR
Sbjct  555  AGALYDVEAAKQH---GGSLAGGADKTCIGVQCFRKAFLIITAATVAGALVSLVLVWRTR  611

Query  289  KFYKGDIYKKFR  254
             FY+GDIY KFR
Sbjct  612  NFYRGDIYAKFR  623



>ref|XP_012082602.1| PREDICTED: uncharacterized protein LOC105642394 [Jatropha curcas]
Length=575

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY + +ISTF+SL+SIWN+LGRV AGFLSE  LTKYKFPRP++LT+ +  SCVGH+LIA
Sbjct  349  LGYKENNISTFISLISIWNFLGRVLAGFLSETLLTKYKFPRPVILTLTILFSCVGHILIA  408

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY +S+I+GFC GAQ PL+ AIISE+FGLK++STLY+ GS +SP+GSYI NV+V
Sbjct  409  LGVPNSLYLSSIILGFCLGAQLPLVSAIISEMFGLKHFSTLYSVGSVSSPVGSYIFNVKV  468

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA RQM  LG  R  G++L C GV CF+LAF+IIT  +  G LVS +L  RT+
Sbjct  469  AGHLYDREAIRQMSLLGLKREKGKELICNGVHCFRLAFVIITVSSFLGFLVSIILVQRTK  528

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  529  KFYEGDIYKKFR  540



>gb|KDP29178.1| hypothetical protein JCGZ_16567 [Jatropha curcas]
Length=577

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY + +ISTF+SL+SIWN+LGRV AGFLSE  LTKYKFPRP++LT+ +  SCVGH+LIA
Sbjct  351  LGYKENNISTFISLISIWNFLGRVLAGFLSETLLTKYKFPRPVILTLTILFSCVGHILIA  410

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LY +S+I+GFC GAQ PL+ AIISE+FGLK++STLY+ GS +SP+GSYI NV+V
Sbjct  411  LGVPNSLYLSSIILGFCLGAQLPLVSAIISEMFGLKHFSTLYSVGSVSSPVGSYIFNVKV  470

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYDREA RQM  LG  R  G++L C GV CF+LAF+IIT  +  G LVS +L  RT+
Sbjct  471  AGHLYDREAIRQMSLLGLKREKGKELICNGVHCFRLAFVIITVSSFLGFLVSIILVQRTK  530

Query  289  KFYKGDIYKKFR  254
            KFY+GDIYKKFR
Sbjct  531  KFYEGDIYKKFR  542



>gb|AAP68384.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ26937.1| hypothetical protein OsJ_10866 [Oryza sativa Japonica Group]
Length=606

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SISTFVSLVSIWNY GRVAAGF SE+ L  YK PRPL LT +L ++  GHLLIA
Sbjct  377  LGYPQRSISTFVSLVSIWNYAGRVAAGFGSEYVLAAYKLPRPLALTAVLLLATAGHLLIA  436

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  437  LGVGNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRV  496

Query  469  AGHLYDREAERQM---KALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAV  299
             GHLYDREAERQ+         RR   DL C GV+CF+++F+II AVT  G  VS +LA 
Sbjct  497  TGHLYDREAERQLAAAGGGAAARRGSRDLTCAGVRCFRVSFLIIAAVTLLGAAVSLLLAW  556

Query  298  RTRKFYKGDIYKKFR  254
            RTRKFY+GD+Y KFR
Sbjct  557  RTRKFYRGDLYGKFR  571



>gb|EMS61490.1| hypothetical protein TRIUR3_01875 [Triticum urartu]
Length=389

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI TF+SL+SIWNY GRV AGF SE  L +YKFPRPL+LT++L ++CVGHLLIA
Sbjct  176  LGYPPKSIKTFISLISIWNYAGRVTAGFASEAVLARYKFPRPLMLTLVLLLACVGHLLIA  235

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LYAASV+IGFCFGAQWPLLFAIISELFG  Y STLYNFGS ASPIG+Y LNVRV
Sbjct  236  FGVPQSLYAASVVIGFCFGAQWPLLFAIISELFGRNYCSTLYNFGSVASPIGAYALNVRV  295

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD EA RQ    G +  AG D  C+GV+CF+LAF+IITA T  G LVS +L  RTR
Sbjct  296  AGYLYDVEAARQHG--GTLDGAG-DKTCIGVQCFKLAFLIITAATVAGALVSLLLVWRTR  352

Query  289  KFYKGDIYKKFR  254
             FY+ DIY KFR
Sbjct  353  NFYRSDIYAKFR  364



>ref|XP_004986309.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Setaria 
italica]
Length=629

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY ++SI+TFVSLVSIWNY GRV +GF SEH L +YK PRPL LT++L ++CVGH LIA
Sbjct  393  LGYAQRSITTFVSLVSIWNYAGRVVSGFASEHLLARYKVPRPLALTVVLLLACVGHGLIA  452

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  453  SGVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRV  512

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YDREA RQ        R G DL C+GV+CF+ +F+IIT VT  G LVS VLA RTR
Sbjct  513  AGRMYDREALRQGG------RKGRDLTCIGVRCFRESFLIITGVTLLGALVSLVLAWRTR  566

Query  289  KFYKGDIYKKFR  254
            +FY+GD+Y +FR
Sbjct  567  EFYRGDLYGRFR  578



>gb|ABF98224.1| nodulin family protein, putative [Oryza sativa Japonica Group]
Length=639

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SISTFVSLVSIWNY GRVAAGF SE+ L  YK PRPL LT +L ++  GHLLIA
Sbjct  377  LGYPQRSISTFVSLVSIWNYAGRVAAGFGSEYVLAAYKLPRPLALTAVLLLATAGHLLIA  436

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  437  LGVGNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRV  496

Query  469  AGHLYDREAERQM---KALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAV  299
             GHLYDREAERQ+         RR   DL C GV+CF+++F+II AVT  G  VS +LA 
Sbjct  497  TGHLYDREAERQLAAAGGGAAARRGSRDLTCAGVRCFRVSFLIIAAVTLLGAAVSLLLAW  556

Query  298  RTRKFYKGDIYKKFR  254
            RTRKFY+GD+Y KFR
Sbjct  557  RTRKFYRGDLYGKFR  571



>ref|NP_001141252.1| uncharacterized protein LOC100273339 [Zea mays]
 gb|ACF85853.1| unknown [Zea mays]
Length=386

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 6/192 (3%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SI+TFVSLVSIWNY GRV AGF SE+ L +YK PRPL LT++L ++CVGH LIA
Sbjct  154  LGYPQRSITTFVSLVSIWNYAGRVVAGFASEYVLARYKVPRPLALTVVLLLACVGHALIA  213

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVR+
Sbjct  214  FGVNNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRI  273

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YDREA RQ    GK      DL C+GV+CF+ +F+IIT VT  G LVS +LA RTR
Sbjct  274  AGRMYDREALRQGGQRGK------DLTCIGVRCFRESFLIITGVTLLGALVSLLLAWRTR  327

Query  289  KFYKGDIYKKFR  254
             FY+GD+Y +FR
Sbjct  328  NFYRGDLYGRFR  339



>ref|XP_009356931.1| PREDICTED: uncharacterized protein LOC103947712 [Pyrus x bretschneideri]
Length=559

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T++L +SCVGHLLIA
Sbjct  362  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  422  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G  R + ++L C+G +C++LAF I+ A+T FG +VS +L VRTR
Sbjct  482  TGMLYDREALKELAKSGMARSSVKELICLGNQCYRLAFSILAAITFFGAVVSLILVVRTR  541

Query  289  KFYKGDIYKKFR  254
            +FY GDIYKKFR
Sbjct  542  EFYNGDIYKKFR  553



>gb|EAY91415.1| hypothetical protein OsI_13040 [Oryza sativa Indica Group]
Length=584

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 155/195 (79%), Gaps = 3/195 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SISTFV LVSIWNY GRVAAGF SE+ L  YK PRPL LT +L ++  GHLLIA
Sbjct  355  LGYPQRSISTFVYLVSIWNYAGRVAAGFGSEYVLAAYKLPRPLALTAVLLLATAGHLLIA  414

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVRV
Sbjct  415  LGVGNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRV  474

Query  469  AGHLYDREAERQM---KALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAV  299
             GHLYDREAERQ+         RR   DL C GV+CF+++F+II AVT  G  VS +LA 
Sbjct  475  TGHLYDREAERQLAAAAGGAAARRGSRDLTCAGVRCFRVSFLIIAAVTLLGAAVSLLLAW  534

Query  298  RTRKFYKGDIYKKFR  254
            RTRKFY+GD+Y KFR
Sbjct  535  RTRKFYRGDLYGKFR  549



>ref|XP_003559578.1| PREDICTED: uncharacterized protein LOC100828435 [Brachypodium 
distachyon]
Length=609

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 157/192 (82%), Gaps = 6/192 (3%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP++SISTFVSLVSIWNY GRV AGF SE+ L +YK PRPL LT++L ++CVGHLLIA
Sbjct  373  LGYPQRSISTFVSLVSIWNYAGRVVAGFASEYVLARYKMPRPLALTLVLLLACVGHLLIA  432

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V  GLYAASVI+GFCFGAQWPLLFAIISE+FGLKYYSTLYNFG+ ASP+GSYILNVR+
Sbjct  433  VGVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRI  492

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG  YDREA RQ    G  R  G+DL C+GV+CF+ +F II AVT  G  VS +LA RTR
Sbjct  493  AGRFYDREALRQ----GGKR--GKDLTCIGVRCFRESFYIIAAVTLLGAGVSLLLAWRTR  546

Query  289  KFYKGDIYKKFR  254
            +FY+GD+Y KF+
Sbjct  547  EFYRGDLYGKFK  558



>ref|XP_008226501.1| PREDICTED: uncharacterized protein LOC103326070 [Prunus mume]
Length=577

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T++L +SCVGHLLIA
Sbjct  380  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISE+FGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  440  FPAPGSVYVASVIIGFSFGAQLPLLFAIISEIFGLKYYSTLFNCGQLASPLGSYILNVKV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G  R + ++L C+G +C++LAF I+ ++T FG LVS VL +RTR
Sbjct  500  TGMLYDREALKELAKKGMARSSVKELICLGSQCYRLAFTILASITFFGALVSLVLVIRTR  559

Query  289  KFYKGDIYKKF  257
            +FYKGDIYKKF
Sbjct  560  EFYKGDIYKKF  570



>ref|XP_002301218.2| hypothetical protein POPTR_0002s13500g, partial [Populus trichocarpa]
 gb|EEE80491.2| hypothetical protein POPTR_0002s13500g, partial [Populus trichocarpa]
Length=503

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY   +I TF+SLVS+WN+LGRV A F SE  LTKYKFPRPL+LT ++  SC+GH+LIA
Sbjct  303  LGYKTHNIGTFISLVSVWNFLGRVLASFASEVALTKYKFPRPLMLTFVILFSCIGHVLIA  362

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +S+IIGFC GAQ PL+ AIISE+FGLK++STLY+ GS +SPIGSYI NV+V
Sbjct  363  FGVEHSLYISSIIIGFCLGAQLPLVSAIISEIFGLKHFSTLYSVGSVSSPIGSYIFNVKV  422

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG+LYD+EA +QM+ALG  R AG++L+C GV CF+ AF+IITA T  G LVS +L  RTR
Sbjct  423  AGNLYDKEALKQMEALGLKREAGKELNCSGVHCFRKAFVIITAATFLGFLVSIILVYRTR  482

Query  289  KFYKGDIYKKF  257
            +FYKGDIYKKF
Sbjct  483  RFYKGDIYKKF  493



>gb|EAZ03041.1| hypothetical protein OsI_25182 [Oryza sativa Indica Group]
Length=623

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +S +TFVSL+SIWNY GRVAAGF SE F+ +++ PRPLVLT IL ++C GHLLIA
Sbjct  394  LGYPARSTNTFVSLISIWNYAGRVAAGFASEAFVERWRLPRPLVLTGILLLACAGHLLIA  453

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LYAASVIIGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG  ASP+GSYILNV V
Sbjct  454  LGVPRALYAASVIIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMASPVGSYILNVLV  513

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA RQ  A      AG D  C+GV CF+ +F+IITA T FG LVS VL  RT 
Sbjct  514  AGRLYDAEAGRQPGA-SLAAGAGRDKVCLGVDCFKKSFLIITAATVFGALVSLVLVWRTW  572

Query  289  KFYKGDIYKKFR  254
            +FYKGDIY +FR
Sbjct  573  RFYKGDIYARFR  584



>ref|XP_006384953.1| nodulin family protein [Populus trichocarpa]
 gb|ABK95139.1| unknown [Populus trichocarpa]
 gb|ERP62750.1| nodulin family protein [Populus trichocarpa]
Length=559

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+I +FVSLVSIWNY GRV +GF+SE  L KYK PRPL++T +L ++CVGHLLIA
Sbjct  362  LGYPTKTIKSFVSLVSIWNYFGRVFSGFVSESLLVKYKMPRPLMMTFVLLLACVGHLLIA  421

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVI+GF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV++
Sbjct  422  FPFPGSVYVASVIMGFAFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  481

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD EA +++   G  R + ++L C+GV+C+++ FII+++VT FG L+S VL +RTR
Sbjct  482  TGHLYDHEALKELAKKGMNRSSVKELICMGVQCYRVPFIILSSVTLFGALISLVLVMRTR  541

Query  289  KFYKGDIYKKFR  254
            KFY  DIYKKFR
Sbjct  542  KFYSSDIYKKFR  553



>ref|XP_007208506.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
 gb|EMJ09705.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
Length=577

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWNY GRV +GF+SE  L K+K PRPL++T +L +SC GHLLIA
Sbjct  380  LGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTFVLLLSCAGHLLIA  439

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  440  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  499

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G  R + ++L C+G +C++LAF I+ ++T FG LVS VL +RTR
Sbjct  500  TGMLYDREALKELAKKGMARSSVKELICLGSQCYRLAFTILASITFFGALVSLVLVIRTR  559

Query  289  KFYKGDIYKKF  257
            +FYKGDIYKKF
Sbjct  560  EFYKGDIYKKF  570



>ref|XP_002466277.1| hypothetical protein SORBIDRAFT_01g004940 [Sorghum bicolor]
 gb|EER93275.1| hypothetical protein SORBIDRAFT_01g004940 [Sorghum bicolor]
Length=618

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 155/192 (81%), Gaps = 3/192 (2%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV AGF SE FL +YKFPRPL+LT++L +SCVGHLLIA
Sbjct  399  LGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLTLVLLLSCVGHLLIA  458

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   LY +SV+IGFCFGAQWPLLFAIISE+FGLKYYSTLYNFGS ASPIG+Y+LNVRV
Sbjct  459  FGVPQSLYVSSVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVASPIGAYVLNVRV  518

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYD EA +Q    G +  AG D  C+GV+CF+ +F+IITA T  G LVS VL  RT 
Sbjct  519  AGALYDVEAAKQHG--GSLVGAG-DKTCIGVECFRKSFLIITAATVAGALVSLVLVWRTW  575

Query  289  KFYKGDIYKKFR  254
             FYKGDIY KFR
Sbjct  576  NFYKGDIYAKFR  587



>emb|CDP14419.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+I+TFV+LVS+WN+LGRVAAGF SE  L KY F RPL+L ++L +SC GHLLIA
Sbjct  346  LGYPTKTIATFVTLVSVWNFLGRVAAGFASEILLAKYNFARPLMLALVLFVSCAGHLLIA  405

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F V   +Y AS+I+GFCFGAQW L+F+I+SELFGLKYYSTL +  +  +P+G+Y+L VRV
Sbjct  406  FGVPNSVYLASLIVGFCFGAQWTLIFSIVSELFGLKYYSTLVSIVAGGTPLGTYVLKVRV  465

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AGHLYD EA +QM A G  R+ GE L C GV+C++L+F+I+TA T FG  +S VL+ RTR
Sbjct  466  AGHLYDMEALKQMAAKGLTRKEGEALTCNGVECYKLSFLILTAATFFGCALSLVLSYRTR  525

Query  289  KFYKGDIYKKFR  254
             FYKGDIYKKF+
Sbjct  526  NFYKGDIYKKFK  537



>ref|XP_003557448.1| PREDICTED: uncharacterized protein LOC100822987 [Brachypodium 
distachyon]
Length=626

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 150/192 (78%), Gaps = 2/192 (1%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP KSI+TFVSL+SIWNY GRV +GF SE  L +YK PR L+LT +L ++CVGH+LIA
Sbjct  403  LGYPSKSINTFVSLISIWNYAGRVTSGFASEILLERYKVPRTLMLTGVLLLACVGHVLIA  462

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
              V   LYAASV+IGFCFGAQWPL+FAIISE+FGLKYYSTLYNFG  ASP+GSYILNVRV
Sbjct  463  LGVPHSLYAASVVIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMASPVGSYILNVRV  522

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG +YD EA+RQ    G     G D  C+GV+CF+ +F+IITA T FG LVS VL  RT 
Sbjct  523  AGRMYDAEADRQPG--GGFAAGGRDKVCLGVECFKRSFLIITAATVFGALVSLVLVWRTW  580

Query  289  KFYKGDIYKKFR  254
             FYKGDIY +FR
Sbjct  581  AFYKGDIYARFR  592



>ref|XP_008379570.1| PREDICTED: uncharacterized protein LOC103442545 [Malus domestica]
Length=607

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +SI+TFVSL SIW YLG V  GFLSE F+TKYK PRPL LT+ L +SC+GHLLIA
Sbjct  375  LGYSLESITTFVSLASIWIYLGEVMLGFLSEVFITKYKIPRPLTLTVSLLVSCIGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+I GFCFG QWPL+FAIISE+FGLK+ STL N G  A P+GSY+LNV+V
Sbjct  435  FNVPNGLYVASIITGFCFGGQWPLIFAIISEVFGLKHCSTLNNVGVMACPLGSYLLNVKV  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EAE+Q+ ALG  R+ GE L+C G +C++L F+IIT  T  GV  S +L +RT 
Sbjct  495  TGYLYDKEAEKQLXALGLERKPGEGLNCTGGQCYKLPFLIITGATILGVFFSLILVLRTW  554

Query  289  KFYKGDIYKKFR  254
            KFY  DIYKKF+
Sbjct  555  KFYNSDIYKKFK  566



>ref|XP_010111839.1| hypothetical protein L484_020631 [Morus notabilis]
 gb|EXC31804.1| hypothetical protein L484_020631 [Morus notabilis]
Length=573

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP +++S+FVSLVSIWNY GRV +GF+SE  + K+K PRPL++T +L +SC GHLLIA
Sbjct  364  LGYPARTVSSFVSLVSIWNYFGRVFSGFVSEGLMVKWKVPRPLMMTFVLLLSCAGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F + G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  424  FPIPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
            AG LYDREA +++   G  R++ ++L C+G  C++++F I+  VT FG LVS +L VRTR
Sbjct  484  AGMLYDREALKELAQKGLDRKSVKELICIGKNCYRVSFTILACVTFFGALVSLILVVRTR  543

Query  289  KFYKGDIYKKFR  254
            +FY+GDIYKKFR
Sbjct  544  EFYRGDIYKKFR  555



>gb|EYU36146.1| hypothetical protein MIMGU_mgv1a018039mg [Erythranthe guttata]
Length=583

 Score =   258 bits (659),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            L YP ++I TFVSL+SIWNY GR+ +GF+SE  L+KYKFPRPL++TI+L +SC+G LLIA
Sbjct  375  LEYPVRTIKTFVSLLSIWNYFGRIFSGFVSEKLLSKYKFPRPLMMTIVLFLSCIGLLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F  RG +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNVRV
Sbjct  435  FPFRGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRV  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA + +   G  R + ++L CVG +C++LAF+I+ +VT FG + S +L  RTR
Sbjct  495  TGPLYDREALKNLAKKGLTRDSVKELTCVGPQCYRLAFVILASVTFFGAVSSLILVARTR  554

Query  289  KFYKGDIYKKFR  254
            +FY+GDIYKKFR
Sbjct  555  EFYRGDIYKKFR  566



>ref|XP_010045310.1| PREDICTED: uncharacterized protein LOC104434056 [Eucalyptus grandis]
 gb|KCW87472.1| hypothetical protein EUGRSUZ_B03936 [Eucalyptus grandis]
Length=599

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +  STFVSLVSIWNY GRV +GF+SE  L +YKFPRPL++T++L +SCVGHLLIA
Sbjct  369  LGYEARITSTFVSLVSIWNYFGRVFSGFVSESLLVRYKFPRPLMMTLVLLLSCVGHLLIA  428

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G LY ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  429  FPSSGSLYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  488

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA +++   G  R + ++L C+G  C++L+FII+  VT FG LVS +L VRTR
Sbjct  489  TGMLYDREALKELARKGLSRDSVKELTCIGRHCYRLSFIILALVTLFGALVSLILVVRTR  548

Query  289  KFYKGDIYKKFR  254
            +FY+GDIY+KFR
Sbjct  549  EFYRGDIYEKFR  560



>ref|XP_011459986.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=534

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWN+ GRV +GF+SE  L ++K PRPL++T++L +S +GHLLIA
Sbjct  337  LGYPTKTISSFVSLVSIWNFFGRVFSGFVSESLLVRWKMPRPLMMTLVLMLSSIGHLLIA  396

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  397  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  456

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA + + + G  R + ++L C+G +C++L+F I+ AVT FG LVS VL +RTR
Sbjct  457  TGMLYDREALKVLASKGMTRSSVKELICIGSQCYRLSFSILAAVTFFGALVSLVLVIRTR  516

Query  289  KFYKGDIYKKFR  254
            +FYK DIYKKFR
Sbjct  517  EFYKSDIYKKFR  528



>gb|EPS69782.1| hypothetical protein M569_04980, partial [Genlisea aurea]
Length=547

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY +KS++TFVSLVSIW YLGRV +GF SE  L K++FPRPL+LT +L +SC GHLLIA
Sbjct  357  LGYTEKSVTTFVSLVSIWGYLGRVISGFASEILLAKFRFPRPLMLTAVLLVSCSGHLLIA  416

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            + V   LYAASVI+GFCFGAQWPL+FAIISE+FGLKYYSTLY+ G  ASP+G+YI NV+V
Sbjct  417  YGVPNSLYAASVIVGFCFGAQWPLIFAIISEIFGLKYYSTLYSLGGGASPLGAYIFNVKV  476

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             GHLYD EA +Q  A       G DL CVGV+C++ AF+ I   T  G L S +L +RTR
Sbjct  477  TGHLYDAEARKQTTA------GGPDLSCVGVRCYRTAFLTIAVATFAGALASLILVMRTR  530

Query  289  KFYKGDIYKKFR  254
            KFY+GDIY+KFR
Sbjct  531  KFYRGDIYRKFR  542



>ref|XP_009368937.1| PREDICTED: uncharacterized protein LOC103958409 [Pyrus x bretschneideri]
 ref|XP_009368984.1| PREDICTED: uncharacterized protein LOC103958445 [Pyrus x bretschneideri]
Length=607

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGY  +SI+TFVSL SIW YLG V  GFLSE F+TKYK PRPL+ T+ L +SC+GHLLIA
Sbjct  375  LGYSLESITTFVSLASIWIYLGEVMLGFLSEVFITKYKIPRPLMFTVSLLVSCIGHLLIA  434

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            FNV  GLY AS+I GFCFG QWPL+FAI SE+FGLK+ STL N G  A P+GSY+LNV+V
Sbjct  435  FNVPNGLYVASIITGFCFGGQWPLIFAITSEVFGLKHCSTLNNVGVMACPLGSYLLNVKV  494

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G+LYD+EAE+Q+KALG  R+ GE L+C G +C++L F+IIT  T  GV  S +L +RT 
Sbjct  495  TGYLYDKEAEKQLKALGLERKPGEGLNCTGGQCYKLPFLIITGATILGVFFSLILVLRTW  554

Query  289  KFYKGDIYKKFR  254
            KFY  DIYKKF+
Sbjct  555  KFYNSDIYKKFK  566



>ref|XP_011089961.1| PREDICTED: uncharacterized protein LOC105170755 [Sesamum indicum]
Length=573

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+I +FVSL+SIWNY GRV +GF+SE  L KYKFPRPL++TI+L +SC+G +LIA
Sbjct  371  LGYPTKTIKSFVSLLSIWNYFGRVFSGFVSETLLAKYKFPRPLMMTIVLLLSCIGLILIA  430

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F  +G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  431  FPFQGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  490

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA R++   G  R + + L C+G +C++LAF+I+ ++T FG + S +L VRT+
Sbjct  491  TGPLYDREALRELAKKGMTRSSVKQLTCIGARCYRLAFLILASITFFGAISSLILVVRTQ  550

Query  289  KFYKGDIYKKF  257
            +FY+GDIYKKF
Sbjct  551  EFYRGDIYKKF  561



>ref|XP_004288935.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=561

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  829  LGYPKKSISTFVSLVSIWNYLGRVAAGFLSEHFLTKYKFPRPLVLTIILSISCVGHLLIA  650
            LGYP K+IS+FVSLVSIWN+ GRV +GF+SE  L ++K PRPL++T++L +S +GHLLIA
Sbjct  364  LGYPTKTISSFVSLVSIWNFFGRVFSGFVSESLLVRWKMPRPLMMTLVLMLSSIGHLLIA  423

Query  649  FNVRGGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSTASPIGSYILNVRV  470
            F   G +Y ASVIIGF FGAQ PLLFAIISELFGLKYYSTL+N G  ASP+GSYILNV+V
Sbjct  424  FPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  483

Query  469  AGHLYDREAERQMKALGKIRRAGEDLDCVGVKCFQLAFIIITAVTAFGVLVSAVLAVRTR  290
             G LYDREA + + + G  R + ++L C+G +C++L+F I+ AVT FG LVS VL +RTR
Sbjct  484  TGMLYDREALKVLASKGMTRSSVKELICIGSQCYRLSFSILAAVTFFGALVSLVLVIRTR  543

Query  289  KFYKGDIYKKFR  254
            +FYK DIYKKFR
Sbjct  544  EFYKSDIYKKFR  555



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779792308916