BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4080

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15204.1|  unnamed protein product                                352   2e-116   Coffea canephora [robusta coffee]
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     349   2e-115   Sesamum indicum [beniseed]
emb|CAA67554.1|  protein kinase                                         347   3e-115   Trifolium repens [creeping white clover]
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    348   7e-115   
ref|XP_012088843.1|  PREDICTED: shaggy-related protein kinase alpha     347   2e-114   Jatropha curcas
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    347   2e-114   Camelina sativa [gold-of-pleasure]
gb|AFH00876.1|  glycogen synthase kinase-3                              347   2e-114   Glycine soja [wild soybean]
dbj|BAJ34573.1|  unnamed protein product                                347   3e-114   Eutrema halophilum
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             347   3e-114   Eutrema salsugineum [saltwater cress]
emb|CBI39647.3|  unnamed protein product                                345   3e-114   Vitis vinifera
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             347   3e-114   Capsella rubella
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             346   3e-114   Phaseolus vulgaris [French bean]
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    346   3e-114   Elaeis guineensis
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    346   4e-114   Glycine max [soybeans]
ref|NP_001242661.1|  glycogen synthase kinase-3                         346   4e-114   
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    347   4e-114   
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       345   4e-114   Cucumis sativus [cucumbers]
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             346   5e-114   
gb|ACQ91102.1|  glycogen synthase kinase                                346   5e-114   Glycine max [soybeans]
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    346   6e-114   Glycine max [soybeans]
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alpha     345   6e-114   Cucumis sativus [cucumbers]
ref|XP_003591238.1|  Glycogen synthase kinase                           345   8e-114   Medicago truncatula
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     345   8e-114   Camelina sativa [gold-of-pleasure]
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    345   8e-114   
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     345   8e-114   Vitis vinifera
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     345   1e-113   Brassica rapa
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    345   1e-113   Camelina sativa [gold-of-pleasure]
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     343   1e-113   Eucalyptus grandis [rose gum]
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    345   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63877.1|  hypothetical protein M569_10905                         345   2e-113   Genlisea aurea
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     344   2e-113   Eucalyptus grandis [rose gum]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     343   3e-113   Tarenaya hassleriana [spider flower]
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    344   3e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     344   3e-113   
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 344   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   343   4e-113   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95892.1|  Ser/Thr protein kinase                                 343   4e-113   Lotus japonicus
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    343   5e-113   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   342   6e-113   Glycine soja [wild soybean]
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    344   6e-113   Nelumbo nucifera [Indian lotus]
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    343   6e-113   Medicago sativa [alfalfa]
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     343   6e-113   Gossypium arboreum [tree cotton]
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    343   7e-113   Glycine max [soybeans]
gb|KJB45479.1|  hypothetical protein B456_007G308500                    343   8e-113   Gossypium raimondii
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             343   9e-113   
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             343   9e-113   Populus trichocarpa [western balsam poplar]
emb|CDY05202.1|  BnaC05g46010D                                          343   1e-112   
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     342   1e-112   Cucumis melo [Oriental melon]
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     342   1e-112   Populus euphratica
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             342   2e-112   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    341   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             342   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     342   2e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    342   2e-112   Camelina sativa [gold-of-pleasure]
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                342   2e-112   Erythranthe guttata [common monkey flower]
gb|EPS73818.1|  hypothetical protein M569_00937                         342   3e-112   Genlisea aurea
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    341   3e-112   Camelina sativa [gold-of-pleasure]
ref|NP_001242406.1|  uncharacterized protein LOC100788612               341   3e-112   
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    341   4e-112   Populus trichocarpa [western balsam poplar]
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    341   4e-112   Elaeis guineensis
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          341   4e-112   Ricinus communis
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             341   4e-112   Capsella rubella
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             341   4e-112   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     341   5e-112   Populus euphratica
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    341   5e-112   Nicotiana tomentosiformis
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    341   6e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             341   6e-112   Eutrema salsugineum [saltwater cress]
emb|CDY49981.1|  BnaC03g34380D                                          341   6e-112   Brassica napus [oilseed rape]
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     341   6e-112   Brassica rapa
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    340   6e-112   Setaria italica
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   340   6e-112   Arabidopsis thaliana [mouse-ear cress]
gb|ABY60447.1|  serine/threonine protein kinase                         340   7e-112   Adonis aestivalis var. palaestina
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    340   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    340   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   340   1e-111   
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    340   2e-111   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    339   2e-111   Sesamum indicum [beniseed]
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    339   2e-111   Phoenix dactylifera
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             339   2e-111   
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     338   3e-111   Brassica rapa
dbj|BAJ99594.1|  predicted protein                                      339   3e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     338   3e-111   
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    338   4e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             338   4e-111   
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    338   4e-111   Brassica rapa
emb|CBI37005.3|  unnamed protein product                                337   4e-111   Vitis vinifera
emb|CDY19757.1|  BnaA09g04100D                                          338   4e-111   Brassica napus [oilseed rape]
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    338   4e-111   Nicotiana sylvestris
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    338   5e-111   Tarenaya hassleriana [spider flower]
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                342   5e-111   
gb|ABK93098.1|  unknown                                                 338   6e-111   Populus trichocarpa [western balsam poplar]
emb|CDX87033.1|  BnaC09g03480D                                          338   6e-111   
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     338   7e-111   Prunus mume [ume]
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      338   8e-111   Fragaria vesca [alpine strawberry]
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             338   8e-111   Prunus persica
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    338   8e-111   Phoenix dactylifera
gb|ABG74911.1|  AtSK12-like protein                                     338   8e-111   Brassica napus [oilseed rape]
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     338   9e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     338   9e-111   
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     337   9e-111   Solanum lycopersicum
ref|XP_012082965.1|  PREDICTED: shaggy-related protein kinase alp...    337   1e-110   Jatropha curcas
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     337   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    337   1e-110   Vitis vinifera
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    337   1e-110   Vitis vinifera
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    337   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    337   1e-110   Prunus mume [ume]
gb|ABB55385.1|  Ser/Thr protein kinase-like                             337   1e-110   Solanum tuberosum [potatoes]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    337   1e-110   Populus euphratica
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    337   1e-110   Oryza brachyantha
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             337   2e-110   Prunus persica
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   337   2e-110   Solanum tuberosum [potatoes]
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    337   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          336   3e-110   Sorghum bicolor [broomcorn]
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     336   3e-110   Nicotiana tomentosiformis
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     336   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO86867.1|  hypothetical protein CISIN_1g015632mg                   332   4e-110   Citrus sinensis [apfelsine]
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    336   4e-110   Malus domestica [apple tree]
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   334   6e-110   Citrus sinensis [apfelsine]
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                335   7e-110   Erythranthe guttata [common monkey flower]
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     335   7e-110   Nicotiana sylvestris
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     335   8e-110   
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          335   9e-110   Zea mays [maize]
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    335   1e-109   
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             335   1e-109   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    335   1e-109   
ref|XP_008447666.1|  PREDICTED: glycogen synthase kinase-3 homolo...    327   1e-109   Cucumis melo [Oriental melon]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    335   1e-109   Citrus sinensis [apfelsine]
emb|CDX80585.1|  BnaC07g28590D                                          334   1e-109   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    335   1e-109   Nicotiana tabacum [American tobacco]
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    334   2e-109   Phoenix dactylifera
emb|CDY27737.1|  BnaA05g31460D                                          338   2e-109   Brassica napus [oilseed rape]
emb|CAA53181.1|  shaggy related kinase                                  334   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    334   2e-109   Populus euphratica
ref|XP_008812957.1|  PREDICTED: shaggy-related protein kinase alp...    332   2e-109   Phoenix dactylifera
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        334   2e-109   Gossypium arboreum [tree cotton]
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    334   2e-109   Oryza brachyantha
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    334   3e-109   Cucumis sativus [cucumbers]
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...    333   4e-109   Fragaria vesca subsp. vesca
gb|KJB49765.1|  hypothetical protein B456_008G136600                    333   4e-109   Gossypium raimondii
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     335   4e-109   Triticum urartu
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   333   5e-109   Glycine soja [wild soybean]
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 334   7e-109   Zea mays [maize]
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   332   9e-109   Citrus sinensis [apfelsine]
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     332   9e-109   Brachypodium distachyon [annual false brome]
ref|NP_001042602.1|  Os01g0252100                                       332   1e-108   
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    332   1e-108   
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     332   1e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    333   2e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CAA04265.1|  shaggy-like kinase alpha                               331   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     331   2e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    331   2e-108   Sesamum indicum [beniseed]
ref|XP_006841582.1|  PREDICTED: glycogen synthase kinase-3 homolo...    331   2e-108   Amborella trichopoda
ref|NP_001150105.1|  LOC100283734                                       331   3e-108   Zea mays [maize]
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    330   3e-108   Sesamum indicum [beniseed]
ref|XP_007031507.1|  Shaggy-like kinase 13 isoform 4                    329   3e-108   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    331   5e-108   Eucalyptus grandis [rose gum]
gb|KDO66104.1|  hypothetical protein CISIN_1g0141742mg                  322   6e-108   Citrus sinensis [apfelsine]
ref|NP_001288361.1|  uncharacterized protein LOC103641344               330   7e-108   Zea mays [maize]
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    330   9e-108   
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    329   2e-107   
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          329   2e-107   Sorghum bicolor [broomcorn]
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    329   2e-107   Setaria italica
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    329   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    328   3e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM77397.1|  GSK-like kinase                                         327   3e-107   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    328   5e-107   Brachypodium distachyon [annual false brome]
gb|ABG29422.1|  GSK-like kinase 1A                                      328   5e-107   Triticum aestivum [Canadian hard winter wheat]
emb|CDM82575.1|  unnamed protein product                                328   5e-107   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      328   5e-107   Morus notabilis
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3           327   9e-107   Triticum urartu
ref|NP_001054564.1|  Os05g0134000                                       327   1e-106   
dbj|BAF36565.1|  Shaggy-like kinase                                     327   1e-106   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    327   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABC94949.1|  GSK-like kinase                                         327   2e-106   Aegilops tauschii
emb|CDP17018.1|  unnamed protein product                                325   2e-106   Coffea canephora [robusta coffee]
gb|ABK24355.1|  unknown                                                 325   2e-106   Picea sitchensis
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    327   3e-106   Citrus sinensis [apfelsine]
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    325   3e-106   Nelumbo nucifera [Indian lotus]
gb|AAY98510.1|  glycogen synthase kinase                                326   3e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    326   4e-106   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    326   4e-106   Nelumbo nucifera [Indian lotus]
ref|XP_011622016.1|  PREDICTED: shaggy-related protein kinase eps...    326   4e-106   Amborella trichopoda
gb|ABC94948.1|  GSK-like kinase                                         325   5e-106   Aegilops speltoides
emb|CDP02094.1|  unnamed protein product                                325   5e-106   Coffea canephora [robusta coffee]
gb|ABG29426.1|  GSK-like kinase 1                                       325   7e-106   Aegilops speltoides
gb|ABG29424.1|  GSK-like kinase 1D                                      325   7e-106   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004141099.2|  PREDICTED: shaggy-related protein kinase eps...    325   8e-106   Cucumis sativus [cucumbers]
gb|EAY96448.1|  hypothetical protein OsI_18343                          325   8e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    324   8e-106   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    325   8e-106   Glycine max [soybeans]
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    325   1e-105   Vitis vinifera
gb|EMT00762.1|  Glycogen synthase kinase-3-MsK-3-like protein           324   1e-105   
gb|AFK38277.1|  unknown                                                 324   2e-105   Medicago truncatula
ref|XP_003626019.1|  Protein kinase, putative                           324   2e-105   
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    324   2e-105   Cucumis melo [Oriental melon]
gb|ABG29423.1|  GSK-like kinase 1B                                      324   2e-105   Triticum aestivum [Canadian hard winter wheat]
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    324   2e-105   Medicago sativa [alfalfa]
emb|CAA48472.1|  protein kinase                                         324   2e-105   Medicago sativa [alfalfa]
ref|XP_006446533.1|  hypothetical protein CICLE_v10015323mg             323   3e-105   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             324   4e-105   Citrus clementina [clementine]
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             323   5e-105   Eutrema salsugineum [saltwater cress]
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    323   6e-105   
ref|XP_004967591.1|  PREDICTED: shaggy-related protein kinase alp...    322   7e-105   Setaria italica
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    322   8e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    322   1e-104   Tarenaya hassleriana [spider flower]
gb|ABC94947.1|  GSK-like kinase                                         322   1e-104   Triticum monococcum [einkorn wheat]
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             322   1e-104   Phaseolus vulgaris [French bean]
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    322   1e-104   Camelina sativa [gold-of-pleasure]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      322   1e-104   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68300.1|  hypothetical protein M569_06467                         322   1e-104   Genlisea aurea
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             322   1e-104   
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    322   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    322   2e-104   Prunus mume [ume]
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    321   3e-104   
dbj|BAG95540.1|  unnamed protein product                                317   4e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             320   4e-104   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    320   4e-104   Pyrus x bretschneideri [bai li]
ref|NP_001042804.1|  Os01g0296100                                       320   6e-104   
emb|CDX78587.1|  BnaA03g04990D                                          320   8e-104   
emb|CDX70574.1|  BnaC03g06580D                                          320   9e-104   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    320   9e-104   Brassica rapa
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   325   1e-103   Glycine soja [wild soybean]
ref|XP_002873682.1|  kinase family protein                              320   1e-103   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             321   1e-103   Selaginella moellendorffii
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    320   1e-103   Selaginella moellendorffii
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    318   1e-103   Glycine max [soybeans]
ref|XP_003591342.1|  Glycogen synthase kinase-3-like protein            315   1e-103   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               318   2e-103   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   318   2e-103   Glycine soja [wild soybean]
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    319   2e-103   Glycine max [soybeans]
ref|XP_006644095.1|  PREDICTED: glycogen synthase kinase-3 homolo...    319   2e-103   Oryza brachyantha
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            318   2e-103   
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            317   2e-103   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            319   2e-103   
gb|AES61591.2|  glycogen synthase kinase                                319   2e-103   Medicago truncatula
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    318   3e-103   Medicago sativa [alfalfa]
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    318   5e-103   Solanum tuberosum [potatoes]
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    317   6e-103   Solanum tuberosum [potatoes]
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    317   1e-102   Fragaria vesca subsp. vesca
ref|XP_001763270.1|  predicted protein                                  317   1e-102   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         317   2e-102   Physcomitrella patens
gb|AFN42826.1|  GSK3-like protein                                       316   2e-102   Marsilea vestita
emb|CAB87631.1|  protein kinase MSK-3-like                              315   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    315   6e-102   Nicotiana sylvestris
gb|AAQ23107.1|  shaggy-related protein kinase 2                         315   7e-102   Physcomitrella patens
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    315   7e-102   Solanum lycopersicum
ref|XP_001763265.1|  predicted protein                                  315   9e-102   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    314   1e-101   Solanum lycopersicum
gb|AAQ23110.1|  shaggy-related protein kinase 5                         312   2e-101   Physcomitrella patens
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    314   2e-101   Solanum tuberosum [potatoes]
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    313   2e-101   Eucalyptus grandis [rose gum]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    313   2e-101   Solanum lycopersicum
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    313   2e-101   Nicotiana tomentosiformis
ref|XP_001762052.1|  predicted protein                                  313   3e-101   
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...    313   3e-101   Brachypodium distachyon [annual false brome]
gb|ABK24513.1|  unknown                                                 313   4e-101   Picea sitchensis
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    314   4e-101   
emb|CAA58594.1|  Petunia Shaggy kinase 4                                313   4e-101   Petunia x hybrida [garden petunia]
gb|AAQ23109.1|  shaggy-related protein kinase 4                         313   4e-101   Physcomitrella patens
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    313   4e-101   Cicer arietinum [garbanzo]
emb|CAA10288.1|  protein kinase                                         309   5e-101   Cicer arietinum [garbanzo]
gb|AAQ23108.1|  shaggy-related protein kinase 3                         313   5e-101   Physcomitrella patens
ref|XP_001765207.1|  predicted protein                                  313   5e-101   
ref|XP_008644282.1|  PREDICTED: uncharacterized protein LOC542518...    311   2e-100   Zea mays [maize]
ref|XP_008644283.1|  PREDICTED: uncharacterized protein LOC542518...    310   2e-100   Zea mays [maize]
ref|XP_002463546.1|  hypothetical protein SORBIDRAFT_01g001760          311   3e-100   Sorghum bicolor [broomcorn]
ref|XP_009396814.1|  PREDICTED: shaggy-related protein kinase kap...    311   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    310   3e-100   Sesamum indicum [beniseed]
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                310   4e-100   Erythranthe guttata [common monkey flower]
gb|KGN58535.1|  hypothetical protein Csa_3G664590                       309   5e-100   Cucumis sativus [cucumbers]
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                310   5e-100   Erythranthe guttata [common monkey flower]
ref|XP_008644280.1|  PREDICTED: uncharacterized protein LOC542518...    311   5e-100   Zea mays [maize]
ref|XP_008347928.1|  PREDICTED: shaggy-related protein kinase kap...    303   1e-99    
ref|XP_006650875.1|  PREDICTED: shaggy-related protein kinase kap...    310   1e-99    Oryza brachyantha
ref|XP_010030186.1|  PREDICTED: shaggy-related protein kinase kappa     309   2e-99    Eucalyptus grandis [rose gum]
gb|KDO39708.1|  hypothetical protein CISIN_1g014595mg                   308   2e-99    Citrus sinensis [apfelsine]
ref|XP_006389513.1|  hypothetical protein POPTR_0022s00490g             303   2e-99    
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                   308   2e-99    Citrus sinensis [apfelsine]
gb|KDO39711.1|  hypothetical protein CISIN_1g014595mg                   307   3e-99    Citrus sinensis [apfelsine]
ref|NP_001051854.1|  Os03g0841800                                       309   3e-99    
ref|XP_001781582.1|  predicted protein                                  308   3e-99    
ref|XP_011628612.1|  PREDICTED: shaggy-related protein kinase kappa     308   3e-99    
ref|XP_001781586.1|  predicted protein                                  308   4e-99    
gb|KJB16215.1|  hypothetical protein B456_002G218100                    308   4e-99    
ref|NP_001105536.1|  uncharacterized protein LOC542518                  308   4e-99    
gb|ACN34914.1|  unknown                                                 308   4e-99    
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg             308   5e-99    
ref|XP_009353785.1|  PREDICTED: shaggy-related protein kinase kap...    308   5e-99    
gb|EYU33277.1|  hypothetical protein MIMGU_mgv1a007009mg                308   5e-99    
ref|XP_004981107.1|  PREDICTED: shaggy-related protein kinase del...    308   5e-99    
ref|XP_011028359.1|  PREDICTED: shaggy-related protein kinase kappa     308   6e-99    
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            307   8e-99    
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    307   9e-99    
ref|XP_002886726.1|  hypothetical protein ARALYDRAFT_475455             307   1e-98    
gb|ERN20048.1|  hypothetical protein AMTR_s00071p00186380               308   1e-98    
gb|ADE76936.1|  unknown                                                 306   1e-98    
ref|NP_176096.1|  shaggy-related protein kinase delta                   306   1e-98    
emb|CDO97625.1|  unnamed protein product                                301   2e-98    
ref|XP_002263398.1|  PREDICTED: shaggy-related protein kinase kappa     306   2e-98    
ref|XP_010470311.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    306   2e-98    
ref|NP_001240918.1|  uncharacterized protein LOC100820098               306   2e-98    
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    308   2e-98    
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     308   2e-98    
ref|XP_002526439.1|  Glycogen synthase kinase-3 beta, putative          300   2e-98    
ref|XP_010414797.1|  PREDICTED: shaggy-related protein kinase del...    306   2e-98    
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa     306   2e-98    
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kappa     306   2e-98    
emb|CDY18828.1|  BnaAnng02930D                                          306   2e-98    
ref|XP_006302308.1|  hypothetical protein CARUB_v10020358mg             306   2e-98    
ref|XP_011092295.1|  PREDICTED: shaggy-related protein kinase del...    305   2e-98    
ref|XP_004485442.1|  PREDICTED: shaggy-related protein kinase kap...    307   2e-98    
ref|XP_006349315.1|  PREDICTED: shaggy-related protein kinase kap...    306   3e-98    
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    307   3e-98    
gb|AAW80932.1|  putative protein kinase                                 296   3e-98    
ref|NP_001185256.1|  shaggy-related protein kinase delta                306   3e-98    
ref|XP_003592909.1|  Glycogen synthase kinase-3-like protein            306   3e-98    
gb|EMT16766.1|  Shaggy-related protein kinase delta                     305   4e-98    
ref|XP_011092292.1|  PREDICTED: shaggy-related protein kinase kap...    306   4e-98    
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    307   4e-98    
gb|AAN63591.1|AF432225_1  GSK-3-like protein MsK4                       306   4e-98    
ref|XP_008339410.1|  PREDICTED: shaggy-related protein kinase kappa     305   4e-98    
ref|XP_006385048.1|  hypothetical protein POPTR_0004s23430g             305   4e-98    
ref|XP_010511361.1|  PREDICTED: shaggy-related protein kinase del...    305   5e-98    
ref|XP_010475837.1|  PREDICTED: shaggy-related protein kinase kap...    305   7e-98    
ref|XP_010511360.1|  PREDICTED: shaggy-related protein kinase del...    305   8e-98    
emb|CDY65729.1|  BnaCnng48480D                                          305   9e-98    
ref|XP_009110795.1|  PREDICTED: shaggy-related protein kinase kap...    305   9e-98    
emb|CDY31060.1|  BnaA08g26100D                                          305   1e-97    
ref|XP_010490391.1|  PREDICTED: shaggy-related protein kinase kap...    304   1e-97    
ref|NP_001241073.1|  uncharacterized protein LOC100799387               304   1e-97    
ref|XP_006307622.1|  hypothetical protein CARUB_v10009250mg             304   2e-97    
ref|XP_010544097.1|  PREDICTED: shaggy-related protein kinase kappa     304   2e-97    
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    306   2e-97    
ref|XP_010245515.1|  PREDICTED: shaggy-related protein kinase kap...    303   2e-97    
ref|XP_010458292.1|  PREDICTED: shaggy-related protein kinase kappa     304   2e-97    
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...    303   2e-97    
ref|NP_172455.1|  Shaggy-related protein kinase kappa                   303   2e-97    
ref|XP_006392357.1|  hypothetical protein EUTSA_v10023486mg             303   3e-97    
ref|XP_010910153.1|  PREDICTED: shaggy-related protein kinase kap...    303   3e-97    
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    305   3e-97    
gb|AAB60754.1|  Identical to A. thaliana AtK-1 (gb|X79279)              304   3e-97    
gb|KJB47877.1|  hypothetical protein B456_008G045800                    303   3e-97    
ref|XP_006417527.1|  hypothetical protein EUTSA_v10007729mg             303   3e-97    
ref|XP_004230443.1|  PREDICTED: shaggy-related protein kinase kappa     303   3e-97    
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    303   3e-97    
gb|KHF99017.1|  Shaggy-related protein kinase delta                     305   3e-97    
ref|XP_009598595.1|  PREDICTED: shaggy-related protein kinase kappa     303   4e-97    
gb|ERM98330.1|  hypothetical protein AMTR_s00170p00028260               300   5e-97    
ref|XP_008802921.1|  PREDICTED: shaggy-related protein kinase kap...    303   6e-97    
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    304   6e-97    
ref|XP_002892530.1|  hypothetical protein ARALYDRAFT_471093             302   7e-97    
gb|ABR17316.1|  unknown                                                 304   7e-97    
ref|XP_008802919.1|  PREDICTED: shaggy-related protein kinase kap...    303   8e-97    
ref|XP_007148571.1|  hypothetical protein PHAVU_006G219700g             302   9e-97    
ref|XP_006833052.2|  PREDICTED: shaggy-related protein kinase zeta      300   1e-96    
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    303   1e-96    
ref|XP_009148291.1|  PREDICTED: shaggy-related protein kinase kappa     301   1e-96    
dbj|BAJ89558.1|  predicted protein                                      302   1e-96    
ref|XP_008802918.1|  PREDICTED: shaggy-related protein kinase kap...    303   1e-96    
gb|AAT81407.1|  shaggy-related protein kinase 6                         303   1e-96    
ref|XP_003562606.1|  PREDICTED: shaggy-related protein kinase kappa     301   1e-96    
ref|XP_008802915.1|  PREDICTED: shaggy-related protein kinase kap...    303   1e-96    
gb|EMS50941.1|  Shaggy-related protein kinase kappa                     300   1e-96    
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    303   1e-96    
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          303   2e-96    
ref|XP_010682019.1|  PREDICTED: shaggy-related protein kinase kap...    301   2e-96    
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg             301   2e-96    
ref|XP_010682020.1|  PREDICTED: shaggy-related protein kinase kap...    301   2e-96    
ref|XP_003626020.1|  Protein kinase, putative                           302   2e-96    
emb|CAA68872.1|  shaggy-like kinase kappa                               300   2e-96    
ref|XP_008795406.1|  PREDICTED: shaggy-related protein kinase eps...    295   3e-96    
ref|XP_009775075.1|  PREDICTED: shaggy-related protein kinase kappa     301   3e-96    
emb|CAA55866.1|  K-1                                                    301   3e-96    
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    302   4e-96    
gb|ABR16348.1|  unknown                                                 300   4e-96    
gb|AFW79696.1|  putative glycogen synthase kinase family protein        299   7e-96    
ref|XP_010556680.1|  PREDICTED: shaggy-related protein kinase alp...    298   7e-96    
ref|XP_006643888.1|  PREDICTED: shaggy-related protein kinase eta...    297   9e-96    
ref|XP_010556679.1|  PREDICTED: shaggy-related protein kinase alp...    298   1e-95    
gb|KEH23337.1|  shaggy-like kinase                                      297   1e-95    
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    301   1e-95    
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             303   1e-95    
ref|XP_003623822.1|  Shaggy-related protein kinase                      301   1e-95    
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             300   2e-95    
ref|XP_009365289.1|  PREDICTED: shaggy-related protein kinase zet...    297   2e-95    
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    300   2e-95    
ref|XP_006654148.1|  PREDICTED: shaggy-related protein kinase zet...    296   2e-95    
ref|XP_010924595.1|  PREDICTED: shaggy-related protein kinase eta...    298   2e-95    
ref|XP_012083467.1|  PREDICTED: shaggy-related protein kinase the...    300   3e-95    
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    297   3e-95    
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             300   3e-95    
ref|XP_006375322.1|  shaggy-related protein kinase theta                298   3e-95    
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     300   4e-95    
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    298   5e-95    
ref|XP_006598764.1|  PREDICTED: uncharacterized protein LOC100820...    298   5e-95    
ref|XP_006647108.1|  PREDICTED: shaggy-related protein kinase zet...    296   6e-95    
ref|XP_009124961.1|  PREDICTED: shaggy-related protein kinase gam...    297   6e-95    
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            301   7e-95    
gb|EEE62704.1|  hypothetical protein OsJ_17507                          296   7e-95    
gb|ACN27271.1|  unknown                                                 289   8e-95    
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          296   9e-95    
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             298   1e-94    
ref|NP_191981.1|  Shaggy-related protein kinase theta                   298   1e-94    
ref|NP_001042341.1|  Os01g0205700                                       290   1e-94    
gb|EEC72801.1|  hypothetical protein OsI_06492                          295   1e-94    
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kappa     296   1e-94    
ref|NP_001054901.1|  Os05g0207500                                       296   1e-94    
ref|XP_009588662.1|  PREDICTED: shaggy-related protein kinase eta...    295   2e-94    
gb|EMS65432.1|  Shaggy-related protein kinase iota                      296   2e-94    
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             298   2e-94    
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             297   2e-94    
ref|XP_003596713.1|  Shaggy-related protein kinase                      291   2e-94    
gb|AGJ93558.1|  SHAGGY-like kinase                                      295   3e-94    
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    297   3e-94    
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              315   3e-94    
emb|CDY51144.1|  BnaA09g51790D                                          297   3e-94    
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    297   3e-94    
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    297   4e-94    
gb|AES66964.2|  shaggy-like kinase dzeta                                294   4e-94    
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    297   4e-94    
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     297   5e-94    
gb|EMT26120.1|  Shaggy-related protein kinase iota                      295   5e-94    
ref|XP_011466967.1|  PREDICTED: shaggy-related protein kinase zet...    293   5e-94    
emb|CDY07202.1|  BnaCnng02170D                                          296   5e-94    
emb|CDX74346.1|  BnaA03g27010D                                          296   5e-94    
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             297   5e-94    
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    295   5e-94    
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             295   5e-94    
ref|XP_009394192.1|  PREDICTED: shaggy-related protein kinase eta...    295   5e-94    
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     296   6e-94    
dbj|BAJ93751.1|  predicted protein                                      296   6e-94    
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    296   6e-94    
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    296   6e-94    
ref|XP_008789340.1|  PREDICTED: shaggy-related protein kinase eta       294   6e-94    
gb|ACG34459.1|  shaggy-related protein kinase eta                       294   7e-94    
ref|XP_011466966.1|  PREDICTED: shaggy-related protein kinase zet...    293   7e-94    
ref|XP_004951349.1|  PREDICTED: shaggy-related protein kinase eta...    295   7e-94    
emb|CAA11860.1|  shaggy-like kinase 91                                  296   7e-94    
ref|XP_009378930.1|  PREDICTED: shaggy-related protein kinase zet...    293   7e-94    
ref|NP_001065093.1|  Os10g0521700                                       296   8e-94    
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     296   9e-94    
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    296   9e-94    
gb|AES66963.2|  shaggy-like kinase dzeta                                295   9e-94    
ref|XP_003596712.1|  Shaggy-related protein kinase                      294   1e-93    
gb|EMS48919.1|  Shaggy-related protein kinase eta                       292   1e-93    
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           295   1e-93    
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     295   1e-93    
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   292   1e-93    
ref|XP_010529206.1|  PREDICTED: shaggy-related protein kinase eta...    292   1e-93    
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    293   2e-93    
gb|AGK41246.1|  SHAGGY-like kinase                                      293   2e-93    
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    292   2e-93    
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase eta...    293   2e-93    
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          295   2e-93    
ref|XP_008343095.1|  PREDICTED: shaggy-related protein kinase zet...    292   2e-93    
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     293   2e-93    
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   292   2e-93    
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     295   2e-93    
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    295   2e-93    
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    293   2e-93    
gb|KHN27286.1|  Shaggy-related protein kinase theta                     295   2e-93    
ref|NP_001149983.1|  shaggy-related protein kinase eta                  293   2e-93    
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    295   2e-93    
ref|XP_009770234.1|  PREDICTED: shaggy-related protein kinase eta...    292   2e-93    
gb|ACG33866.1|  shaggy-related protein kinase eta                       293   3e-93    
ref|XP_010052816.1|  PREDICTED: shaggy-related protein kinase eta       293   3e-93    
ref|NP_001149135.1|  shaggy-related protein kinase eta                  292   3e-93    
dbj|BAA92966.1|  putative shaggy-like kinase dzeta                      293   3e-93    
emb|CDM82043.1|  unnamed protein product                                292   3e-93    
ref|XP_004487575.1|  PREDICTED: shaggy-related protein kinase zet...    293   3e-93    
gb|EMT19129.1|  Shaggy-related protein kinase iota                      291   3e-93    
ref|XP_010920339.1|  PREDICTED: shaggy-related protein kinase eta       292   4e-93    
ref|XP_008672878.1|  PREDICTED: shaggy-related protein kinase eta...    293   4e-93    
gb|KDO77892.1|  hypothetical protein CISIN_1g016950mg                   288   4e-93    
ref|XP_004968576.1|  PREDICTED: shaggy-related protein kinase iot...    292   4e-93    
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    294   4e-93    
emb|CDX91895.1|  BnaC03g31970D                                          294   4e-93    
emb|CAA72330.1|  shaggy-like kinase                                     288   4e-93    
ref|XP_008228935.1|  PREDICTED: shaggy-related protein kinase zet...    291   4e-93    
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    293   4e-93    
gb|EEC70138.1|  hypothetical protein OsI_00828                          292   4e-93    
ref|XP_002453590.1|  hypothetical protein SORBIDRAFT_04g008580          293   4e-93    
emb|CAA64409.1|  shaggy-like kinase etha                                291   5e-93    
ref|XP_009394828.1|  PREDICTED: shaggy-related protein kinase eta       292   5e-93    
emb|CAA72291.1|  serine/threonine protein kinase                        285   5e-93    
ref|XP_012066688.1|  PREDICTED: shaggy-related protein kinase kappa     293   5e-93    
gb|KDO77891.1|  hypothetical protein CISIN_1g016950mg                   290   5e-93    
emb|CDP08875.1|  unnamed protein product                                294   5e-93    
gb|AGJ93554.1|  SHAGGY-like kinase                                      291   6e-93    
gb|AGJ93556.1|  SHAGGY-like kinase                                      292   6e-93    
gb|ABR68632.1|  RIM11-like protein                                      292   6e-93    
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             292   6e-93    
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   292   6e-93    
ref|XP_004965568.1|  PREDICTED: shaggy-related protein kinase zet...    291   7e-93    
gb|AGK41245.1|  SHAGGY-like kinase                                      291   7e-93    
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase theta     293   8e-93    
gb|AFW71144.1|  putative glycogen synthase kinase family protein        291   8e-93    
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    291   8e-93    
gb|KDO77890.1|  hypothetical protein CISIN_1g016950mg                   290   8e-93    
ref|XP_006449528.1|  hypothetical protein CICLE_v10015608mg             290   8e-93    



>emb|CDP15204.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGRF+PPLFNFKPHELKGVP ET++KL+PEHARKQCPFL L
Sbjct  356  FFDELRDPSSRLPNGRFLPPLFNFKPHELKGVPVETLVKLIPEHARKQCPFLAL  409



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP ET++KL+PEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPAETLVKLIPEHARKQCPVLGL  409



>emb|CAA67554.1| protein kinase [Trifolium repens]
Length=341

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  168  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  227

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHP
Sbjct  228  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHP  287

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP GRF+PPLFNFKPHELKG+P ET++KLVPEHARKQCPFLGL
Sbjct  288  FFDELRDPNARLPTGRFLPPLFNFKPHELKGIPVETLVKLVPEHARKQCPFLGL  341



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   348 bits (893),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP GRF+PPLFNFKPHELKGVP ET++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLVKLVPEHARKQCPFLGL  410



>ref|XP_012088843.1| PREDICTED: shaggy-related protein kinase alpha [Jatropha curcas]
 gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP
Sbjct  295  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGV  ET+ KL+PEHARKQCPFLGL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVAAETLAKLIPEHARKQCPFLGL  408



>ref|XP_010486058.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=408

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  355  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  408



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>dbj|BAJ34573.1| unnamed protein product [Thellungiella halophila]
Length=409

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>emb|CBI39647.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  208  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  267

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A+DALTH 
Sbjct  268  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAMDALTHS  327

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD S RLPNGRF+PPLFNFKPHELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  328  FFDELRDSSTRLPNGRFLPPLFNFKPHELKGVPVEILVKLIPEHARKQCPFLGL  381



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPMEMVAKLVPEHARKQCPWLGL  409



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_010938176.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGRF+PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPSTRLPNGRFLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|NP_001242661.1| glycogen synthase kinase-3 [Glycine max]
 gb|ACU18223.1| unknown [Glycine max]
Length=410

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  261  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  320

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHP
Sbjct  321  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHP  380

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP GRF+PPLFNFKPHELKGVP ET++KLVPEHARKQCPFLGL
Sbjct  381  FFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLVKLVPEHARKQCPFLGL  434



>gb|KGN65982.1| hypothetical protein Csa_1G560660 [Cucumis sativus]
Length=387

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  214  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  273

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH 
Sbjct  274  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHQ  333

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  334  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  387



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   346 bits (887),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score =   346 bits (887),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  FFDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  353  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILLKLIPEHARKQCPFLGL  406



>ref|XP_004135570.1| PREDICTED: shaggy-related protein kinase alpha [Cucumis sativus]
Length=409

 Score =   345 bits (886),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH 
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHQ  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_003591238.1| Glycogen synthase kinase [Medicago truncatula]
 gb|AES61489.1| glycogen synthase kinase [Medicago truncatula]
 gb|AFK45213.1| unknown [Medicago truncatula]
Length=411

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC ALD LTHP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRCQALDCLTHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP GRF+PPLFNFKPHELKGVP ET+MKLVPEHARKQCPFLGL
Sbjct  358  FFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMKLVPEHARKQCPFLGL  411



>ref|XP_010464137.1| PREDICTED: shaggy-related protein kinase gamma [Camelina sativa]
Length=410

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDTLVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPSTRLPNGRFLPPLFNFKPHELKGVPMEILSKLIPEHARKQCAFLGL  409



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A+DALTH 
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAMDALTHS  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD S RLPNGRF+PPLFNFKPHELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDSSTRLPNGRFLPPLFNFKPHELKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_009134851.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + +LVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVARLVPEHARKQCPWLGL  410



>ref|XP_010432712.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=407

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  234  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  293

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HP
Sbjct  294  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDTLIHP  353

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  354  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  407



>gb|KCW84976.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=370

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  197  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  256

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP
Sbjct  257  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  316

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDPS RLPNGRF+PPLFNFK HELK +P E  +KLVPEHARKQCPFLGL
Sbjct  317  FFNELRDPSTRLPNGRFLPPLFNFKAHELKNIPAEVQLKLVPEHARKQCPFLGL  370



>ref|XP_009386339.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEF FPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFNFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGRF+PPLFNFKPHELKGVP ET+ KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPSTRLPNGRFMPPLFNFKPHELKGVPMETLTKLIPEHARKQCAFLGL  409



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDMWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDP++RLPNGRFVPPLFNFK HELKG+PTE I+KL+PEHARKQCPFLGL
Sbjct  356  FFNELRDPNVRLPNGRFVPPLFNFKQHELKGIPTEFIVKLIPEHARKQCPFLGL  409



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  240  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  299

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP
Sbjct  300  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  359

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDPS RLPNGRF+PPLFNFK HELK +P E  +KLVPEHARKQCPFLGL
Sbjct  360  FFNELRDPSTRLPNGRFLPPLFNFKAHELKNIPAEVQLKLVPEHARKQCPFLGL  413



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  226  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  285

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HP
Sbjct  286  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLVHP  345

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVP+HARKQCP+LGL
Sbjct  346  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPAEMVAKLVPDHARKQCPWLGL  399



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFMPPLFNFKPHELKGVPKEMLLKLIPEHARKQCAFLGL  409



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR++PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+L L
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLSL  409



>ref|NP_187235.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 ref|NP_850520.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 sp|P43289.1|KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma; AltName: Full=ASK-gamma 
[Arabidopsis thaliana]
 gb|AAF26086.1|AC012393_12 shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 emb|CAA53180.1| ASK-gamma (Arabidopsis shaggy-related kinase) [Arabidopsis thaliana]
 emb|CAA73247.1| shaggy-like kinase gamma [Arabidopsis thaliana]
 gb|AAL32791.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 gb|AAM13346.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 dbj|BAE99095.1| shaggy related protein kinase [Arabidopsis thaliana]
 dbj|BAH19402.1| AT3G05840 [Arabidopsis thaliana]
 gb|AEE74303.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 gb|AEE74304.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
Length=409

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+L L
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLSL  409



>dbj|BAD95892.1| Ser/Thr protein kinase [Lotus japonicus]
Length=412

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+PS RLP GRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  359  FFDELREPSTRLPTGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  412



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD LTHP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLTHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  353  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  406



>gb|KHN26183.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=370

 Score =   342 bits (877),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  197  SRYYRAPELIFGATEYTSAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  256

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A DALTHP
Sbjct  257  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAFDALTHP  316

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP+E ++KLVPEHARKQCPFLG
Sbjct  317  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPSEILVKLVPEHARKQCPFLG  369



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  261  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  320

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  321  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  380

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  381  FFDELRDPNTRLPNGRFMPPLFNFKPHELKGVPKEMLLKLIPEHARKQCAFLGL  434



>sp|P51137.1|MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1 [Medicago 
sativa]
 emb|CAA48474.1| protein kinase [Medicago sativa]
Length=411

 Score =   343 bits (880),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGE GVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGERGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC ALD LTHP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRCQALDCLTHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP GRF+PPLFNFKPHELKGVP ET+MKLVPEHARKQCPFLGL
Sbjct  358  FFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMKLVPEHARKQCPFLGL  411



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   343 bits (880),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAE+LLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  234  SRYYRAPELIFGATEYTTAIDIWSAGCVLAEMLLGQPLFPGESGVDQLVEIIKVLGTPTR  293

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRCSALDAL HP
Sbjct  294  EEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCSALDALIHP  353

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQCP LGL
Sbjct  354  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPEEITAKLIPEHARKQCPSLGL  407



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  253  SRYYRAPELIFGATEYTSAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  312

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A DALTHP
Sbjct  313  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAFDALTHP  372

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP+E ++KLVPEHARKQCPFLG
Sbjct  373  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPSEILVKLVPEHARKQCPFLG  425



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score =   343 bits (879),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAE+LLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  234  SRYYRAPELIFGATEYTTAIDIWSAGCVLAEMLLGQPLFPGESGVDQLVEIIKVLGTPTR  293

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRCSALDAL HP
Sbjct  294  EEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCSALDALIHP  353

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQCP LGL
Sbjct  354  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPEEITAKLIPEHARKQCPSLGL  407



>ref|XP_006382289.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60086.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
Length=405

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  232  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  291

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  292  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  351

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPLFNFK HELKGV  ET++KL+PEHARKQCPFLGL
Sbjct  352  FFDELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLIPEHARKQCPFLGL  405



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPLFNFK HELKGV  ET++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLIPEHARKQCPFLGL  409



>emb|CDY05202.1| BnaC05g46010D [Brassica napus]
Length=410

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFFPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|XP_008450520.1| PREDICTED: shaggy-related protein kinase NtK-1 [Cucumis melo]
Length=409

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTH 
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHQ  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDPNTRLPNGRILPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPLFNFK HELKG+  ET++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDQNTRLPNGRFLPPLFNFKSHELKGISVETLVKLIPEHARKQCPFLGL  409



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  234  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  293

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  294  EEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  353

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HEL GVP E + KL+PEHARKQCPFLGL
Sbjct  354  FFDELRDPNARLPNGRFLPPLFNFKSHELNGVPVEILAKLIPEHARKQCPFLGL  407



>ref|XP_010493929.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Camelina 
sativa]
Length=370

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  197  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  256

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  257  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  316

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  317  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  370



>ref|XP_006408022.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49475.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=410

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPH ELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHAELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKP+ELKGVP E ++KLVPEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPNELKGVPVEMLLKLVPEHARKQCAFLGL  409



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  359  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  412



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  230  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  289

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSA+D L H 
Sbjct  290  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSAMDVLVHS  349

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+  LPNGRF+PPLFNFKPHELK VP ET++KL+PEHARKQCPFLGL
Sbjct  350  FFDELRDPNAHLPNGRFLPPLFNFKPHELKDVPMETLVKLIPEHARKQCPFLGL  403



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FF+ELRDP++RLPNGRF+PPLFNFKPHELKGVP E  MKL+PEHARKQCPFLG
Sbjct  356  FFNELRDPNVRLPNGRFIPPLFNFKPHELKGVPLELSMKLIPEHARKQCPFLG  408



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  359  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  412



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRA ELIFGATEYTTAID+WS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRASELIFGATEYTTAIDIWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD LTHP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLTHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  353  FFDELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  406



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPLFNFK HELKGV  E ++KLVPEHARKQC FLGL
Sbjct  356  FFDELRDQNTRLPNGRFLPPLFNFKSHELKGVSVEMLVKLVPEHARKQCAFLGL  409



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLL Q LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLQQPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR++PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNF+PHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFRPHELKGVPVEVLVKLIPEHARKQCAFLGL  409



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALMHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPLFNFK HELKGV  ET++KLVPEHARKQC FLGL
Sbjct  356  FFDELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLVPEHARKQCAFLGL  409



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELK V  ET++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKNVHAETLVKLVPEHARKQCPSLGL  409



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQCP+LGL
Sbjct  359  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLIPEHARKQCPWLGL  412



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVGKLVPEHARKQCPWLGL  409



>emb|CDY49981.1| BnaC03g34380D [Brassica napus]
 emb|CDX74129.1| BnaA03g29180D [Brassica napus]
Length=411

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 167/175 (95%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPH ELKGVP E + +LVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFLPPLFNFKPHAELKGVPVEMVARLVPEHARKQCPWLGL  411



>ref|XP_009147201.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF PPLFNFKPHELKGVP E   KLVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFFPPLFNFKPHELKGVPVEMAAKLVPEHARKQCPWLGL  410



>ref|XP_004967857.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=408

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHA+KQCP++GL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLIPEHAKKQCPYVGL  408



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  232  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  291

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  292  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  351

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  352  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQCPWLGL  405



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   340 bits (873),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPTTRLPNGRFLPPLFNFKPHELKGVPVEILGKLIPEHARKQCAFLGL  409



>ref|XP_009382471.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382472.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=409

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD   RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  356  FFDELRDSDTRLPNGRFLPPLFNFKPHELKGVPMEIVAKLIPEHARKQCAFLGL  409



>ref|XP_009384446.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384447.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384448.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGA EYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGAIEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIK HPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKGHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKP+ELKGVP+E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPTTRLPNGRFLPPLFNFKPYELKGVPSEIVVKLIPEHARKQCAFLGL  409



>ref|NP_001148880.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 ref|XP_008654975.1| PREDICTED: glycogen synthase kinase-3 MsK-3 isoform X1 [Zea mays]
 gb|ACG33274.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 gb|AFW79697.1| putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP++ + KL+PEHA+KQC ++GL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPSDIVAKLIPEHAKKQCSYVGL  408



>ref|XP_009382470.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  248  SRYYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  307

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  308  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  367

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD   RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  368  FFDELRDSDTRLPNGRFLPPLFNFKPHELKGVPMEIVAKLIPEHARKQCAFLGL  421



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP++RLPNGRFVPPLFNFKP+E+KGVP E + KL+PEHARKQC FLG
Sbjct  356  FFDELRDPNVRLPNGRFVPPLFNFKPNEIKGVPAELLGKLIPEHARKQCAFLG  408



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR++PPLFNFKPHELKGVP E ++KL+PEH RKQC FLG 
Sbjct  356  FFDELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHVRKQCAFLGF  409



>ref|XP_007051226.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 ref|XP_007051227.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95383.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95384.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=409

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +A++AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTAIEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + I+KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDIIVKLIPEHARKQCAFLGL  409



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  230  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  289

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  290  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  349

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  350  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  403



>dbj|BAJ99594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LR SALDAL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPHLRSSALDALIHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  MKLVPEHAR QCPFLGL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAMKLVPEHARSQCPFLGL  408



>ref|XP_010941497.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLR +ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRSTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMEMVAKLIPEHARKQCAFLGL  409



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNARLPNGRILPPLFNFKPHELKGVPVEMLVKLIPEHARKQCAFLGL  409



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQT-LFPGESGVDQLVEIIKVLGTPT  623
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ  LFPGESGVDQLVEIIKVLGTPT
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQQPLFPGESGVDQLVEIIKVLGTPT  294

Query  622  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH  443
            REEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL H
Sbjct  295  REEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALIH  354

Query  442  PFFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            PFFDELRDP+ RLPNGRF+PPLFNFK HEL GVP E + KL+PEHARKQCPFLGL
Sbjct  355  PFFDELRDPNARLPNGRFLPPLFNFKSHELNGVPVEILAKLIPEHARKQCPFLGL  409



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  353  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>emb|CBI37005.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   337 bits (865),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  208  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  267

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  268  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  327

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+P+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  328  FFDELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  381



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  353  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTH 
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALTHH  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELK V  ET++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKNVHAETLLKLVPEHARKQCPSLGL  409



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP LRC++LDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPYLRCTSLDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHAR+QCP+LGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKAHELKGVPAEMVAKLVPEHARRQCPWLGL  409



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score =   342 bits (877),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGV  E ++KL+PEHARKQC FLGL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVSVEILVKLIPEHARKQCSFLGL  408



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGRF+PPL NFK HELKGV  E ++KLVPEHARKQC FLGL
Sbjct  356  FFDELRDQNTRLPNGRFLPPLSNFKSHELKGVSVEMLVKLVPEHARKQCAFLGL  409



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  233  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  292

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  293  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  352

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  353  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRD + RLPNGRF+PPLFNFK HELKGVP E +MKL+PEHARKQ PFL 
Sbjct  356  FFDELRDLNTRLPNGRFLPPLFNFKSHELKGVPVEILMKLIPEHARKQAPFLA  408



>ref|NP_001269276.1| glycogen synthase kinase-3 homolog MsK-1-like [Fragaria vesca]
 ref|XP_011465886.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011465887.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 gb|AEH02865.1| protein kinase [Fragaria vesca]
Length=412

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRD + RLPNGRF+PPLFNFK HELKGVP E +MKLVPEHARKQ PF+
Sbjct  358  FFDELRDLNTRLPNGRFLPPLFNFKSHELKGVPAEILMKLVPEHARKQVPFM  409



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRD + RLPNGRF+PPLFNFK HELKGVP E +MKL+PEHARKQ PFL 
Sbjct  356  FFDELRDLNTRLPNGRFLPPLFNFKSHELKGVPVEILMKLIPEHARKQVPFLA  408



>ref|XP_008778092.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008778093.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLL Q LFPGESGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLEQPLFPGESGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVPTE + KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPTEIVAKLIPEHARKQCAFLGL  409



>gb|ABG74911.1| AtSK12-like protein [Brassica napus]
Length=410

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  357  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  410



>ref|XP_010679446.1| PREDICTED: shaggy-related protein kinase NtK-1 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDA+THP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDAITHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK HELKGVP ET++++VPEHARKQC FLG
Sbjct  356  FFDELRDPNSRLPNGRPLPPLFNFKAHELKGVPEETLVRVVPEHARKQCGFLG  408



>ref|XP_008388444.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388445.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388446.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=412

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL H 
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALVHS  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET+MKLVPEHARKQ PFL 
Sbjct  358  FFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  410



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   337 bits (865),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELK V  E ++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|XP_012082965.1| PREDICTED: shaggy-related protein kinase alpha-like [Jatropha 
curcas]
 gb|KDP28311.1| hypothetical protein JCGZ_14082 [Jatropha curcas]
Length=409

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDP+ RLPNGRF+PPLFNFKPHEL+GVP E + KL+PEHARKQC FLGL
Sbjct  356  FFNELRDPNTRLPNGRFLPPLFNFKPHELRGVPVEMLAKLIPEHARKQCAFLGL  409



>ref|XP_009335521.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335522.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335523.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
Length=414

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  240  SRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  299

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL H 
Sbjct  300  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALVHS  359

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET+MKLVPEHARKQ PFL 
Sbjct  360  FFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  412



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+P+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  356  FFDELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  409



>ref|XP_010652295.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Vitis 
vinifera]
Length=390

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  217  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  276

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  277  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  336

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+P+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  337  FFDELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  390



>ref|XP_009363099.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Pyrus x 
bretschneideri]
Length=409

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQC FLG
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>ref|XP_008227813.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Prunus mume]
Length=410

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQC FLG
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>gb|ABB55385.1| Ser/Thr protein kinase-like [Solanum tuberosum]
Length=409

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDAL HP
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCGALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELK V  E ++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNARLPNGRILPPLFNFKPHELKGVPFEMLVKLIPEHARKQCAFLGL  409



>ref|XP_006650852.1| PREDICTED: shaggy-related protein kinase alpha-like [Oryza brachyantha]
Length=409

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESG+DQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGLDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSP+LRCSALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRIPPEAVDLVSRLLQYSPHLRCSALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+P HAR QCPFLGL
Sbjct  356  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEVVKKLIPGHARNQCPFLGL  409



>ref|XP_007221484.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
 gb|EMJ22683.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
Length=410

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQC FLG
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDAL HP
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCGALDALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELK V  E ++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|XP_009366055.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
 ref|XP_009366056.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
Length=412

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL H 
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALVHS  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET+MKLVPEHARKQ PFL 
Sbjct  358  FFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  410



>ref|XP_002455378.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
 gb|EES00498.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
Length=408

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP + + KL+PEHA+KQC ++GL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPADIVAKLIPEHAKKQCSYVGL  408



>ref|XP_009617298.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617299.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617301.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
Length=409

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSAL+A+TH 
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALEAVTHA  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFK HELKGV  ET++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAETLLKLVPEHARKQCPSLGL  409



>ref|XP_009383704.1| PREDICTED: shaggy-related protein kinase alpha [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR++PPLFNFKPHELKGVP E ++KL+PEHAR+QC FLGL
Sbjct  356  FFDELRDPNARLPNGRYLPPLFNFKPHELKGVPMEIVLKLIPEHARQQCAFLGL  409



>gb|KDO86867.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86868.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=292

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  119  SRYYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  178

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  179  EEIKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  238

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  239  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  292



>ref|XP_008353866.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
 ref|XP_009367184.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
 ref|XP_009367186.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
Length=409

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLV+IIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVQIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQC FLG
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>gb|KDO86866.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=373

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  200  SRYYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  259

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  260  EEIKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  319

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  320  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  373



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTSAIDIWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEA DLVSRLLQYSPNLRC+AL+A+ HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEATDLVSRLLQYSPNLRCTALEAMIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP++RLPNGR VPPLFNFKPHELKGV  E + +L+PEHARKQC FLGL
Sbjct  356  FFDELRDPNVRLPNGRVVPPLFNFKPHELKGVAVEMLGRLIPEHARKQCAFLGL  409



>ref|XP_009757512.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
 ref|XP_009757513.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
Length=409

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A+TH 
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHA  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFK HELKGV  E+++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAESLLKLVPEHARKQCPSLGL  409



>gb|EMT09676.1| Shaggy-related protein kinase alpha [Aegilops tauschii]
Length=418

 Score =   335 bits (860),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  245  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTR  304

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FH+RMPPEAVDLVSRLLQYSP+LR SALDAL HP
Sbjct  305  EEIKCMNPNYTEFKFPQIKAHPWHKVFHRRMPPEAVDLVSRLLQYSPHLRSSALDALIHP  364

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E   KLVPEHAR QCPFLGL
Sbjct  365  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAAKLVPEHARSQCPFLGL  418



>gb|AEN14336.1| hypothetical protein rf1-C1-g7 [Zea mays]
Length=408

 Score =   335 bits (859),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KL+PEHARKQC FL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFL  407



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  230  SRYYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  289

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  290  EEIKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  349

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARKQC FLGL
Sbjct  350  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  403



>tpg|DAA53951.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>ref|XP_008447666.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3, partial 
[Cucumis melo]
Length=205

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  32   SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  91

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  92   EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  151

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FF+ELRDP+ RLPNGRF+PPLFNFK HELKGVP E +++L+PEHARKQC FLG
Sbjct  152  FFNELRDPNTRLPNGRFLPPLFNFKAHELKGVPPEMLVRLIPEHARKQCNFLG  204



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCV+AEL+LG+ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVVAELMLGKPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFPKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP+GRF+PPLFNFK HELKGVP E ++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDPNARLPSGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  409



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  229  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  288

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  289  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  348

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVP+HARKQC +LGL
Sbjct  349  FFDELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPDHARKQCHWLGL  402



>sp|Q40518.1|MSK1_TOBAC RecName: Full=Shaggy-related protein kinase NtK-1 [Nicotiana 
tabacum]
 emb|CAA54803.1| shaggy like protein kinase [Nicotiana tabacum]
 prf||2106142A Ser/Thr protein kinase
Length=409

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A+TH 
Sbjct  296  EEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHA  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFK HELKGV  E ++KLVPEHARKQCP LGL
Sbjct  356  FFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAENLLKLVPEHARKQCPSLGL  409



>ref|XP_008812956.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Phoenix 
dactylifera]
Length=409

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL +P
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALINP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+P  RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQC FLGL
Sbjct  356  FFDELRNPDTRLPNGRFLPPLFNFKPHELKGVPMEIAAKLIPEHARKQCTFLGL  409



>emb|CDY27737.1| BnaA05g31460D [Brassica napus]
Length=514

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  340  SRYYRAPELIFGATEYTTAIDVWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  399

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HP
Sbjct  400  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALIHP  459

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF PPLFNFKPH ELKGVP E + KLVPEHARKQCP+LGL
Sbjct  460  FFDELRDPNARLPNGRFFPPLFNFKPHAELKGVPVEMVAKLVPEHARKQCPWLGL  514



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLV IIKVLGTPTR
Sbjct  232  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIKVLGTPTR  291

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  292  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  351

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PP F+FKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  352  FFDELRDPNARLPNGRFLPPAFHFKPHELKGVPLEMVAKLVPEHARKQCPWLGL  405



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP+GRF+PPLFNFKPHELKGVP E ++KL+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPSGRFLPPLFNFKPHELKGVPLEMLVKLIPEHARKQCAFLGL  409



>ref|XP_008812957.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Phoenix 
dactylifera]
Length=336

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  163  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  222

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL +P
Sbjct  223  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALINP  282

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELR+P  RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQC FLGL
Sbjct  283  FFDELRNPDTRLPNGRFLPPLFNFKPHELKGVPMEIAAKLIPEHARKQCTFLGL  336



>gb|KHG00969.1| Glycogen synthase kinase-3 MsK-3 [Gossypium arboreum]
Length=409

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGA EYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGAIEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +A++AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTAIEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP  RLPNGRF+PPLFNFKPHELKGVPT+ + KL+PEHA+KQC FLGL
Sbjct  356  FFDELRDPHTRLPNGRFLPPLFNFKPHELKGVPTDMLPKLIPEHAKKQCSFLGL  409



>ref|XP_006643997.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006643998.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=408

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P++ + KL+PEHA+KQC + G+
Sbjct  355  FFDELRDPNARLPNGRFLPPLFNFKPHELKGIPSDIMAKLIPEHAKKQCSYAGV  408



>ref|XP_004148581.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Cucumis 
sativus]
Length=409

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E +++L+PEHARKQC FLG
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPPEMLVRLIPEHARKQCNFLG  408



>ref|XP_011466950.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011466953.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRSTALEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E I+KL+P+HARKQC FL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMIVKLIPDHARKQCAFL  407



>gb|KJB49765.1| hypothetical protein B456_008G136600 [Gossypium raimondii]
Length=409

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +A++AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPLEAVDLVSRLLQYSPNLRSTAIEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVPT+ + KL+PEHA+KQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPTDMLPKLIPEHAKKQCSFLGL  409



>gb|EMS62368.1| Shaggy-related protein kinase alpha [Triticum urartu]
Length=455

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  282  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTR  341

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LR SALDAL HP
Sbjct  342  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPHLRSSALDALIHP  401

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E   KLVPEHAR QCPFLGL
Sbjct  402  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAAKLVPEHARSQCPFLGL  455



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLG-QTLFPGESGVDQLVEIIKVLGTPT  623
            SRYYRAPELIFGATEYT+AID+WS GCVLAELLL    LFPGESGVDQLVEIIKVLGTPT
Sbjct  237  SRYYRAPELIFGATEYTSAIDIWSVGCVLAELLLAFYPLFPGESGVDQLVEIIKVLGTPT  296

Query  622  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH  443
            REEIKCMNP+YTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTH
Sbjct  297  REEIKCMNPDYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTH  356

Query  442  PFFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            PFFDELRDP+ RLPNGRF+PPLFNFK HELKGVP E ++KLVPEHARKQCPFLGL
Sbjct  357  PFFDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  411



>ref|XP_008672929.1| PREDICTED: LOC100283734 isoform X1 [Zea mays]
Length=438

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  265  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  324

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  325  EEIKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  384

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  385  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  437



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCV+AEL+LG+ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVVAELMLGKPLFPGDSGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFPKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP+GRF+PPLFNFK HELK VP E ++KL+PEHARKQCPFLGL
Sbjct  356  FFDELRDPNARLPSGRFLPPLFNFKSHELKSVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_003566380.1| PREDICTED: shaggy-related protein kinase alpha [Brachypodium 
distachyon]
Length=408

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALIHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKP+ELKG P + + KL+PEHARKQC   GL
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPNELKGTPVDIVAKLIPEHARKQCSHAGL  408



>ref|NP_001042602.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAA92214.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAB40983.1| shaggy-related protein kinase gamma [Oryza sativa (japonica cultivar-group)]
 dbj|BAF04516.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAG94276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70327.1| hypothetical protein OsI_01196 [Oryza sativa Indica Group]
 gb|EEE54244.1| hypothetical protein OsJ_01119 [Oryza sativa Japonica Group]
Length=408

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P++ + KL+PEH +KQC + G+
Sbjct  355  FFDELRDPNARLPNGRFLPPLFNFKPHELKGIPSDIMAKLIPEHVKKQCSYAGV  408



>ref|XP_010070089.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Eucalyptus grandis]
 gb|KCW58654.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58655.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58656.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58657.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58658.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
Length=409

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNG F+PPLF+FK +ELKGVP E + KL+PEHARKQC  LGL
Sbjct  356  FFDELRDPNARLPNGLFLPPLFSFKSNELKGVPVEVLAKLIPEHARKQCSSLGL  409



>ref|XP_009401663.1| PREDICTED: shaggy-related protein kinase gamma [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLV+IIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVQIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKF QIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFSQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQC  293
            FFDELRD + RLPNGRF+PPLFNFKPHELKGVP ET+ +L+PEHARKQC
Sbjct  356  FFDELRDHNTRLPNGRFLPPLFNFKPHELKGVPVETVARLIPEHARKQC  404



>gb|AAB61055.1| Similar to shaggy related protein kinase. Belongs to the CDC2/CDKX 
subfamily [Arabidopsis thaliana]
Length=447

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 166/182 (91%), Gaps = 8/182 (4%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  266  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  325

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  326  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  385

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPH--------ELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRDP+ RLPNGRF+PPLFNFKPH        ELKGVP E + KLVPEHARKQCP+L
Sbjct  386  FFDELRDPNARLPNGRFLPPLFNFKPHGTTSPFPNELKGVPLEMVAKLVPEHARKQCPWL  445

Query  283  GL  278
            GL
Sbjct  446  GL  447



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLV IIKVLGTPTR
Sbjct  232  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIKVLGTPTR  291

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HP
Sbjct  292  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHP  351

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PP F+FKPH LKGVP E + KLVPEHARKQCP+LGL
Sbjct  352  FFDELRDPNARLPNGRFLPPAFHFKPHGLKGVPLEMVAKLVPEHARKQCPWLGL  405



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  234  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  293

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP
Sbjct  294  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  353

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK V  +T+++L PEH RKQ P  GL
Sbjct  354  FFDELRDPNTRLPNGRFLPPLFNFKPHELKDVNPDTVVRLNPEHMRKQSPGTGL  407



>ref|XP_011087526.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
 ref|XP_011087527.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
Length=409

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTT ID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTNIDIWSAGCVIAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFP+IKAHPWHKIFHKRMPPEA+DLVSR+LQYSPNLRCSALDALTHP
Sbjct  296  EEIKCMNPNYTEFKFPEIKAHPWHKIFHKRMPPEAIDLVSRVLQYSPNLRCSALDALTHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDP+ RLPNGR +PPLFNFKP ELK VP ET+ KL+PEHARK CP LGL
Sbjct  356  FFNELRDPNTRLPNGRSLPPLFNFKPQELKNVPEETLTKLIPEHARKHCPSLGL  409



>ref|XP_006841582.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1 [Amborella 
trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTSAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFH+RMP EAVDLVSRLLQYSPNLRCSALDA  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPAEAVDLVSRLLQYSPNLRCSALDACVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKGVP+E +++L+PEHARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGVPSEILVRLIPEHARKQCSFLGL  409



>ref|NP_001150105.1| LOC100283734 [Zea mays]
 gb|ACG37853.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
Length=408

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVS LLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSWLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  355  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>ref|XP_011087528.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Sesamum 
indicum]
Length=388

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTT ID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  215  SRYYRAPELIFGATEYTTNIDIWSAGCVIAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  274

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFP+IKAHPWHKIFHKRMPPEA+DLVSR+LQYSPNLRCSALDALTHP
Sbjct  275  EEIKCMNPNYTEFKFPEIKAHPWHKIFHKRMPPEAIDLVSRVLQYSPNLRCSALDALTHP  334

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDP+ RLPNGR +PPLFNFKP ELK VP ET+ KL+PEHARK CP LGL
Sbjct  335  FFNELRDPNTRLPNGRSLPPLFNFKPQELKNVPEETLTKLIPEHARKHCPSLGL  388



>ref|XP_007031507.1| Shaggy-like kinase 13 isoform 4 [Theobroma cacao]
 gb|EOY02433.1| Shaggy-like kinase 13 isoform 4 [Theobroma cacao]
Length=347

 Score =   329 bits (843),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  174  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  233

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  234  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  293

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  294  FFDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  347



>ref|XP_010070081.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070082.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070083.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070084.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070085.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070086.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070087.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070088.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
Length=412

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNG F+PPLF+FK +ELKGVP E + KL+PEHARKQC  LG 
Sbjct  356  FFDELRDPNARLPNGLFLPPLFSFKSNELKGVPVEVLAKLIPEHARKQCSSLGF  409



>gb|KDO66104.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66105.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66106.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
Length=185

 Score =   322 bits (825),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTA+D+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  12   SRYYRAPELIFGATEYTTAVDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  71

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  72   EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  131

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  132  FFDELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  185



>ref|NP_001288361.1| uncharacterized protein LOC103641344 [Zea mays]
 gb|ACF80579.1| unknown [Zea mays]
Length=410

 Score =   330 bits (846),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK VP + ++KLVPEHARKQC F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKNVPADFMVKLVPEHARKQCAFVG  409



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  359  FFDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  412



>ref|XP_006654010.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006654011.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=410

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E ++KL+PEHARKQC F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  409



>ref|XP_002440537.1| hypothetical protein SORBIDRAFT_09g002710 [Sorghum bicolor]
 gb|EES18967.1| hypothetical protein SORBIDRAFT_09g002710 [Sorghum bicolor]
Length=412

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEALIHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK VP + ++KL+PEHARKQC F+G
Sbjct  359  FFDELRDPNTRLPNGRFLPPLFNFKPHELKSVPMDFLVKLIPEHARKQCAFVG  411



>ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=410

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK +P + ++KL+PEHARKQC F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKSMPMDFLVKLIPEHARKQCAFVG  409



>ref|XP_010248490.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248491.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248492.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
Length=408

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRCTALEACVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  355  FFDELRDPSTRLPNGRPLPPLFNFKPQELKGATLELLAKLIPEHARKQCPFLGF  408



>ref|XP_009384996.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFP IK HPWHKIFHKR P EAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPHIKTHPWHKIFHKRTPREAVDLVSRLLQYSPNLRSTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF+ELRDPS RLPNGR++PPLFNFKP+ELKGVPTE + KL+PEHARKQC FLGL
Sbjct  356  FFEELRDPSARLPNGRYLPPLFNFKPNELKGVPTEIVSKLIPEHARKQCAFLGL  409



>gb|AAM77397.1| GSK-like kinase [Triticum aestivum]
Length=381

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  208  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  267

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  268  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  327

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  328  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  380



>ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=411

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFK HELKGVP + ++KLVPEHARKQC F+G
Sbjct  358  FFDELRDPNTRLPNGRFLPPLFNFKAHELKGVPMDILVKLVPEHARKQCTFVG  410



>gb|ABG29422.1| GSK-like kinase 1A [Triticum aestivum]
Length=410

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>emb|CDM82575.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCP  290
            FFDELRDP  RLPNGRF+PPLFNFKP+ELKG+P +   KL+PEHARKQ P
Sbjct  355  FFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPADVAAKLIPEHARKQSP  404



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEY+TAID+WSAGCVLAEL+LGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYSTAIDIWSAGCVLAELMLGQPLFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNP+YTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPHYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNFK HELKGVP E ++KL+P+HA+KQC FLG
Sbjct  357  FFDELRDPNTRLPNGRYLPPLFNFKSHELKGVPAEMLVKLIPDHAKKQCGFLG  409



>gb|EMS50777.1| Glycogen synthase kinase-3-like protein MsK-3 [Triticum urartu]
Length=397

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  224  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  283

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  284  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  343

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  344  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  396



>ref|NP_001054564.1| Os05g0134000 [Oryza sativa Japonica Group]
 gb|AAT94043.1| putative glycogen synthase kinase [Oryza sativa Japonica Group]
 dbj|BAF16478.1| Os05g0134000 [Oryza sativa Japonica Group]
 dbj|BAG86642.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62230.1| hypothetical protein OsJ_17017 [Oryza sativa Japonica Group]
Length=411

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +A +AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTASEALIHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E ++KL+PEHARKQC F+G
Sbjct  358  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>dbj|BAF36565.1| Shaggy-like kinase [Triticum aestivum]
Length=406

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HP
Sbjct  295  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQ  296
            FFDELRDP  RLPNGRF+PPLFNFKP+ELKG+P +   KL+PEHARKQ
Sbjct  355  FFDELRDPGTRLPNGRFLPPLFNFKPNELKGIPADVAAKLIPEHARKQ  402



>ref|XP_009403747.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403755.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNY EFKFPQIK HPWHKIFHK+MP EAVDLVSRLLQYSP+LRC+AL+AL HP
Sbjct  296  EEIKCMNPNYNEFKFPQIKVHPWHKIFHKQMPLEAVDLVSRLLQYSPSLRCTALEALIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELR+ S RLPNGRF+PPLFNFKPHELKGVPTE + KL+PEHARKQC  LG
Sbjct  356  FFDELRNQSTRLPNGRFLPPLFNFKPHELKGVPTEMVAKLIPEHARKQCVGLG  408



>gb|ABC94949.1| GSK-like kinase [Aegilops tauschii]
 gb|ABG29427.1| GSK-like kinase 1 [Aegilops tauschii]
Length=410

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR+P EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRVPAEAVDLVSRLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>emb|CDP17018.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SR+YRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  213  SRFYRAPELIFGATEYTTAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  272

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  273  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRSTALEALIHP  332

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+  LPNGRF+PPLFNF+PHEL GVP E ++KL+PEHARKQC FL  
Sbjct  333  FFDELRDPNTHLPNGRFLPPLFNFRPHELNGVPMEIMVKLIPEHARKQCSFLNF  386



>gb|ABK24355.1| unknown [Picea sitchensis]
Length=370

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  197  SRYYRAPELIFGATEYTTAIDIWSMGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  256

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  257  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  316

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   + ++KL+PEHARKQCPFL L
Sbjct  317  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGATPDLLIKLIPEHARKQCPFLNL  370



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTA+D+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  256  SRYYRAPELIFGATEYTTAVDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  315

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  316  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  375

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  376  FFDELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  429



>ref|XP_010251219.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  209  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  268

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR LQYSPNLRC+AL+A  HP
Sbjct  269  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRFLQYSPNLRCTALEACVHP  328

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQCPFL  
Sbjct  329  FFDELRDPSTRLPNGRPLPPLFNFKPQELKGATLELVARLIPEHARKQCPFLSF  382



>gb|AAY98510.1| glycogen synthase kinase [Oryza sativa Japonica Group]
Length=411

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +A +AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTAPEALIHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E ++KL+PEHARKQC F+G
Sbjct  358  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKV-LGTPT  623
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKV LGTPT
Sbjct  239  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVVLGTPT  298

Query  622  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH  443
            REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  H
Sbjct  299  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  358

Query  442  PFFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            PFFDELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  359  PFFDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  413



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR LQYSPNLRC+AL+A  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRFLQYSPNLRCTALEACVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQCPFL  
Sbjct  356  FFDELRDPSTRLPNGRPLPPLFNFKPQELKGATLELVARLIPEHARKQCPFLSF  409



>ref|XP_011622016.1| PREDICTED: shaggy-related protein kinase epsilon [Amborella trichopoda]
Length=409

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLG  LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDMWSVGCVLAELLLGSPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDA  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDACVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGR +PPLFNFKP ELKG   E + KL+PEH+RKQCPFLG+
Sbjct  356  FFDELRDANARLPNGRPLPPLFNFKPQELKGASLEVLAKLIPEHSRKQCPFLGI  409



>gb|ABC94948.1| GSK-like kinase [Aegilops speltoides]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  208  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  267

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  268  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  327

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFN KPHELKGVP   ++KL+PEHARK C F+G
Sbjct  328  FFDELRDPNTRLPNGRFLPPLFNLKPHELKGVPMGILVKLIPEHARKNCAFVG  380



>emb|CDP02094.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEY+TAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYSTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FF+ELRDPS RLPNGR +PPLFNF+P ELKG   E I KL+PEHAR QCPF+G
Sbjct  357  FFNELRDPSTRLPNGRPLPPLFNFRPQELKGASLELIAKLIPEHARNQCPFIG  409



>gb|ABG29426.1| GSK-like kinase 1 [Aegilops speltoides]
Length=410

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFN KPHELKGVP   ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNLKPHELKGVPMGILVKLIPEHARKNCAFVG  409



>gb|ABG29424.1| GSK-like kinase 1D [Triticum aestivum]
Length=410

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVS LLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSGLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_004141099.2| PREDICTED: shaggy-related protein kinase epsilon [Cucumis sativus]
 gb|KGN59685.1| hypothetical protein Csa_3G838640 [Cucumis sativus]
Length=410

 Score =   325 bits (833),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>gb|EAY96448.1| hypothetical protein OsI_18343 [Oryza sativa Indica Group]
Length=411

 Score =   325 bits (833),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF+KRMP EAVDLVSRLLQYSP LR +A +AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFYKRMPAEAVDLVSRLLQYSPYLRSTASEALIHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKG+P E ++KL+PEHARKQC F+G
Sbjct  358  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  220  SRYYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  279

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  280  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  339

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  340  FFDELRDQNSRLPNGRPLPPLFNFKPQELKGASLELLAKLIPEHARKQCPFLGF  393



>ref|XP_003518657.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Glycine 
max]
Length=409

 Score =   325 bits (833),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALAHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP E ++KL+P HARKQC    
Sbjct  356  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPEMLVKLIPSHARKQCALFA  408



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRD + RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  359  FFDELRDQNSRLPNGRPLPPLFNFKPQELKGASLELLAKLIPEHARKQCPFLGF  412



>gb|EMT00762.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii]
Length=397

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  224  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  283

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  284  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHP  343

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+  LPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  344  FFDELRDPNTCLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  396



>gb|AFK38277.1| unknown [Medicago truncatula]
 gb|AES82238.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            F+DELRDP+ RLPNGRF+PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  358  FYDELRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFA  410



>ref|XP_003626019.1| Protein kinase, putative [Medicago truncatula]
Length=411

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            F+DELRDP+ RLPNGRF+PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  357  FYDELRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFA  409



>ref|XP_008443540.1| PREDICTED: shaggy-related protein kinase epsilon [Cucumis melo]
Length=410

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFL  284
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>gb|ABG29423.1| GSK-like kinase 1B [Triticum aestivum]
Length=410

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELI GATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELILGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHK MP EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKGMPAEAVDLVSRLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELKGVP + ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>sp|P51139.2|MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3 [Medicago 
sativa]
Length=411

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            F+D++RDP+ RLPNGRF+PPLFNFK +ELKGVP E ++KLVP HARKQC   G
Sbjct  357  FYDDVRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFG  409



>emb|CAA48472.1| protein kinase [Medicago sativa]
Length=412

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            F+D++RDP+ RLPNGRF+PPLFNFK +ELKGVP E ++KLVP HARKQC   G
Sbjct  358  FYDDVRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFG  410



>ref|XP_006446533.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446535.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59773.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59775.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=409

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF ELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  356  FFYELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  409



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  256  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  315

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  316  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHP  375

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FF ELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  376  FFYELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  429



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFN+KP ELKG   E + KL+P+HARKQC FLGL
Sbjct  356  FFDELRDPNTRLPNGRPLPPLFNYKPQELKGASLELLSKLIPDHARKQCSFLGL  409



>ref|XP_008662920.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
Length=410

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF  +MP EAVDLVSRLLQYSP LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFRLKMPAEAVDLVSRLLQYSPKLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK VP + ++KLVPEHARKQC F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKNVPADFMVKLVPEHARKQCAFVG  409



>ref|XP_004967591.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Setaria italica]
 ref|XP_004967592.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Setaria italica]
Length=408

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            +EIK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  295  DEIKRMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPNLRCTALEALIHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +P LFNFKP+EL+GVP E +MKL+P+HA+KQC FLG+
Sbjct  355  FFDELRDPNARLPNGRSLPHLFNFKPNELRGVPMEFLMKLIPQHAKKQCAFLGI  408



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  358  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAL  411



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRM PEA DLVSRLLQYSPNLRC+AL+A+ HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMSPEAADLVSRLLQYSPNLRCTALEAIVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLF+FKP ELKG   E + KL+PEH RKQC FLG 
Sbjct  356  FFDELRDPNTRLPNGRPLPPLFSFKPQELKGASLELLAKLIPEHERKQCSFLGF  409



>gb|ABC94947.1| GSK-like kinase [Triticum monococcum]
 gb|ABG29425.1| GSK-like kinase 1 [Triticum monococcum]
Length=410

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRM  EAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMLAEAVDLVSRLLQYSPSLRSTALEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGRF+PPLFNFKPHELK VP + ++KL+PEHARK C F+G
Sbjct  357  FFDELRDPNTRLPNGRFLPPLFNFKPHELKDVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_007140965.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
 gb|ESW12959.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
Length=402

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  229  SRYYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  288

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDA  HP
Sbjct  289  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDACVHP  348

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KLVPEHARKQCP L  
Sbjct  349  FFDELRDPNTRLPNGRPMPPLFNFKPQELKGVTLELLCKLVPEHARKQCPSLNF  402



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP EL+G   E + KL+P+HARKQC FL L
Sbjct  358  FFDELRDPNTRLPNGRPLPPLFNFKPQELRGASVELLSKLIPDHARKQCSFLAL  411



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTT ID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  357  FFDELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQCSFLAL  410



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGAT+YTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATDYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR+LQYSPNLRC+A++AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRVLQYSPNLRCTAVEALIHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQC-PFLGL  278
            FFDELRDP++RLPNGRF+PPLFNFK  ELKGV  E + +L+PEHARKQ  PFLGL
Sbjct  357  FFDELRDPNVRLPNGRFLPPLFNFKQQELKGVAMELLERLIPEHARKQQPPFLGL  411



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC+AL+A  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFD+LRDP+ RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQC FLG+
Sbjct  356  FFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAFLGI  409



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  358  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLLPDHARKQCSFLAL  411



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC+AL+A  HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFD+LRDP+ RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQC FLG+
Sbjct  356  FFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAFLGI  409



>ref|XP_008357735.1| PREDICTED: shaggy-related protein kinase epsilon [Malus domestica]
Length=410

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRFTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDP+ RLPNGR +PPLFNFKP ELKG   E + KLVPEHARKQC FLG
Sbjct  357  FFDQLRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLVPEHARKQCAFLG  409



>dbj|BAG95540.1| unnamed protein product [Oryza sativa Japonica Group]
Length=292

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  119  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTR  178

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRCSAL+ L HP
Sbjct  179  EEIKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCSALEVLIHP  238

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E ++KLVP+HA+KQC FLGL
Sbjct  239  FFDELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  292



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + K++P+HARKQC FL +
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASLELLAKIIPDHARKQCSFLAI  410



>ref|XP_009334099.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334100.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334101.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
Length=410

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEY+TAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYSTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+ L HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRFTALEVLVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDPS RLPNGR +PPLFNFKP ELKG   E + KLVPEHARKQC FLG
Sbjct  357  FFDQLRDPSTRLPNGRPLPPLFNFKPQELKGATLELLSKLVPEHARKQCAFLG  409



>ref|NP_001042804.1| Os01g0296100 [Oryza sativa Japonica Group]
 dbj|BAB55743.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF04718.1| Os01g0296100 [Oryza sativa Japonica Group]
 dbj|BAG99913.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54392.1| hypothetical protein OsJ_01412 [Oryza sativa Japonica Group]
Length=408

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRCSAL+ L HP
Sbjct  295  EEIKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCSALEVLIHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E ++KLVP+HA+KQC FLGL
Sbjct  355  FFDELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  408



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  410



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HP
Sbjct  296  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  356  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  409



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  410



>gb|KHN00229.1| Glycogen synthase kinase-3 like MsK-3 [Glycine soja]
Length=585

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  412  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTR  471

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  472  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALAHP  531

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP E ++KL+P HARKQC    
Sbjct  532  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPEMLVKLIPSHARKQCALFA  584



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSP+LR +A++A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPSLRSTAMEAIVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP EL G  +E + KL+P+HARKQC FL L
Sbjct  357  FFDELRDPNTRLPNGRPLPPLFNFKPQELNGASSELLSKLIPDHARKQCSFLAL  410



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGAT+YTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  283  SRYYRAPELIFGATDYTTAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  342

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LRC+AL+AL HP
Sbjct  343  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPSLRCNALEALVHP  402

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDPS RLPNGR +P LFNFKP ELKG   E + +L+PEHARKQ PFL L
Sbjct  403  FFDELRDPSTRLPNGRPLPALFNFKPLELKGASQELLERLIPEHARKQVPFLAL  456



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  250  SRYYRAPELIFGATEYTTAIDIWSMGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  309

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRCS+L+AL HP
Sbjct  310  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCSSLEALAHP  369

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPL+NFK  ELKG   E + +LVPEHARKQ PFL L
Sbjct  370  FFDELRDPNTRLPNGRPLPPLYNFKQLELKGASPELLNRLVPEHARKQVPFLAL  423



>ref|XP_006588498.1| PREDICTED: uncharacterized protein LOC100817819 isoform X2 [Glycine 
max]
Length=382

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  209  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTR  268

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  269  EEIKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHP  328

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP   ++KL+P HARKQC    
Sbjct  329  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  381



>ref|XP_003591342.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
 gb|AES61593.1| glycogen synthase kinase [Medicago truncatula]
Length=293

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  119  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  178

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  179  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  238

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  239  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  291



>ref|NP_001242506.1| uncharacterized protein LOC100817819 [Glycine max]
 gb|ACU18867.1| unknown [Glycine max]
Length=374

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  201  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTR  260

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  261  EEIKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHP  320

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP   ++KL+P HARKQC    
Sbjct  321  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  373



>gb|KHN00323.1| Glycogen synthase kinase-3 like MsK-2 [Glycine soja]
Length=373

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  200  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTR  259

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  260  EEIKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHP  319

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP   ++KL+P HARKQC    
Sbjct  320  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  372



>ref|XP_006588497.1| PREDICTED: uncharacterized protein LOC100817819 isoform X1 [Glycine 
max]
Length=409

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  236  SRYYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTR  295

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HP
Sbjct  296  EEIKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHP  355

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR++PPLFNF+ +ELKGVP   ++KL+P HARKQC    
Sbjct  356  FFDELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  408



>ref|XP_006644095.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like [Oryza 
brachyantha]
Length=408

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR
Sbjct  235  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTR  294

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRC+AL+ L HP
Sbjct  295  EEIKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCTALEVLIHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E ++KLVP+HA+KQC FLGL
Sbjct  355  FFDELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  408



>ref|XP_003591341.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
 gb|AES61592.1| glycogen synthase kinase [Medicago truncatula]
Length=379

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  205  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  264

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  265  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  324

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  325  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  377



>ref|XP_003591339.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=373

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  199  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  258

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  259  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  318

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  319  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  371



>ref|XP_003591340.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=411

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  357  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  409



>gb|AES61591.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  238  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  297

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  298  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  357

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  358  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  410



>sp|P51138.1|MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2 [Medicago 
sativa]
 emb|CAA48473.1| protein kinase [Medicago sativa]
Length=411

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFDELRDP+ RLPNGR +PPLFNFK +ELKGVP E ++KLVP HARKQC    
Sbjct  357  FFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCSLFA  409



>ref|XP_006338576.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
Length=410

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H 
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALAHA  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+  LPNGR +PPLFNF+P ELKG  +E + KL+PEHA+KQCP LG 
Sbjct  357  FFDELRDPNAGLPNGRPLPPLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGF  410



>ref|XP_006338577.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=404

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  231  SRYYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  290

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H 
Sbjct  291  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALAHA  350

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+  LPNGR +PPLFNF+P ELKG  +E + KL+PEHA+KQCP LG 
Sbjct  351  FFDELRDPNAGLPNGRPLPPLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGF  404



>ref|XP_004304635.1| PREDICTED: shaggy-related protein kinase epsilon [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  239  SRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  298

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSP+LRC+AL+A  HP
Sbjct  299  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPSLRCTALEACVHP  358

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLG  281
            FFD+LRDP+ RLPNGR +PPLFNF+P ELKG  +E + +L+P+H RKQC FLG
Sbjct  359  FFDQLRDPTTRLPNGRPLPPLFNFRPQELKGATSELLSRLIPDHTRKQCAFLG  411



>ref|XP_001763270.1| predicted protein [Physcomitrella patens]
 gb|AAQ23106.1| shaggy-related protein kinase 1 [Physcomitrella patens]
 gb|EDQ71800.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  249  SRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  308

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  309  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHP  368

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  369  FFDELRDPNCRLPNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLAL  422



>gb|AAQ23111.1| shaggy-related protein kinase 1 [Physcomitrella patens]
Length=410

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHP  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  357  FFDELRDPNCRLPNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLAL  410



>gb|AFN42826.1| GSK3-like protein [Marsilea vestita]
 gb|AFN42827.1| gsk3-like protein [Marsilea vestita]
Length=392

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ +FPGESGVDQLVEIIKVLGTPTR
Sbjct  218  SRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPIFPGESGVDQLVEIIKVLGTPTR  277

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYT+FKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+A  HP
Sbjct  278  EEIKCMNPNYTDFKFPQIKAHPWHKMFHKRMPPEAVDLVSRLLQYSPNLRFTALEACIHP  337

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E I KL+PEHAR+Q PFLG 
Sbjct  338  FFDELRDPNTRLPNGRPLPPLFNFKPPELKGATLEMIQKLIPEHARRQNPFLGF  391



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTT ID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A  A+ HP
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTA--AIVHP  354

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  355  FFDELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQCSFLAL  408



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTFAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+A TH 
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEACTHT  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP  RLPNGR +PPLFNF+P ELKG   E + KL+PEHA+KQC  LG 
Sbjct  357  FFDELRDPKARLPNGRSLPPLFNFRPQELKGASAELLNKLIPEHAKKQCTSLGF  410



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  250  SRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  309

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  310  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHP  369

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RL NGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  370  FFDELRDPNCRLSNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLSL  423



>ref|XP_004232308.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
 ref|XP_010316289.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=410

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H 
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALGHA  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ R PNGR +P LFNF+P ELKG  +E + KL+PEHA+KQCP LG+
Sbjct  357  FFDELRDPNARPPNGRPLPSLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGV  410



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  250  SRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  309

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  310  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHP  369

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RL NGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  370  FFDELRDPNCRLSNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLSL  423



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  219  SRYYRAPELIFGATEYTFAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  278

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+A TH 
Sbjct  279  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEACTHS  338

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP  RLPNGR +PPLFNF+P ELKG   E + KL+PEHA+KQC  LG 
Sbjct  339  FFDELRDPKTRLPNGRPLPPLFNFRPQELKGASAELLNKLIPEHAKKQCTSLGF  392



>gb|AAQ23110.1| shaggy-related protein kinase 5 [Physcomitrella patens]
Length=355

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  182  SRYYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  241

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HP
Sbjct  242  EEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHP  301

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP+ RLP+GR +PPLFNFK  ELKG   E + +L+PEHARKQ P L L
Sbjct  302  FFDELRDPNCRLPSGRPLPPLFNFKRQELKGASPEILQRLLPEHARKQNPMLAL  355



>ref|XP_006364003.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364004.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=410

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  799  SRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTR  620
            SRYYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTR
Sbjct  237  SRYYRAPELIFGATEYTFAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTR  296

Query  619  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHP  440
            EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+A TH 
Sbjct  297  EEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEACTHS  356

Query  439  FFDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETIMKLVPEHARKQCPFLGL  278
            FFDELRDP  RLPNGR +PPLFNF+P ELKG   E + KL+PEHA+KQC  LG 
Sbjct  357  FFDELRDPKTRLPNGRPLPPLFNFRPQELKGASAELLNKLIPEHAKKQCTSLGF  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876